Commit graph

5195 commits

Author SHA1 Message Date
Martin Nordholts
4fcd3024f1 app: Set a GimpContext on GimpDockColumns
In order to make a GimpDock get hold of a GimpContext both in
single-window mode and in multi-window mode, don't make it look for a
GimpContext in a GimpDockWindow, put the context in GimpDockColumns
instead. GimpDockColumns exists both in s-w-m and m-w-m, contrary to
GimpDockWindow. Still use the GimpDockWindow as a backup though.
2010-01-05 11:31:15 +01:00
Martin Nordholts
64896eed7f app: Add run-time check to gimp_dock_columns_get_docks() 2010-01-05 10:37:03 +01:00
Martin Nordholts
1e62e58f61 app: gimp_dockable_set_dockbook() must be able to take NULL 2010-01-05 10:28:16 +01:00
Martin Nordholts
f8410035f1 app: Ref dockables in DnD signal code
Use g_signal_connect_object() instead of g_signal_connect() so that
the dockable is referenced and not destroyed before
_drag_end(). Prevents a crash, but DnD in single-window mode does not
work properly yet.
2010-01-05 10:26:07 +01:00
Martin Nordholts
be653a7110 app: Seal GimpDockable and add necessary getters and setters 2010-01-05 00:32:35 +01:00
Michael Natterer
bb852184e1 app: pass the drop_path to GimpContainerTreeView::drop_possible()
Together with some more refactoring, this will soon enable smarter
layer group dnd behavior.
2009-12-28 21:10:04 +01:00
Martin Nordholts
ad56949d5b app: Make gimp_tool_options_editor_new() use only g_object_new()
In preparation for cleaning up the dialog factory stuff, start making
dockable constructable with just g_object_new(). First out is
gimp_tool_options_editor_new(). Move code from that function into
gimp_tool_options_editor_constructor() and add the necessary "gimp"
GObject property. The regression test
"/gimp-ui/tool-options-editor-updates" still passes after the
refactoring, of course.
2009-12-24 17:50:39 +01:00
Martin Nordholts
0f7c373f3b app: Add gimp_tool_options_editor_get_tool_options()
Add gimp_tool_options_editor_get_tool_options() for unit testing
purposes.
2009-12-24 17:50:39 +01:00
Martin Nordholts
cf5d4953fd app: Add GimpToolOptionsEditorPrivate
Add GimpToolOptionsEditorPrivate and format static function
prototypes.
2009-12-23 22:39:47 +01:00
Martin Nordholts
90d7ffde1a app: Make all GimpDialogFactory members private
Add necessary trivial API that allows us to make remaining
GimpDialogFactory instance members private, and make them private.
2009-12-20 20:21:26 +01:00
Martin Nordholts
8699511bbd app: global_dock_window_factory -> global_dock_factory
With GimpDock not being a toplevel any longer, it makes more sense to
name global_dock_factory global_dock_window_factory. Do that.
2009-12-20 14:41:02 +01:00
Martin Nordholts
b8fe7278c8 app: Add GimpDialogFactoryPrivate
Add and use GimpDialogFactoryPrivate for the members that are not used
by clients. Remove initialiation in _init() for member put in the
private struct, the struct is zeroed for us.
2009-12-20 12:30:59 +01:00
Martin Nordholts
1ed1f5e31d app: Format static function prototypes in widgets/gimpdialogfactory.c 2009-12-20 12:28:12 +01:00
Martin Nordholts
2b7f8f7a7e app: Inline gimp_dialog_factory_show_toolbox()
Merge gimp_dialog_factory_show_toolbox() into the only caller
windows_show_toolbox() to get rid of one non-generic GimpDialogFactory
function.
2009-12-19 09:23:47 +01:00
Martin Nordholts
ef6bd20c3b app: When paned widget is removed, clear drag handler
When paned widget is removed, clear drag handler. Not clearing was a
copy and paste mistake.
2009-12-17 19:51:13 +01:00
Alexia Death
60705f79e9 app: Making spacing available as dynamic parameter
Spacing is now dynamically controllable. Unlike other parameters it
made little sense to scale down from default spacing so it scales between
current and maximum spacing.
2009-12-13 22:46:09 +02:00
Martin Nordholts
65c5541faf app: Don't crash when detaching dockables from image window
Don't crash when detaching dockables from the image window. This
scenario only occurs in single-window mode. We solve it by using
global variables and checking for NULL for src_dock_window; there is
no dock window when detaching from the image window.

The use of global variables is meant to be temporary.
2009-12-10 19:30:49 +01:00
Michael Natterer
c02d28643f app: fix gimp_button_menu_position() to not add the y position twice
Fixes commit 4822ca0d6d from ages ago,
does nobody around here actually *use* master?
2009-12-10 12:20:03 +01:00
Martin Nordholts
34ad9dad1a app: Session manage multi-column dock windows
Introduce GimpSessionInfoDock and session manage multi-column dock
windows. We are still backwards compatible with sessionrc, the only
difference is that a "session-info" entry now can have multiple "dock"
entries.

Also make ond dock window multi-column in the regression test
app/tests/test-session-management.c and adjust positions and image
selection menus a bit.
2009-12-06 14:49:53 +01:00
Martin Nordholts
bfd91ebdb7 app: Append in gimp_dock_columns_add_dock()
Append new docks to the GimpDockColumns list to preserve the order of
addition. This will become important when we serialize the docks into
sessionrc.
2009-12-06 14:36:57 +01:00
Martin Nordholts
482f31cd3f app: Add GimpMenuFactoryPrivate
Add GimpMenuFactoryPrivate. Note that we don't introduce a Gimp-getter
since the menu factory is globally accesible and we want to have as
much control as possible in who can get the Gimp instance.
2009-12-06 10:23:05 +01:00
Martin Nordholts
3bb15eac78 app: Move out dock window logic from gimp_session_info_dock_restore()
Move out dock window logic, most notably aux info, from
gimp_session_info_dock_restore() and put it in
gimp_session_info_restore() where it belongs.
2009-12-05 22:43:32 +01:00
Martin Nordholts
1bf84999e4 Move the Image Selection Menu to GimpDockWindow
Move the Image Selection Menu from GimpMenuDock to
GimpDockWindow. That is, if a dock window contains many docks then
they will share the same Image Selection Menu.

To do this we need to move around quite a bit of code. Move the
"context", "dialog-factory" and "ui-manager" properties from GimpDock
to GimpToolbox, GimpMenuDock doesn't need it any longer. Turn the
GimpDock getters for these properties into wrappers that go to the
GimpDockWindow properties. In some places, most notably GimpToolbox
construction, we use the GimpToolbox values of these properties, but
most of the time it works fine to just use the GimpDockWindow
properties. GimpDock::setup() and set/get_aux_info() have also been
moved to GimpDockWindow since the only aux info for docks was for the
image selection menu.

Also, we don't bother porting gimp_menu_dock_destroy() to
GimpDockWindow, but we leave the code around. If this is a problem, it
will show.
2009-12-05 21:21:24 +01:00
Martin Nordholts
cb854e6ad7 app: Only do necessary init in gimp_dock_window_init()
The private instance data struct is zeroed out for us so we don't need
to assign NULL, FALSE and 0 to private instance data members in
gimp_dock_window_init().
2009-12-05 12:38:55 +01:00
Martin Nordholts
df44751292 app: Add GimpMenuDockPrivate
Add GimpMenuDockPrivate which requires two new trivial getters.
2009-12-05 09:54:40 +01:00
Martin Nordholts
d33f643f6b app: Move GimpDockWindow::"font-scale" style property to GimpDock
To make the smaller font in docks also apply in single-window mode,
move the GimpDockWindow::font-scale style property to GimpDock. We use
the GimpDockWindow approach, so now each GimpDock has a name of the
form "gimp-internal-dock-<id>". We add "internal" to avoid clashing
with the GimpDockWindow legacy id "gimp-dock-<id>".
2009-12-03 23:08:30 +01:00
Martin Nordholts
5ae5ef0f9f app: dock_ID -> dock_window_ID in gimp_dock_window_init() 2009-12-03 21:51:56 +01:00
Martin Nordholts
4ccb650435 Exterminate GimpDockSeparator
Remove all GimpDockSeparator-related code. Seems pointless to keep
even the stuff in gtkrc.
2009-12-02 20:40:39 +01:00
Martin Nordholts
c08c6e21e0 app: Add gimp_dialog_factory_dock_new() 2009-12-01 22:18:04 +01:00
Martin Nordholts
95bab5da5f app: gimp_dialog_factory_dock_new() -> _dock_with_window_new() 2009-12-01 21:42:24 +01:00
Martin Nordholts
7b85cf4de8 app: Use a GdkWindow instead of GimpDockSeparators for dockable DND
Make drag-and-drop rearrangement of dockables happen directly in the
existing widget hierarchy so we don't have to use special, ugly
widgets (read GimpDockSeparator:s) for that.

More specifically, make edges of dockables and dockbooks have the same
semantics as the GimpDockSeparators had. We put a highlight colored
GdkWindow on top of the widget in question to highlight these special
drop areas. This GdkWindow is not taken into consideration in the GTK+
drag-and-drop code, so it does not interupt the DND interaction.

To achive this, there is a problem we must solve: Drag events in GTK+
are propagated inwards and out, but we sometimes want ancenstor
widgets to take care of drop events. We solve this by introducing the
concept of "drag handlers". A drag handler is asked if it will handle
a given drag event, and if it will, a client will let the drag event
be propagated upwards in the widget hierarchy. Right now, the
GimpPanedBox is the only "drag handler". The code could be generalized
more but it doesn't feel worth it at this point.

The size of the special drop area is 5px, the same size as the default
GtkPaned handles. This is because the plan is to later use these
handles as drop areas too.

Other changes of interest are:
 * We need to take care of "drag-motion", "drag-drop" and widget
   highlightning ourselves. We can not use the GtkDestDefaults
   conveniences with gtk_drag_dest_set() any longer since we need more
   control.
 * Make the drop callback pass the insert index directly instead of a
   GimpDockSeparator
 * Add some GIMP_LOG() debug output for DND
 * Disable the GimpDockSeparator code in GimpToolbox
2009-11-29 18:22:12 +01:00
Martin Nordholts
9ea1d490a4 app: Make gimp_paned_box_remove_widget() more destruction friendly
When closing a GimpDockWindow, the GtkBox code might already have
removed the widget. In that case we don't need to do anything.
2009-11-29 15:07:40 +01:00
Martin Nordholts
e4e7bf8471 app: Add and use gimp_highlight_widget()
Add gimp_highlight_widget() so we can simplify
gimp_dockbook_tab_drag_motion() a bit.
2009-11-28 19:12:39 +01:00
Michael Natterer
b45454bc6c Make the popup arrow look sane again
Render the arrow to a temp GdkPixmap, turn it into a GdkPixbuf and set
the pixbuf as icon on the GtkEntry.
2009-11-15 21:35:34 +01:00
Martin Nordholts
a685508713 app: Make GimpDockColumns listen to "dock-removed"
Make GimpDockColumns listen to "dock-removed", not "dockbook-removed",
when trying to figure out when to destroy itself. Fixes some crashes
when rearranging the UI, for example when doing this step-by-step:

1. Have two dock windows with one dockable each, say A and B
2. Move A to B's dock window and make it multi-column
3. Try to detach B, will result in a crash
2009-11-15 21:26:17 +01:00
Michael Natterer
79563b99c2 Use GtkEntry's icon feature instead of reimplementing our own popup arrow
Removes tons of code but looks ugly because it uses GTK_STOCK_GO_DOWN
currently, will fix that. Also did some random small cleanups and
removed unused members from the instance struct.
2009-11-15 20:30:57 +01:00
Martin Nordholts
b5eae26c4b app: gimp_dock_columns_dock_book_remove() -> _removed() 2009-11-15 19:51:15 +01:00
Martin Nordholts
13bac61020 app: Move g_list_copy() out from gimp_dock_columns_get_docks()
Move g_list_copy() out from gimp_dock_columns_get_docks(). Fixes at
least one memory leak (in gimp_dock_window_get_dock()) and feels nicer
and more flexible.
2009-11-15 19:21:57 +01:00
Martin Nordholts
8a473663d5 app: Fix gimp_dock_separator_get_insert_pos(), we must return an index
The insert position for new column in GimpDockColumns was sometimes
wrong, the problem was in gimp_dock_separator_get_insert_pos() not
return an index but a GtkAnchorType. Convert from GtkAnchorType to an
insert index.
2009-11-15 16:10:59 +01:00
Martin Nordholts
ae2f595f12 app: Remove empty GimpDocks from GimpDockColumns 2009-11-15 15:57:49 +01:00
Martin Nordholts
12530bfcf1 app: Add GimpDockColumns "dock-added" and "dock-removed" signals 2009-11-15 15:57:49 +01:00
Michael Natterer
0715c58c13 Fix the find_widget_under_pointer() code to build with GSEAL_ENABLE 2009-11-11 21:01:21 +01:00
Michael Natterer
e4d8a36080 Store the active dynamics with the input device
Also remove cruft #include <stdio.h>
2009-11-07 17:39:02 +01:00
Michael Natterer
2651c2517b Bail our from expose() when the event doesn't come from entry->text_area 2009-11-06 12:04:58 +01:00
Michael Natterer
dd3c1d5eb5 Use the standard system mouse cursor over the popup arrow 2009-11-05 22:48:11 +01:00
Martin Nordholts
397650bc46 app: Remove #include "gimpdockseparator.h" in gimpwidgets-utils.c 2009-10-31 20:56:28 +01:00
Michael Natterer
22767ca7b8 Seal GimpData completely and add the missing accessors 2009-10-31 18:48:38 +01:00
Michael Natterer
398607ee94 Bug 599765 - F1 key on gimp-tool-align in menu have wrong link and it open gimp-tool-move
Add help ID "gimp-tool-align" and use it for the align tool.
2009-10-27 18:54:34 +01:00
Martin Nordholts
624bb78c4c app: Move down gimp_dock_window_from_dock() in the file
Move down gimp_dock_window_from_dock() in the file as it is a special
kind of function.
2009-10-26 07:52:07 +01:00
Martin Nordholts
dd96705549 app: Allow multi-column dock windows by drag-and-drop
When dropping a dockable on a dock separator on the side of e.g. a
dock window, a new column of dockables will be created. This allows
multi-column dock window setups.
2009-10-25 23:34:43 +01:00
Martin Nordholts
d3bb3e7f99 app: Add and use gimp_dockbook_drag_source_to_dockable() 2009-10-25 23:02:05 +01:00
Martin Nordholts
2b622f99cd app: gimp_dock_separator_get_anchor() -> _get_insert_pos() 2009-10-25 22:25:06 +01:00
Martin Nordholts
be8e0045ac app: Add gimp_dock_window_get_docks()
Add gimp_dock_window_get_docks() and get rid of trailing whitespace.
2009-10-25 21:50:08 +01:00
Martin Nordholts
e81c4f44de app: Allow more than one dock inside a dock window
Put a GimpDockColumns inside GimpDockWindow so that there can be more
than one dock inside a dock window. For now,
gimp_dock_window_get_dock() returns the first dock. Eventually need to
return all docks and refactor the other code as needed.
2009-10-25 13:10:08 +01:00
Martin Nordholts
ff6a787757 app: Add gimp_dialog_factory_dock_window_new()
Add gimp_dialog_factory_dock_window_new() since we need to be able to
create only dock windows when going from single-window mode back to
multi-window.
2009-10-25 12:24:54 +01:00
Martin Nordholts
3934813dd1 app: Insert, not prepend, into GimpDock dockbooks list
Insert, not prepend, into GimpDock dockbooks list. Fixes failing test
'test-session-management.c'.
2009-10-25 11:49:54 +01:00
Martin Nordholts
43c000498b app: Format gimpdialogfactory.h 2009-10-25 10:53:00 +01:00
Martin Nordholts
9cbe0cafa8 app: Document GimpDialogFactory 2009-10-25 10:38:42 +01:00
Martin Nordholts
4bd2230a55 app: Chain up GimpPanedBox::finalize() 2009-10-24 20:33:09 +02:00
Martin Nordholts
6f95bc6888 app: Keep GimpDocks in GtkPaneds in GimpDockColumns
Use the new GimpPanedBox to make the space for GimpDocks in
GimpDockColumns manually distributable by the use of GtkPaneds.
2009-10-24 20:10:42 +02:00
Martin Nordholts
b700f219de app: Make created GtkPaned subclass depend on GimpPanedBox orientation 2009-10-24 20:08:08 +02:00
Martin Nordholts
eb9b365864 app: Add GimpPanedBox
Add a new class GimpPanedBox that wraps the arrangement of widgets
into GtkPaned hierarchies. It takes over the separator management from
GimpDock and the GtkPaned management from
gimpwidgets-utils.[ch]. GimpPanedBox can be both vertically and
horizontally oriented.

Change GimpDock to use this widget and make some other minor
adaptations.
2009-10-24 18:53:46 +02:00
Martin Nordholts
69f17fdbf2 app: Add gimp_dock_separator_set_dropped_cb()
Allow to set the dropped callback after dock separator construction.
We need this in order to move the dock separators into a common widget
for which the callback to use is not known at construction time.
2009-10-24 18:43:35 +02:00
Michael Natterer
db896708f3 Disable RGBA colormaps in offscreen widgets for now because they crash 2009-10-19 11:03:23 +02:00
Michael Natterer
0c58ffe680 Use an RGBA colormap so rounded corners work 2009-10-18 22:53:26 +02:00
Michael Natterer
81786482ec Add GimpToolOverlay which displays tool dialogs directly on the canvas
The new widget has a GtkDialog-like API so tools which use either an
overlay or a real dialog are as obvious as possible.
2009-10-18 22:33:23 +02:00
Michael Natterer
3d354c9434 Add new widget GimpOverlayBox which is a GtkContainer subclass
It keeps around its children as offscreen widgets and renders them
using a (potantially) arbitrary cairo_matrix_t (the actual API allows
for arbitrary alignment wihin the container and rotating).
2009-10-18 21:57:34 +02:00
Michael Natterer
4822ca0d6d Make menu positioning also works for transformed offscreen widgets
(gimp_button_menu_position): reorder the code, use the new
gdk_window_get_root_coords() and pass it coordinates that include
the widget's offset within its parent gdk window.
2009-10-18 16:03:33 +02:00
Michael Natterer
0ce426cc79 Make the toggle grid insensitive when the dynamics are read-only 2009-10-18 13:24:59 +02:00
Michael Natterer
387ec40214 Remove useless frame and vbox that were copied over from the paint options 2009-10-18 13:10:58 +02:00
Michael Natterer
52dd01fdef Change user-visible strings from "Dynamics" to "Paint Dynamics"
Because "Dynamics" doesn't mean anything by itself. Didn't add the
"Paint" where the context is clear, like in the dynamics dialog
context menu.
2009-10-18 13:03:40 +02:00
Michael Natterer
e979da8b22 Minor formatting fixes 2009-10-18 13:03:01 +02:00
Michael Natterer
57915302f6 Build with GSEAL_ENABLE 2009-10-17 21:24:12 +02:00
Alexia Death
210a4b5044 Merge resolution 2009-10-17 21:42:02 +03:00
Michael Natterer
1a23b9ecf2 Build with GSEAL_ENABLE and #undef it where accessors are missing 2009-10-17 20:20:39 +02:00
Martin Nordholts
eb6bef33e4 Use gtk_widget_set_visible()
In places where the pattern

  if (show)
    gtk_widget_show (widget);
  else
    gtk_widget_hide (widget);

is used, change to

  gtk_widget_set_visible (widget, show);

Also do some other minor cleanups.
2009-10-17 15:07:34 +02:00
Michael Natterer
3b1f78d286 Reorder dynamics stuff 2009-10-13 21:19:40 +02:00
Michael Natterer
f264cb4908 Remove useless diff to master 2009-10-13 21:17:39 +02:00
Alexia Death
7bae9c0827 Merge commit 'origin/master' into soc-2009-dynamics 2009-10-13 20:23:34 +03:00
Michael Natterer
8fed74777d Rename boolean properties of GimpDynamicsOutput from "foo" to "use-foo" 2009-10-12 19:06:11 +02:00
Michael Natterer
824be894a1 Get rid of local unused variable "config" 2009-10-12 14:46:27 +02:00
Michael Natterer
77faffe4b7 Rename the output members of GimpDynamics from foo_dynamics to foo_output 2009-10-12 14:45:12 +02:00
Michael Natterer
db98f468cb Rename utility function 2009-10-11 22:43:46 +02:00
Michael Natterer
e23073a382 Clean up widget creation in gimp_dynamics_editor_init() 2009-10-11 22:32:14 +02:00
Michael Natterer
6a47c2a4b8 Get rid of unused cruft and reorder functions and includes 2009-10-11 22:06:54 +02:00
Michael Natterer
8df73b9323 Switch to using GimpDynamicsOutput's properties
* app/core/gimpdynamics.c: remove all boolean properties and add the
  outputs as properties instead. Make sure changes on the outputs get
  notified on the dynamics object.

* app/widgets/gimpdynamicseditor.c: change widget creation accordingly,
  also copy around the properties correctly when copying between
  dynamics objects (fixes NULL filenames on GimpData).
2009-10-11 21:25:28 +02:00
Martin Nordholts
21c037fdd6 app: Generalize gimp_dock_add/remove_book()
Move the GtkPaned management code into gimp_widgets_add_paned_widget()
and gimp_widgets_remove_paned_widget() in gimpwidgets-utils.[ch] so we
can share this code for GimpDockColumns later.
2009-10-11 16:58:59 +02:00
Martin Nordholts
423c9d8212 app: Always keep dock separators alive
Always keep dock separators alive and show/hide them instead. This is
to avoid having to constantly create new separators.
2009-10-11 15:20:55 +02:00
Martin Nordholts
3236b57a47 app: Generalize GimpDockSeparator
Add a callback to GimpDockSeparator to get rid of the GimpDock
dependency so that we can reuse it also for GimpDockColumns later.
2009-10-11 13:59:27 +02:00
Martin Nordholts
bdfb87ad19 app: Add GimpDockSeparatorPrivate 2009-10-11 11:31:18 +02:00
Michael Natterer
8e285ba014 Add prefs UI for "dynamics-path" and "global-dynamics" 2009-10-11 01:42:23 +02:00
Alexia Death
0ca81896e9 Merge commit 'origin/master' into soc-2009-dynamics 2009-10-11 01:05:40 +03:00
Michael Natterer
6409ecb389 Fix gimp_dynamics_editor_set_data() to really work this time 2009-10-10 23:02:18 +02:00
Martin Nordholts
677b977776 app: Make class documentation be picked up by gtk-doc 2009-10-10 22:01:06 +02:00
Michael Natterer
5bd751c2d2 Make model <-> data property copying work, and some cleanup 2009-10-10 21:48:17 +02:00
Alexia Death
0ffcad4688 Several small fixes. 2009-10-10 21:43:58 +03:00
Alexia Death
7f8b347677 Several small fixes. 2009-10-10 21:43:57 +03:00
Alexia Death
430a796904 Fixes 2009-10-10 20:22:31 +03:00
Alexia Death
cf3c9b230a some missing files 2009-10-10 11:23:40 +03:00
Alexia Death
23c07b9a8d fixes to actions setup 2009-10-10 11:20:57 +03:00
Alexia Death
11d6219776 Merge commit 'origin/master' into soc-2009-dynamics 2009-10-10 10:23:25 +03:00
Martin Nordholts
2914af893b app: Allow 1-tool wide toolbox in single-window mode 2009-10-09 23:22:51 +02:00
Alexia Death
ac111be15d Added dynamics list and some infrastructure. still ont 100% tho 2009-10-09 20:25:07 +03:00
Alexia Death
860c952416 Inverted maping matrix and fixes to jitter 2009-10-07 23:32:17 +03:00
Alexia Death
88e7d5396d Merge commit 'origin/master' into soc-2009-dynamics 2009-10-07 19:42:04 +03:00
Alexia Death
f89197f165 A small dynamics UI change 2009-10-07 19:32:37 +03:00
Martin Nordholts
94e8c90a5f app: Change toolbox aspect ratio to 2.0 / 15.0
Change toolbox subcomponent aspect ratios to 2.0 / 15.0 so we can have
a two tool wide toolbox dock in the image window.
2009-10-04 17:26:48 +02:00
Martin Nordholts
35b228144a app: Make GimpToolbox members private 2009-10-04 15:43:53 +02:00
Martin Nordholts
2d3aae3982 app: Expand docks in GimpDockColumns 2009-10-04 14:59:31 +02:00
Martin Nordholts
3b721864d7 app: Only show dock separators when rearranging the UI
For now, only show dock separators when they are needed, not all the
time. We need a better solution eventually, but at least docks in the
image window doesn't look terrible any longer.
2009-10-04 12:58:30 +02:00
Alexia Death
7a2acf8811 Merge commit 'origin/master' into soc-2009-dynamics 2009-10-04 11:41:30 +03:00
Martin Nordholts
fcf5895575 app: Move docks to image window in 'Single-window mode'
When 'Single-window mode is enabled, move the toolbox and existing
docks into the image window. Needs a lot of more work but is
functional enough for curious people.

Implemented by adding a new GimpUIConfigurer component that has global
knowledge. There is a single application instance of this
component. It subscribes to changes in the single-window-mode config
property and adjusts the UI accordingly.
2009-10-04 02:10:11 +02:00
Martin Nordholts
10f6ba7774 app: Add simple utility function gimp_dock_columns_add_dock()
Add simple utility function gimp_dock_columns_add_dock(). We'll create
a more sophisticated API later.
2009-10-04 02:10:11 +02:00
Martin Nordholts
4acbda8b35 app: Add more verbose "dialog-factory" debug output 2009-10-04 02:10:11 +02:00
Alexia Death
3a041ad252 Lots of improvements on dynamics 2009-10-03 18:53:25 +03:00
Alexia Death
155393491b Merge commit 'origin/master' into soc-2009-dynamics 2009-10-03 14:12:53 +03:00
Alexia Death
5eedaeb97a A bit better but probablt wrong state 2009-10-03 13:03:51 +03:00
Alexia Death
cd36753f17 Fixed loading for dynamics and made them actually accessible 2009-10-03 12:59:45 +03:00
Sven Neumann
bc9602c410 remove pointless delete-event handler 2009-09-29 23:38:16 +02:00
Alexia Death
e75d44c77c Merge commit 'origin/master' into soc-2009-dynamics 2009-09-28 20:30:17 +03:00
Martin Nordholts
c7b8a67cfd app: Don't kill the toolbox window when removing the last dockbook
Add a "allow-dockbook-absence" property to the GimpDockWindow which is
set to TRUE for the dock window for the toolbox so that it is not
kiled when the last dockbook is removed.
2009-09-27 14:15:03 +02:00
Martin Nordholts
f3f19ac35f app: Make tool selection work again
The toolbox toplevel is no longer the dock, do some minor adjustments
to compensate for this, namely sending the toolbox (which is a dock)
as data to callbacks.
2009-09-27 13:54:45 +02:00
Martin Nordholts
9fa51f70f4 Add a Single-window mode
Add a single-window mode that can be toggled from 'Windows ->
Single-window mode'. No code is yet hooked to the mode though.
2009-09-26 18:28:41 +02:00
Martin Nordholts
1f098e5777 app: Add GimpDockColumns
Add a new widget GimpDockColumns inheriting from GtkHBox that will
contain several GimpDocks making it possible to have columns of
dockables.
2009-09-26 16:49:14 +02:00
Martin Nordholts
9106c75b14 app: Remove temporary GimpDockWindow property prefixes
With GimpDock and GimpDockWindow being separate they can share
property names.
2009-09-26 16:25:30 +02:00
Martin Nordholts
4f7693acf0 app: Make GimpDock a GtkVBox
Make GimpDock be a GtkVBox instead of a GimpDockWindow. This means we
can now put a GimpDock anywhere, including inside an image window.

In order to do this we need to:

 * Separate dock and dock window creation in the dialog factory and
   add a couple of new dock window constructors

 * Change gimp_dialog_factory_dock_new() to not only create a dock,
   but also create a dock window and then combine those two

 * Change the dock constructor to take a GimpUIManager since they
   depend on that during their construction. We get the ui manager
   from the dock window, but we can't create the dock *inside* the
   dock window, we have to add the dock later. So we create the dock
   window first and then pass its ui manager to the dock constructors

 * Make some other minor adaptions, mostly with
   gimp_dock_window_from_dock() and gimp_dock_window_get_dock()
2009-09-26 16:21:10 +02:00
Martin Nordholts
b00c9b87f5 app: Minor code formating 2009-09-26 15:39:10 +02:00
Martin Nordholts
c47c397332 app: Add and use gimp_dock_window_set_dock()
Add and use gimp_dock_window_set_dock() in preparation for making
GimpDock a non-GimpDockWindow.
2009-09-26 15:38:08 +02:00
Martin Nordholts
12a0ea1063 app: Destory the dock window from the dock window, not the dock 2009-09-26 15:26:05 +02:00
Martin Nordholts
acc8765e0a app: Update a few GimpDock related comments 2009-09-26 14:38:33 +02:00
Martin Nordholts
c9d8aafb68 app: Change a few GIMP_IS_DOCK to GIMP_IS_DOCK_WINDOW
In many places we are interested in wether or not we have a dock
window, not a dock. This is in preparation for making GimpDock a
non-GimpDockWindow.
2009-09-26 14:26:49 +02:00
Martin Nordholts
62dde84e43 app: Change GimpDialogFactory signals to "dock-window-added/removed"
Change the GimpDialogFactory signals "dock-added" and "dock-removed"
to "dock-window-added" and "dock-window-removed". Doing this makes
sense for a couple of reasons. First of all, the dialog factory is
built around top-levels. Second of all, the listeners to the signals
(such as the "recently closed docks" construct) work on a
gtk-window-level, not a dock level.

This change is a preparation for when GimpDock will stop being a
GimpDockWindow.
2009-09-26 13:11:42 +02:00
Michael Natterer
295f345b2e Guard against g_file_info_get_icon() returning NULL
It can return NULL, but should not for a proper gvfs backend; add a
returning NULL.
2009-09-22 20:25:11 +02:00
Michael Natterer
90893cea84 Add "layers-merge-group" action, callback and menu items 2009-09-21 19:17:02 +02:00
Michael Natterer
098a0e4491 Make sure the layer preview's border is correct after removing a mask
(gimp_layer_tree_view_mask_update): call
gimp_layer_tree_view_update_borders() unconditionally; not only when a
mask has been added, but also when it has been removed.
2009-09-21 10:43:26 +02:00
Martin Nordholts
02c8835e2c app: Make gimp_dock_window_get_dock() public 2009-09-20 20:21:45 +02:00
Martin Nordholts
3ebad746ee app: Add GimpUIManager property to GimpDock
Add GimpUIManager property to GimpDock. We need it later when the
GimpDock stops being a GimpDockWindow.
2009-09-20 19:30:16 +02:00
Martin Nordholts
ae39604a64 app: Add more dialog-factory debug output 2009-09-20 19:30:10 +02:00
Martin Nordholts
94d95e4db2 app: Make GimpSessionInfo members private
Make GimpSessionInfo members private but put them in a shared header
file so gimpsessioninfo-dock.c can access them too.
2009-09-20 17:06:36 +02:00
Martin Nordholts
8bfcd14f9a app: Add GimpSessionInfo getters and setters 2009-09-20 14:51:03 +02:00
Alexia Death
be78fe3b1d Merge commit 'origin/master' into soc-2009-dynamics 2009-09-20 14:32:32 +03:00
Martin Nordholts
7cac9dff67 app: gimp_session_info_set/get_geometry -> apply/read_geometry()
Rename gimp_session_info_set_geometry() to
gimp_session_info_apply_geometry() and gimp_session_info_get_geometry
to gimp_session_info_read_geometry(). The old functions were not
getters and setters and thus the names were misleading.
2009-09-20 13:17:27 +02:00
Martin Nordholts
4ab58d2e77 app: Have only one GimpDialogFactoryEntry member in GimpSessionInfo
Simplify the code a bit by replacing the 'toplevel_entry' and
'dockable_entry' members in GimpSessionInfo with a single
'factory_entry'. We compensate for this by adding a 'dockable'
gboolean to GimpDialogFactoryEntry.
2009-09-20 12:24:41 +02:00
Martin Nordholts
44d5728d7b app: Add and use factory entry related getters for GimpSessionInfo
Add GimpSessionInfo getters for a bunch of dialog factory entry
fields. This moves much of the GimpDock special casing to a common
place and also reduces direct access to session info fields.
2009-09-20 11:43:41 +02:00
Martin Nordholts
8d86735f20 app: Increase scope of 'info' in gimp_dialog_factory_add_dialog()
Increase scope of 'info' in gimp_dialog_factory_add_dialog() so we can
use it at the end of the function.
2009-09-20 11:33:22 +02:00
Martin Nordholts
6460385553 app: Add docs to GimpSessionInfo related classes 2009-09-20 10:26:32 +02:00
Martin Nordholts
09b04c62c9 app: Introduce and use gimp_dialog_factory_dialog_sane()
Collect common error checking in a new helper function
gimp_dialog_factory_dialog_sane().
2009-09-20 10:25:13 +02:00
Michael Natterer
ff3ca8eee3 Don't lose the active item when reordering between containers of a tree
Implement GimpContainerView::insert_item_after() and select the newly
inserted item if it is the active item in the image.
2009-09-16 20:00:48 +02:00
Michael Natterer
ebe72148dd Add new vfunc GimpContainerView::insert_item_after()
The new function is called after the item is inserted. This is a much
smaller change than turning all vfuncs into signals just to be able
connect_after to one of them.
2009-09-16 19:53:13 +02:00
Martin Nordholts
e87ed66ba7 app: Don't cast GimpDock to GimpDockWindow
In preparation for making GimpDock inherit from a non-window, stop
casting GimpDocks to GimpDockWindows. Instead look up the toplevel
widget for a dock and get the dock window that way.
2009-09-15 07:58:14 +02:00
Martin Nordholts
531c3d6253 app: Update default export filename precedences
Update export filename priorities according to changes in spec. Also
consistently use GIMP_FILE_EXPORT_URI_KEY instead of
GIMP_FILE_EXPORT_TO_URI_KEY. They have the same value.
2009-09-14 23:36:22 +02:00
Michael Natterer
61e76b4bff Random doc fixes 2009-09-14 21:40:09 +02:00
Michael Natterer
2c43da09e0 Random doc fixes 2009-09-14 21:39:46 +02:00
Michael Natterer
be23b17a17 Add missing boilerplate macro 2009-09-14 21:39:19 +02:00
Michael Natterer
fd224caa10 Make sure don't lose the selected item when the tree get collapsed
Collapsing the tree gets rid of any selection in the collapsed branch,
and doesn't restore it upon exapnding. So connect to the
GtkTreeView::row-expanded signal and select the active item manually.

Had to add evil hack that makes sure we don't try this on child items
that are currently being inserted, because our parent class has no
choice but to expand the tree while the item is not completely
inserted in all subclasses yet.
2009-09-13 22:39:01 +02:00
Martin Nordholts
2ac7cedbfc app: Make GimpDockbook instance data private
Make GimpDockbook instance data private and add necessary getters and
setters.
2009-09-13 16:30:09 +02:00
Martin Nordholts
67128d6034 app: Add GimpDock::set_host_geometry_hints()
In order to allow the toolbox dock to set geometry hints on the
GtkWindow it is in, introduce host geometry hint setting through a new
virtual function GimpDock::set_host_geometry_hints() and a new
"geometry-invalidated" signal.

Docks that needs to setup geometry hints on the window they are in
call gimp_dock_invalidate_geometry(). The GimpDockWindow will listen
to this and give the dock a chance to set geometry hints (or any setup
really) on the GimpDockWindow.
2009-09-13 14:14:08 +02:00
Martin Nordholts
a23a220d60 app: Add and use GimpDockWindow window title infrastructure
Add a "title-invalidated" signal to GimpDock and a virtual function
GimpDock::get_title(). When GimpDocks have a state change that their
title depends on they call gimp_dock_invalidate_title(). The
GimpDockWindow listens to this signal and update its window title
using GimpDock::get_title() in an idle handler.
2009-09-13 13:14:18 +02:00
Martin Nordholts
0d4e8d0526 app: Move 'Recently Closed Docks' logic to GimpDockWindow
Move 'Recently Closed Docks' logic from GimpDock to
GimpDockWindow. GimpDock is now free of explicit GtkWindow
dependencies.
2009-09-13 12:04:50 +02:00
Martin Nordholts
dc3521e074 app: Add and use gimp_dock_get_n_dockables() 2009-09-13 11:51:39 +02:00
Martin Nordholts
fb99f99788 Move dock window themeing to GimpDockWindow
Move the dock window related themeing namely default dock heght and
font scale from GimpDock to GimpDockWindow to get rid of yet another
GtkWindow dependency from GimpDock.

Note that this change requires gtkrc updates where "GimpDock::" needs
to be repaced with "GimpDockWindow::".
2009-09-13 11:23:02 +02:00
Martin Nordholts
fc3ab53645 app: Get rid of GimpImageDock typedef 2009-09-13 11:08:38 +02:00
Martin Nordholts
12494097b0 app: Explicitly init dialog_factory member in GimpDockWindow::_init() 2009-09-13 10:14:26 +02:00
Martin Nordholts
88e6fe1e62 app: Add GimpDialogFactory property to GimpDockWindow
Add a GimpDialogFactory property to GimpDockWindow so that it can get
rid of its GimpDock dependency. We need to call the property
"gimp-dialog-factory" instead of "dialog-factory" though as long as
GimpDock subclasses GimpDockWindow.
2009-09-13 09:49:56 +02:00
Martin Nordholts
0fc1a32ad0 app: Kill GimpImageDock
Get rid of GimpImageDock and make its subclasses inherit directly from
GimpDock instead.
2009-09-13 09:31:21 +02:00
Martin Nordholts
3532acbec6 app: Move UI manager from GimpImageDock to GimpDockWindow
Move the GimpUIManager from GimpImageDock to GimpDockWindow. This
includes making the ui_manager_name class-member of GimpImageDock a
normal instance member of GimpDockWindow since the UI manager name no
longer can be configured at the class level.
2009-09-13 09:22:59 +02:00
Martin Nordholts
f5d1c1ba4d app: Add and use gimp_image_dock_get_ui_manager() 2009-09-12 22:23:10 +02:00
Sven Neumann
65e09758ef Bug 595003 - Error in string "Lower this tool Lower this tool..."
Fix tooltips for raise/lower buttons in the GimpToolEditor widget.
2009-09-12 20:33:25 +02:00
Martin Nordholts
8794d2481a Bug 594998 - Keyboard shortcuts does not work for first image when dock is focused
The dock needs to listen to image changes in the context and not only
display changes since the introduction of the empty-image-window does
not cause any display changes when creating the first image.
2009-09-12 14:57:46 +02:00
Martin Nordholts
e2388ed123 app: Clarify why each dock has its own context 2009-09-12 13:29:34 +02:00
Martin Nordholts
45a8d1f487 app: Pass dock roles as construction parameters
In order to keep window specific settings as local as possible, also
move the role setting to dock construction instead of having it in
init.
2009-09-10 22:25:00 +02:00
Martin Nordholts
5b74dd27ef app: Move window init code from GimpDock to GimpDockWindow
Move window init code common to all docks from GimpDock to
GimpDockWindow.
2009-09-10 22:13:21 +02:00
Martin Nordholts
26fbeebf02 app: Set the dock-window-hint centrally in GimpDockWindow
Set the dock-window-hint centrally in GimpDockWindow instead of both
in GimpToolbox and GimpMenuDock.
2009-09-10 22:03:39 +02:00
Martin Nordholts
81d961423a app: Add GimpContext property to GimpDockWindow
The GimpDockWindow will need to have a GimpContext so add such a
property but call it "gimp-context" for now to avoid clashing with
"context" of GimpDock.
2009-09-10 22:03:30 +02:00
Martin Nordholts
e1faf82e7d Get rid of toolbox-window-hint, use dock-window-hint instead
Since the toolbox no longer is the main window with a menu, use the
same hint for the toolbox (which actually is a dock) as for the other
docks.
2009-09-09 23:37:38 +02:00
Martin Nordholts
0110eb0cdf app: Introduce GimpDockWindow
Introduce GimpDockWindow and make GimpDock inherit from it. Right now
it is just a GimpWindow, but window logic from GimpDock and subclasses
will gradually be moved here so that we eventually can make GimpDock a
GtkBin. That in turn will allow us to put several GimpDocks next to
each other in columns, or GimpDocks in an image window.
2009-09-09 18:22:05 +02:00
Martin Nordholts
60b90b817a app: GimpDockPriv -> GimpDockPrivate, priv -> p 2009-09-06 00:15:25 +02:00
Martin Nordholts
04ef83c795 app: Add some comments on classes used for the dock system 2009-09-05 23:52:32 +02:00
Michael Natterer
efd5018420 gimp_editor_set_box_style(): small optimization
Don't set set icon again if the icon size has not actually changed.
2009-09-03 13:24:30 +02:00
Michael Natterer
402408db1a gimp_item_tree_view_style_set(): set the style of the lock buttons
Honor the "button-relief" and "button-icon-size" style properties for
the lock buttons.
2009-09-03 13:22:17 +02:00
Michael Natterer
2d5b6d83d5 Use plain togglebuttons, not checkbuttons for the "lock" toggles
The checkbox is not really needed, the icons can just as well be
toggles themselves.
2009-09-03 13:07:06 +02:00
Sven Neumann
70fdac012e Minor UI tweak in the Keyboard Shortcuts Editor dialog
Use a Clear icon embedded into the Search entry instead of an extra
button next to it.
2009-09-01 22:26:01 +02:00
Michael Natterer
a3558e3cb8 Remove GIMP_OBJECT() casts when calling gimp_object_get_name() 2009-08-31 22:47:18 +02:00
Michael Natterer
c68f82f4ae Connect to "lock-content-changed" of all items, not "lock-alpha-changed" 2009-08-29 20:19:38 +02:00
Michael Natterer
02903d6970 Use gimp_item_is_content_locked() instead of gimp_item_get_lock_content()
Use the new API whenever we want to determine the item's effective
lock state (whether we can write to the item's content or not). Use
gimp_item_get_lock_content() only in code that actually deals with
*this* item's locked state, which is only the PDB wrappers and GUI to
modify the flag on the item itself.
2009-08-29 15:27:04 +02:00
Martin Nordholts
957cf2cfa9 app: Always use gimp_object_get_name()
Begin to consider GimpObject::name as private and always use
gimp_object_get_name(). Change gimp_object_get_name() to take an
untyped pointer so we don't have to do so awfully many casts. There is
a runtime check for the type inside the function anyway.
2009-08-29 12:41:29 +02:00
Michael Natterer
13b384e332 Don't allow dropping colors and patterns to group layers 2009-08-29 12:27:23 +02:00
Michael Natterer
c0785cfc67 Remove all padding from the "visible" and "linked" toggles
Makes the layers, channels and path dialogs much more compact.
2009-08-28 11:11:19 +02:00
Michael Natterer
85885224c3 Also send double-clicks on the expander to GtkTreeView
Enables quickly expanding and collpasing of branches, instead of
disturbingly popping up the peoperties dialog.
2009-08-28 11:06:29 +02:00
Michael Natterer
a302e084ab Rename some functions
- gimp_container_tree_view_prepend_toggle_cell_renderer() to
  gimp_container_tree_view_add_toggle_cell()

- gimp_container_tree_view_prepend_cell_renderer() to
  gimp_container_tree_view_add_renderer_cell()

because "prepend" is an implementation detail, "renderer" is obsolete,
and in the second case it's not "cell renderer" but really a "renderer
cell".
2009-08-28 10:59:27 +02:00
Michael Natterer
b2a1583c2b Fix GimpContainerView::set_context() to really set all rows of a tree 2009-08-28 10:15:38 +02:00
Michael Natterer
1685388fd0 Fix set_view_size() here too so the layer mask previews are updated too 2009-08-28 10:07:15 +02:00
Martin Nordholts
5317ff7490 app: Make "All images" mean all images in the file dialog
Even though a user can only save to XCF in File->Save, the "All
images" filter shall show all images to allow a user to steal names
from non-XCF images and vice versa for File->Export, so make that
happen.
2009-08-28 08:21:20 +02:00
Martin Nordholts
2238b68d16 app: Add helper function gimp_file_dialog_process_procedure()
Add helper function gimp_file_dialog_process_procedure() to better
isolate logic in gimp_file_dialog_add_filters().
2009-08-28 08:21:20 +02:00
Martin Nordholts
cf0db5c6bf app: Don't define stuff in the middle of a file 2009-08-28 08:21:20 +02:00
Michael Natterer
5f3721235e Fix GimpContainerView::set_view_size() implementation for actual trees 2009-08-27 23:21:40 +02:00
Michael Natterer
e0d062aa38 Show a "folder" icon instead of a preview for empty group layers 2009-08-27 22:24:53 +02:00
Michael Natterer
c4b9779161 Enable clicking on tree expanders
If we didn't click on any cell, but on empty space in the expander
column of a row that has children, let GtkTreeView process the button
press to maybe handle a click on an expander.
2009-08-26 20:25:30 +02:00
Alexia Death
4cb185a8ba Fixing up the dynamics UI. Currently does not sync with the object in the context tho. 2009-08-25 21:28:24 +03:00
zhenfeng zhao
be40405fde Fix errors and warnings. 2009-08-24 22:51:46 -03:00
zhenfeng zhao
aac92da559 Have wires and function calls between dynamics and its editor 2009-08-24 15:55:44 -03:00
zhenfeng zhao
2ba3b36969 Have config value for prop button. 2009-08-24 11:15:14 -03:00
zhenfeng zhao
6f5488a046 Implement check button grid. 2009-08-24 09:44:06 -03:00
Michael Natterer
e2ed81e310 Revert "Revert "Add a button to create a group layer to the layers dialog""
This reverts commit b72e5a35b1.
2009-08-23 20:27:47 +02:00
Michael Natterer
d6dd3ea39b Set the lock toggles insensitive if the resp. lock properties can't be changed 2009-08-23 19:45:37 +02:00
zhenfeng zhao
287f9ab887 Adjust UI code to make check button. 2009-08-23 11:56:03 -03:00
zhenfeng zhao
e61316cea1 Clean up and have a new branch. 2009-08-22 17:54:36 -03:00
Alexia Death
0a90a75705 Make the dynamics editor build and move the commented out mess to the end of the file. 2009-08-21 21:14:23 +03:00
zhenfeng zhao
6655f1b04f Merge commit 'origin/soc-2009-dynamics' into soc-2009-dynamics 2009-08-21 13:33:19 -03:00
Alexia Death
d2143b8886 Merging master to current state 2009-08-21 19:26:05 +03:00
Michael Natterer
b929a7a67c Don't allow to drop stuff to locked drawables 2009-08-21 14:10:22 +02:00
Michael Natterer
a7efe42870 Use a GtkToggleButton instead of GtkCheckButton for "Grab event"
A GtkToggleButton doesn't have to be told that it has no indicator,
because it doesn't have one in the first place.
2009-08-21 13:53:34 +02:00
Michael Natterer
b793146bde Remove redundant call to gtk_toggle_button_set_mode()
No need to call that function on an actual GtkToggleButton, because
they never have check indicators anyway.
2009-08-21 13:52:29 +02:00
Michael Natterer
3309c35f18 Fix typo: defualt -> default (spotted by Alexia) 2009-08-20 22:11:33 +02:00
zhenfeng zhao
d73330e3fa Add UI to dynamics editor. 2009-08-20 12:51:07 -03:00
Michael Natterer
ee5b8c6552 Make the appearance of the "lock content" toggle configurable
* app/widgets/gimpitemtreeview.[ch]: add class members for the lock
  content button's icon, tooltip and help_id and use them when
  creating the button. Create the button in constructor() instead of
  init() so we have access to our real class structure without the
  need for a custom get_type() function.

* app/widgets/gimpdrawabletreeview.c: configure the button as "Lock pixels".

* app/widgets/gimpvectorstreeview.c: configure it as "Lock path strokes".
2009-08-20 12:50:40 +02:00
Michael Natterer
ff31975305 Keep the lock buttons at the end of the options vbox 2009-08-20 12:33:01 +02:00
Alexia Death
93f8216881 Renaming GimpDynamicsOptions to GimpDynamics and moving from paint/ to core/. A BIG change. 2009-08-20 04:25:26 +03:00
Michael Natterer
86ad1ff70e Add a "lock content" toggle that needs some more refinement hacking 2009-08-19 21:30:48 +02:00
Michael Natterer
a16bfe749f Fix a comment 2009-08-19 21:30:48 +02:00
Michael Natterer
5260a535e5 Use the new option box API of GimpItemTreeView, remove own code for it 2009-08-19 21:30:47 +02:00
Michael Natterer
36530dd8be Add generic code for boxes of options to GimpItemTreeView
- new API to add widgets to a box of options, for stuff like the paint
  mode menu and opacity scale. Set it sensitive automatically and
  update its spacings in GtkWidget::style_set().
- new API to get a hbox for "lock" toggles, for stuff like lock
  pixels and lock alpha.
2009-08-19 21:30:47 +02:00
zhenfeng zhao
6aa4d55315 Solve errors in gimpcontext for dynamics. 2009-08-18 22:38:45 -03:00
zhenfeng zhao
f48a7e4a8b Add dynamics context and factory data and functions (need debugging). 2009-08-17 23:47:26 -03:00
Martin Nordholts
b72e5a35b1 Revert "Add a button to create a group layer to the layers dialog"
This reverts commit d2e1f2ac74. If we
keep the layer group button in 2.7.0 people will expect layer groups
to fully work and get mad when that is not the case. We can enable it
again after the release.
2009-08-15 09:41:20 +02:00
zhenfeng zhao
3a78004757 Add UI to editor. 2009-08-14 00:01:15 -03:00
Martin Nordholts
4df574acd6 Use separate shortcuts for 'File->Export to' and 'File->Overwrite'
Since Ctrl+E previously meant something harmless, don't use that
keyboard shortcut for the destructive command 'File->Overwrite'. We
still keep Ctrl+E for 'File->Export to' though, and we do this by
having 'File->Overwrite' as a separate GtkAction with its own keyboard
shortcut slot.
2009-08-13 21:53:23 +02:00
zhenfeng zhao
30382a599f Fix bugs and make a working build. 2009-08-11 00:53:31 -03:00
zhenfeng zhao
997db31a2e Working version of dynamics editor and its menu.
Dynamics editor shows up when clicked on dockable menu.
2009-08-07 20:29:34 -03:00
Alexia Death
7adb01a589 typos 2009-08-07 20:45:16 +03:00
Alexia Death
ac58002f57 Giving a boost. 2009-08-07 20:34:45 +03:00
Michael Natterer
4e9f198831 Fix dropping an item into an empty group item immediately above it 2009-08-07 09:46:16 +02:00
Michael Natterer
d2e1f2ac74 Add a button to create a group layer to the layers dialog
Will probably hide that button again, or make it only appear
when some environment variable is set until the stuff works
completely.
2009-08-06 21:34:54 +02:00
Michael Natterer
d059f239ac Make reordering items between groups work in the core and the UI
* app/core/gimpimage.[ch]: rename all gimp_image_reposition_foo() to
  gimp_image_reorder_foo() and added "new_parent" parameters. Factor
  out calculating of the item's new container and index to a utility
  function.

* app/core/core-enums.[ch]: rename the REPOSITION undos to REORDER.

* app/core/gimpimage-undo-push.[ch]
* app/core/gimpchannelpropundo.[ch]
* app/core/gimplayerpropundo.[ch]
* app/vectors/gimpvectorspropundo.[ch]: change accordingly. Remember
  the old parent item in all item reorder undos.

* app/widgets/gimpitemtreeview.h: change GimpReorderItemFunc prototype
  accordingly.

* app/widgets/gimpchanneltreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpvectorstreeview.c (class_init): follow image API
  name changes.

* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_drop_viewable):
  implement reordering of items between groups.

* app/widgets/gimpcontainertreeview.c
  (gimp_container_tree_view_reorder_item): fix to reorder the item
  within its level of the tree (unrelated to above changes, but needed
  to make them work).
2009-08-06 18:43:57 +02:00
Michael Natterer
b2c7c4f61b Add infrastructure for dragging things between branches of a tree
* app/widgets/gimpcontainertreeview-dnd.c
  (gimp_container_tree_view_real_drop_possible): support DND within a
  tree and make sure a group item is not dropped into itself.

* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_drop_viewable):
  implement intra-container reordering within all branches; print a
  message for inter-container reordering because that's not yet
  implemented in the core.
2009-08-05 18:57:08 +02:00
Sven Neumann
5febc2e417 Add functions to get the ISO 639-1 language code from GimpLanguageEntry
and to set the language using this code.
2009-08-04 22:46:01 +02:00
Sven Neumann
bf8885f637 Bug 132509 – Allow to choose language in text tool
Remove the commented out language entry from the text editor and add
one to the text tool options instead. Work in progress...
2009-08-04 22:46:01 +02:00
Sven Neumann
e2dbd56c5a app: add stubs for gimp_prop_language_entry_new() 2009-08-04 22:46:01 +02:00
Michael Natterer
86239d3b55 Use GimpTreeHandler to connect to all layers in the image 2009-08-04 22:41:49 +02:00
Michael Natterer
57f44b89e8 Use GimpTreeHandler to connect to all items' "visible" and "linked" callbacks
Makes the visibility and link buttons work for all items in a tree.
2009-08-04 20:20:09 +02:00
Michael Natterer
00682ee7cf Replace the hash table of container handlers by a single GimpTreeHandler 2009-08-04 20:19:13 +02:00
Michael Natterer
e8c6e3dbd3 Expand the treeview to newly inserted items 2009-08-04 09:06:03 +02:00
Michael Natterer
3c0df851d0 Make the preview column the expander column 2009-08-04 00:21:07 +02:00
Michael Natterer
ac052aabf4 Add items at the right place again (did not affect item treeviews) 2009-08-04 00:13:58 +02:00
Michael Natterer
8a578354fe Show expanders in treeviews showing actual trees 2009-08-03 23:46:19 +02:00
Michael Natterer
ad806713ae Add a per-class flags that indicates that a container view's model is a tree
* app/widgets/gimpcontainerview.h: add "gboolean model_is_tree"
  to GimpContainerViewInterface.

* app/widgets/gimpcontainerview.c: default to FALSE and enable the
  commented-out optimization in remove_container() for list-only
  container views.
2009-08-03 23:42:55 +02:00
Michael Natterer
a53d4566da Use GIMP_IMAGE_ACTIVE_PARENT instead of a NULL parent in all obvious places 2009-08-03 22:30:36 +02:00
Michael Natterer
c4075975bf Bring parent items to the public API in the core
* app/core/gimpimage.[ch]: make the parent parameter public in
add_layer(), add_layers(), add_channel() and add_vectors().

* app/vectors/gimpvectors-import.[ch]: add parent parameters to
  the vectors import functions.

* app/core/gimpchannelundo.[ch]
* app/core/gimplayerundo.[ch]
* app/vectors/gimpvectorsundo.[ch]
* app/core/gimpimage-undo-push.[ch]: remember the parent item when
  removing layers, channels and vectors.

* app/actions/channels-commands.c
* app/actions/debug-commands.c
* app/actions/edit-commands.c
* app/actions/layers-commands.c
* app/actions/vectors-commands.c
* app/core/gimp-edit.c
* app/core/gimpimage-duplicate.c
* app/core/gimpimage-merge.c
* app/core/gimpimage-quick-mask.c
* app/core/gimplayer-floating-sel.c
* app/core/gimpselection.c
* app/core/gimptemplate.c
* app/dialogs/file-open-dialog.c
* app/display/gimpdisplayshell-dnd.c
* app/text/gimptext-compat.c
* app/tools/gimptexttool.c
* app/tools/gimpvectortool.c
* app/widgets/gimptoolbox-dnd.c
* app/xcf/xcf-load.c
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/paths.pdb
* tools/pdbgen/pdb/vectors.pdb: pass NULL as parent item to above
  functions and add FIXMEs all over the place because there is some
  more hacking needed to make adding with index = -1 (on top of the
  current item) work again.

* app/pdb/image-cmds.c
* app/pdb/paths-cmds.c
* app/pdb/vectors-cmds.c: regenerated.

* app/core/gimpimage-duplicate.c: duplicate the original image's
  tree structure in the copy.

* app/widgets/gimpitemtreeview.[ch]: add parent to GimpAddItemFunc,
  add utility function gimp_item_tree_view_get_drop_index() which
  figures where to add something dropped to an item tree.

* app/widgets/gimpchanneltreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpvectorstreeview.c: changed accordingly, using above
  new GimpItemTreeView API.
2009-08-03 19:21:51 +02:00
zhenfeng zhao
ce1212f5bb Add context parameter back to gimp_dynamics_editor_new. 2009-08-03 11:54:32 -03:00
zhenfeng zhao
4da7c67406 Debug dynamics editor, and solve many bugs. 2009-08-02 17:18:09 -03:00
zhenfeng zhao
1b0c3595c3 Adjust dynamics editor codes and its function call in dialogs-constructor. 2009-08-02 15:57:53 -03:00
Martin Nordholts
f026c52478 Bug 568445 – Closing the Toolbox causes the program to close
Instead of invoking the file-quit action when closing the toolbox, use
gimp_dialog_factory_hide_dialog().
2009-08-02 14:57:46 +02:00
Michael Natterer
7805bd2186 Use the new item counting functions where appropriate 2009-08-02 12:24:06 +02:00
Michael Natterer
01c77b18d5 Use the new item iter API instead of the image APIs in some straightforward places 2009-08-01 23:07:07 +02:00
Michael Natterer
88f49a5ddb Use gimp_item_get_index() all over the place
Remove gimp_image_get_layer,channel,vectors_index() and
use the new function everywhere.
2009-08-01 20:49:55 +02:00
Michael Natterer
ee022e907e Add basic support for trees of containers in GimpContainerView classes
* app/widgets/gimpcontainerview.[ch]: add and remove container trees
  recursively. Change virtual function ::add_item() to pass the
  insert_data of the parent viewable.

* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c: changed accordingly.

* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c: dito, but actually use the passed
  parent_insert_data to insert the item at the right place in the
  GtkTreeView.
2009-08-01 19:13:35 +02:00
Stephen Griffiths
6a41c872f6 app: Make GimpToolEditor changes cancellable
Allow the user to cancel rearrangements of tool order and visibility
in Preferences. See enhancement request/bug #500930.
2009-08-01 16:27:34 +02:00
Alexia Death
08a88f681d Lo and behold, menu item. 2009-07-30 20:49:10 +03:00
Michael Natterer
96126034c9 Get rid of antique code duplication
Factor out large portions of identical code into new utility functions
gimp_container_view_connect_context() and
gimp_container_view_disconnect_context().
2009-07-28 21:02:32 +02:00
Michael Natterer
3ae83c5ced Fix setting a context for the unlikely case that the container is frozen 2009-07-28 19:17:42 +02:00
Michael Natterer
eff6d4f930 Cosmetic changes 2009-07-28 19:15:36 +02:00
Michael Natterer
b54a0fdf88 Replace the name_changed_handler_id GQuark by a hash of quarks
Keep around the handler IDs for the "name-changed" signals of the
container's children in a hash table that maps containers to handler
IDs and move adding/removing of the handler to
add_container()/remove_container(). This way the name-changed code is
prepared for handling multiple containers.
2009-07-28 19:08:07 +02:00
Michael Natterer
13ec6cca81 Add utility functions for adding/removing a container to/from the view
In preparation of having a tree of containers, added

gimp_container_view_add_container(),
gimp_container_view_remove_container() and
gimp_container_view_remove_foreach()

which do all the job of inserting/removing items and
connecting/disconnecting the "add", "remove" and "reorder" signals.

Also refactored things so when the toplevel container freezes/thaws,
it simply gets removed from the view instead of ignoring its signals.

gimp_container_view_real_set_container()
gimp_container_view_freeze()
gimp_container_view_thaw(): use the new add_container() and
remove_container() APIs and fix the code for the unlikely case
that a frozen container gets added/removed.
2009-07-28 16:47:28 +02:00
Michael Natterer
1b759561ce Keep the item hash table around permanently
GHashTable has g_hash_table_remove_all() since GLib 2.12, so there is
no need any longer to clear the hash table by destroyung it. Instead,
keep the hash around during the view's entire lifetime and remove all
re-creation code and all checks for its existence.
2009-07-28 15:04:43 +02:00
Michael Natterer
a5a2672345 Set the tree view's "show-expanders" to FALSE
Don't waste the expander space in all GimpContainerTreeViews. We can
later set it to TRUE in individual subclasses which actually display a
tree and not only a list.
2009-07-27 13:30:54 -03:00
Michael Natterer
23ab1a6ac2 Use the right area for click detection on treeview cells
Use gtk_tree_view_get_cell_area() instead of
gtk_tree_view_get_background_area() because the latter includes things
like expanders, indentation and padding and messes up the x coordinate
of our naive click detection.
2009-07-27 13:30:54 -03:00
Michael Natterer
2edfc47deb Rename private->hash_table to private->item_hash 2009-07-27 13:30:53 -03:00
Michael Natterer
f7f31650a6 Use GtkTreeStore instead of GtkListStore in GimpContainerTreeView 2009-07-27 13:30:53 -03:00
Michael Natterer
4ea36f92f4 Some straightforward tool editor cleanups
- split up button callbacks into one callback per button
- add stephen to copyright
- some minor whitespace fixups
2009-07-27 13:30:53 -03:00
Michael Natterer
b78b6f6274 Set the tree view's "show-expanders" to FALSE
Don't waste the expander space in all GimpContainerTreeViews. We can
later set it to TRUE in individual subclasses which actually display a
tree and not only a list.
2009-07-26 14:19:58 +02:00
Michael Natterer
bc51e8f98c Use the right area for click detection on treeview cells
Use gtk_tree_view_get_cell_area() instead of
gtk_tree_view_get_background_area() because the latter includes things
like expanders, indentation and padding and messes up the x coordinate
of our naive click detection.
2009-07-26 14:13:30 +02:00
Michael Natterer
07ecd55b1c Rename private->hash_table to private->item_hash 2009-07-25 18:21:23 +02:00
Michael Natterer
344f52bbc2 Use GtkTreeStore instead of GtkListStore in GimpContainerTreeView 2009-07-25 17:38:03 +02:00
Michael Natterer
472bf62b67 Some straightforward tool editor cleanups
- split up button callbacks into one callback per button
- add stephen to copyright
- some minor whitespace fixups
2009-07-23 10:28:04 +02:00
Alexia Death
d6a59dca35 Merge commit 'origin/master' into soc-2009-dynamics 2009-07-22 19:48:52 +03:00
Martin Nordholts
ce5cfe0f1c app: Rename gimptoolview.[ch] to gimptooleditor.[ch]
Rename gimptoolview.[ch] to gimptooleditor.[ch]. The contents of the
file has already gone through this change, we do the file name change
separately for better diffs. Part of fix for bug #500930.
2009-07-22 00:21:31 +02:00
Stephen Griffiths
450db18abb app: Convert GimpToolView into a non-dockable GimpToolEditor
Convert the GimpToolView dockable to a non-dockable GimpToolEditor,
but wait with renaming the file so that we get better diffs. Part of
fix for bug #500930.
2009-07-22 00:21:31 +02:00
Alexia Death
7cbf10b886 Merge branch 'master' into soc-2009-dynamics 2009-07-21 21:17:37 +03:00
Alexia Death
cea52220ea Merge branch 'master' into soc-2009-dynamics
Conflicts:
	.gitignore
	NEWS
	app/widgets/gimptagpopup.c
	po/ru.po
2009-07-21 20:12:35 +03:00
Martin Nordholts
c6818c5710 app: Remove transient-docks gimprc setting
Remove the transient-docks setting for gimprc. What GIMP tried to
accomplish with this enabled is much better accomplished by the window
manager with the docks set to the 'Utility window' window hint. See
discussion in bug #322577.
2009-07-21 17:12:34 +02:00
Martin Nordholts
cfbcdbd207 app: Add WM debug output 2009-07-20 13:16:30 +02:00
Martin Nordholts
b2b2b41e62 Get rid of artificial compiler warnings
Get rid of artificial compiler warnings generated with the #warning
directive. They pollute the build output and don't work as incentives
for fixing stuff.
2009-07-20 12:47:59 +02:00
Michael Natterer
e564cc2e4e Fix motion event processing on the tag popup's scroll arrows
Should work properly now wrt detecting the different speed
areas and stopping scolling upon leaving the arrow.
2009-07-18 19:58:33 +02:00
Martin Nordholts
20aa60ac8c app: Fix a free cell renderer for GimpLanguageEntry
We must set the text column with
gtk_entry_completion_set_text_column() in order to get a free cell
renderer.
2009-07-18 19:56:10 +02:00
Michael Natterer
84fd35d832 Connect to widget signals in init() instead of constructor() 2009-07-18 19:34:42 +02:00
Michael Natterer
48a8b89bea Only redraw the affected tags when prelight changes, not the entire widget 2009-07-18 19:31:21 +02:00
Michael Natterer
5d76dd9bc5 Fix unprelighting of the prelighted tag when there is no hit on any tag 2009-07-18 19:23:26 +02:00
Michael Natterer
24209f7625 Use g_value_dup_object() inatead of g_value_get_object() and g_object_ref() 2009-07-18 18:57:15 +02:00
Michael Natterer
6fd729cfb6 Remove the possibility to disable mnemonics (bug #120034)
There is GtkSettings:gtk-enable-mnemonics: now, so there is no
reason to do the same in GIMP:

* app/config/gimpguiconfig.[ch]: turn "menu-mnemonics" into a dummy.

* app/dialogs/preferences-dialog.c: remove its GUI.

* app/widgets/gimpactionfactory.[ch]
* app/widgets/gimpactiongroup.[ch]: remove infrastructure for disabling
  menu mnemonics.

* app/actions/actions.c: bye bye glue code.
2009-07-18 17:51:04 +02:00
Michael Natterer
0d81ce9717 Bug 446171 – select content by click on layer icon
* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_layer_clicked):
  when ALT is pressed, select the layer's alpha. SHIFT and CONTROL work
  as usual to add, subtract and intersect.

* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpvectorstreeview.c: add "clicked" handlers here too
  and do the same select-on-alt-click thing.
2009-07-18 16:59:43 +02:00
Martin Nordholts
99ce3bd8b2 Bug 120563 – Add an easy way to use the default comment
Add a 'Use default comment' button to the Comment tab in Image
Properties that if clicked sets the image comment to the default
comment set in Preferences.
2009-07-18 09:38:58 +02:00
Michael Natterer
65421aa0b6 Use accessors instead of widget->style and widget->window 2009-07-15 04:05:24 +02:00
Michael Natterer
84e933d80b Use accessors instead of widget->window and widget->style 2009-07-15 03:58:30 +02:00
zhenfeng zhao
aca8a6d597 Create a new GUI for dynamics dockable - needs debugging
* app/widgets/gimpdynamicseditor.c
* app/widgets/gimpdynamicseditor.h: Two files are added.
2009-07-13 13:28:28 -03:00
Michael Natterer
ffe2afb6fb Tag popup scrolling cleanup
- artificially limit the popup's height again so scrolling gets some testing.
- make sure the scroll buttons' sensitivity is always correct.
- remove obsolete utility function and other cleanups.
2009-07-12 19:26:17 +03:00
Michael Natterer
34f3c20d67 Remove more obsolete variables and indentation levels 2009-07-12 19:26:17 +03:00
Michael Natterer
e90a610e88 Factor out tag hit detection into a utility function 2009-07-12 19:26:17 +03:00
Michael Natterer
f441464656 Fix tiny miscalculation of the tag name rendering position 2009-07-12 19:26:16 +03:00
Michael Natterer
357e24aebf More tag popup cleanup
- reorder instance struct and add some spacing
- rename member "timeout_id" to "scroll_timeout_id"
- clean up constructor() even more (still the wrong place to
  do all these things)
2009-07-12 19:26:16 +03:00
Michael Natterer
3db3ad0703 Some more cleanup and a fix of a tiny earlier cleanup glitch 2009-07-12 19:26:16 +03:00
Michael Natterer
df57181899 Remove useless member "ignore_button_release" 2009-07-12 19:26:16 +03:00
Michael Natterer
7fdefa92e0 Clean up spacings, tag size calculation and tag rendering
The area sensitive to clicks now corresponds to the area that
is drawn selected, minus a border of one pixel.
2009-07-12 19:26:16 +03:00
Michael Natterer
66c54126f0 Use GTK_SHADOW_OUT for the tag popup's frame 2009-07-12 19:26:15 +03:00
Michael Natterer
59849bcb44 Use #defines instead of magic values for the tag spacing constants 2009-07-12 19:26:15 +03:00
Michael Natterer
3a1f3b4813 Remove "close_rectangles" member and the feature it implemented
Closing whatever popup by click on dead space within it is a no no,
otherwise one-pixel mis-clicks inside the widget make it go away,
which is totally unexpected.
2009-07-12 19:26:15 +03:00
Michael Natterer
094b7f5d64 Various code cleanups 2009-07-12 19:26:15 +03:00
Michael Natterer
e28727bdbd Widget construction / showing cleanup
- create the widgets in init() instead of constructor()
- don't show the popup in constructor()
- don't use gtk_widget_show_all()
2009-07-12 19:26:15 +03:00
Michael Natterer
487fc7402e Rename member "drawing_area" to "tag_area" 2009-07-12 19:26:14 +03:00
Michael Natterer
7582753661 Whitespace and minor code cleanup 2009-07-12 19:26:14 +03:00
Michael Natterer
7171dad364 Tag popup scrolling cleanup
- artificially limit the popup's height again so scrolling gets some testing.
- make sure the scroll buttons' sensitivity is always correct.
- remove obsolete utility function and other cleanups.
2009-07-10 20:10:49 +02:00
Michael Natterer
48bc1d1ced Remove more obsolete variables and indentation levels 2009-07-10 20:10:49 +02:00
Michael Natterer
25a8a9ea9f Factor out tag hit detection into a utility function 2009-07-10 20:10:49 +02:00
Michael Natterer
5a26780ed9 Fix tiny miscalculation of the tag name rendering position 2009-07-10 20:10:48 +02:00
Michael Natterer
bd00ac3891 More tag popup cleanup
- reorder instance struct and add some spacing
- rename member "timeout_id" to "scroll_timeout_id"
- clean up constructor() even more (still the wrong place to
  do all these things)
2009-07-10 20:10:48 +02:00
Michael Natterer
e15e9c222d Some more cleanup and a fix of a tiny earlier cleanup glitch 2009-07-10 20:10:48 +02:00
Michael Natterer
4699152a4f Remove useless member "ignore_button_release" 2009-07-10 20:10:48 +02:00
Michael Natterer
dd6b65179e Clean up spacings, tag size calculation and tag rendering
The area sensitive to clicks now corresponds to the area that
is drawn selected, minus a border of one pixel.
2009-07-10 20:10:48 +02:00
Michael Natterer
1f199ba060 Use GTK_SHADOW_OUT for the tag popup's frame 2009-07-10 20:10:48 +02:00
Michael Natterer
8995cdf9d7 Use #defines instead of magic values for the tag spacing constants 2009-07-10 20:10:47 +02:00
Michael Natterer
75ee288278 Remove "close_rectangles" member and the feature it implemented
Closing whatever popup by click on dead space within it is a no no,
otherwise one-pixel mis-clicks inside the widget make it go away,
which is totally unexpected.
2009-07-10 20:10:47 +02:00
Michael Natterer
3d85ee285a Various code cleanups 2009-07-10 20:10:47 +02:00
Michael Natterer
1ecf4bed67 Widget construction / showing cleanup
- create the widgets in init() instead of constructor()
- don't show the popup in constructor()
- don't use gtk_widget_show_all()
2009-07-10 20:10:47 +02:00
Michael Natterer
4d860185c1 Rename member "drawing_area" to "tag_area" 2009-07-10 20:10:47 +02:00
Michael Natterer
f350e5ac51 Whitespace and minor code cleanup 2009-07-10 20:10:47 +02:00
Martin Nordholts
7deab857b4 app: Update default save name according to spec
Update default save name according to the spec which is
http://gui.gimp.org/index.php/Save_%2B_export_specification in case
someone forgot.
2009-07-02 22:17:36 +02:00
Martin Nordholts
f07d89de2a Bug 587543 – crash in GNU Image Manipulation Program: Pressing shift+-
Not all actions have procedures associated with them, for example
unused "plug-in-recent-[N]" actions, so check for NULL before we
invoke the plug-in action
2009-07-01 21:45:33 +02:00
Michael Natterer
1a2136408e Implement overwrite-mode in the text tool
* app/widgets/gimptextproxy.c: also swallow the "toggle-overwrite"
signal.

* app/tools/gimpdrawtool. [ch] (gimp_draw_tool_draw_text_cursor): add
"gboolean overwrite" which causes the cursor to be drawn as block.

* app/tools/gimptexttool.[ch]: implement overwriting, toggling it,
and changing the text cursor accordingly.
2009-06-25 13:22:25 +02:00
Michael Natterer
e78bda44b3 Implement insert_at_cursor() so bindings can insert text 2009-06-24 21:31:39 +02:00
Michael Natterer
b5079eb1b7 Move the GimpTextProxy widget from app/tools/ to app/widgets/ 2009-06-24 19:34:36 +02:00
Michael Natterer
1b69070556 Make key themes really work this time
* app/widgets/gimpwindow.c: treat GimpCanvas as a text widget and
  dispatch all key events to it before invoking menu shortcuts.

* app/display/gimpdisplayshell-callbacks.c: treat all events on the
  empty display as unhandled, not handled.

* app/tools/gimptexttool.c: use the right API for invoking the proxy
  text view's bindings. Handle some more cursor navigation request and
  swallow text deletion requests we don't handle instead of always
  doing what the delete key does.
2009-06-23 23:25:09 +02:00
Michael Natterer
6049768abf Bug 578630 - File Creation Permission Bug Only for Some File Types: Creating as 644 (rw-r--r--) when should be 664 (rw-rw-r--)
Use 0666 as permissions instead of 0644 and let the user's umask care
about restricting, so creating a file with open() behaves the same way
as with fopen().
2009-06-15 19:28:06 +02:00
Stephen Griffiths
d5fddb5ba9 app: gimpuimanager.c formatting 2009-05-28 19:42:18 +02:00
Aurimas Juška
4c8b0f1f7e Bug 573614 – Tags dropdowns for brushes, patterns,
Display correct cursor when in widget area which opens popup list.
2009-05-26 21:39:43 +03:00
Michael Natterer
c9674b4603 Use the new GtkAction accessors instead of g_object_get()/set() 2009-05-24 22:29:18 +02:00
Michael Natterer
be21d3a1e3 Restrict the set of modifiers that prevent treeview item activation
Check for SHIFT, CONTROL and MOD1 explicitely so the code doesn't prevent
item activation for esoteric modifiers that are set by whatever X
component (like XKB).
2009-05-24 22:17:42 +02:00
Manish Singh
7d76f25e26 Use gtk_activatable_set_related_action() instead of deprecated
gtk_action_connect_proxy()
2009-05-24 10:38:09 -07:00
Martin Nordholts
2f9e2662c4 app: Don't activate container tree view items while modkey pressed
Only activate container tree view items when no modifier keys are
pressed so that for example the layer properties dialog is not shown
when quickly toggling a layer mask with Ctrl + Click.
2009-05-22 22:49:14 +02:00
Sven Neumann
f24ff4aca2 formatting 2009-05-17 11:01:28 +02:00
Martin Nordholts
08beda17a2 app: Update out-of-date comment on default export type 2009-05-17 08:30:13 +02:00
Martin Nordholts
c23370c3af app: Emit the GimpImage::exported signal when image is exported 2009-05-16 13:02:55 +02:00
Martin Nordholts
d8f3cd1b26 app: Support default types for save and export 2009-05-16 13:02:54 +02:00
Martin Nordholts
3122eb491f app: Implement save and export dialog default paths and filenames 2009-05-16 13:02:54 +02:00
Martin Nordholts
d3353f721b app: Rename 'Save as Template' to 'Create Template'
Rename 'Save as Template' to 'Create Template' in the File menu.
2009-05-16 09:48:22 +02:00
Martin Nordholts
46a1afebcd app: In some cases, fall back to export procs in absence of save proc
We want to fall back to export procs in some cases to maintain a level
of backwards compatibility.
2009-05-16 09:48:22 +02:00
Martin Nordholts
0971d61fc4 app: Add an 'export' mode to the file save dialog 2009-05-16 09:48:12 +02:00
Martin Nordholts
3025dac653 app: Introduce and use GimpFileChooserAction
Introduce and use GimpFileChooserAction in the core so that we can
differentiate Save from Export later.
2009-05-16 09:48:12 +02:00
Martin Nordholts
c1a226bc74 app: Rearrange menu items for Save + export
Begin implementing the spec
http://gui.gimp.org/index.php/Save_+_export_specification
by rearranging the menu items according to it and adding necessary
stuff like help ids.
2009-05-16 01:12:40 +02:00
Martin Nordholts
5db0b727d6 app: Don't set NULL URIs through GIMP_FILE_SAVE_LAST_URI_KEY 2009-05-16 00:44:29 +02:00
Martin Nordholts
4e40ff7e65 app: Untabify gimpfiledialog.c 2009-05-08 20:15:47 +02:00
Martin Nordholts
a0d9f6e57e app: Rename file_save() parameter save_a_copy to change_saved_state
Rename file_save() parameter save_a_copy to change_saved_state since
that is the semantics it has now.
2009-05-06 15:03:30 +02:00
Martin Nordholts
8064bbf22e app: Pass Gimp instead of GimpContext to file_save() 2009-05-03 08:35:01 +02:00
Martin Nordholts
c5787f51fc app: Introduce gimp_file_dialog_get_dirname_from_uri()
Introduce gimp_file_dialog_get_dirname_from_uri() to improve
readability.
2009-05-01 17:29:02 +02:00
Martin Nordholts
a93346d0a0 app: Gather save dialog uri defaults in one place
Gather save dialog uri defaults in one place. Move the small bits of
it from file_save_dialog_new() to gimp_file_dialog_set_save_image()
where the rest is.
2009-05-01 12:23:46 +02:00
Sven Neumann
b0af6524b4 app/file: Rename gimpfile.h to gimp-file.h and fix include guards
The source filename convention would indicate that gimpfile.h
	holds code for the GimpFile object. Rename it to gimp-file.h
	to make clear that it doesn't.
2009-05-01 09:03:13 +02:00
Martin Nordholts
e622dc3cad app: Introduce gimpfile.h
Introduce gimpfile.h which for now contains defines for GObject data
keys used when managing save and open dialog URI defaults. More are to
be added.
2009-04-30 20:00:18 +02:00
Martin Nordholts
a51521fe1d app: Rename save-a-copy key
Rename "gimp-image-save-a-copy" key to "gimp-file-save-a-copy-uri"
since the key is more logical to have in the gimp file namespace and
the "-ur"i suffix is more consistent with other similar keys.
2009-04-30 19:58:55 +02:00
Michael Natterer
d9448730f9 Bug 555025 – Action GEGL box widgets weirdness
2009-03-28  Michael Natterer  <mitch@gimp.org>

	Bug 555025 – Action GEGL box widgets weirdness

	Must not set GDK_HINT_MIN_SIZE if we don't actually set a minimum
	size, or the window will be shrinkable to zero and it won't
	expand automatically when its contents' requisition grows.

	* app/widgets/gimpdialogfactory.[ch]: add hackish API
	gimp_dialog_factory_set,get_has_min_size() because GTK+ itself
	has no API for querying a window's GdkWindowHints.

	(gimp_dialog_factory_set_user_pos): set GDK_HINT_MIN_SIZE only if
	the window was being marked as having a minimum size using above
	new API.

	* app/widgets/gimptoolbox.c (gimp_toolbox_set_geometry)
	* app/display/gimpdisplayshell.c (gimp_display_shell_style_set):
	call gimp_dialog_factory_set_has_min_size (window, TRUE).


svn path=/trunk/; revision=28224
2009-03-28 13:19:53 +00:00
Michael Natterer
2399d31d41 use GtkScaleButton's accessors.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpscalebutton.c: use GtkScaleButton's accessors.


svn path=/trunk/; revision=28212
2009-03-23 08:57:59 +00:00
Michael Natterer
45e89543d1 use GtkAdjustment's accessors.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.c: use GtkAdjustment's accessors.


svn path=/trunk/; revision=28210
2009-03-22 23:24:45 +00:00
Michael Natterer
b05a4efacb use GtkSelectionData's accessors.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_data_drop_handle): use
	GtkSelectionData's accessors.


svn path=/trunk/; revision=28209
2009-03-22 23:16:59 +00:00
Michael Natterer
a89e8d59e9 use GtkAdjustment's accessors.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c: use GtkAdjustment's
	accessors.


svn path=/trunk/; revision=28208
2009-03-22 23:13:15 +00:00
Michael Natterer
ee8e1b2af8 use GtkAdjustment's accessors.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c: use GtkAdjustment's accessors.


svn path=/trunk/; revision=28207
2009-03-22 23:10:26 +00:00
Michael Natterer
0251d98b64 use accessors instead of scrolled_window->vscrollbar.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerbox.c: use accessors instead of
	scrolled_window->vscrollbar.


svn path=/trunk/; revision=28206
2009-03-22 23:07:56 +00:00
Michael Natterer
b11b678d2d use accessors instead of widget->window and widget->style.
2009-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcombotagentry.c: use accessors instead of
	widget->window and widget->style.


svn path=/trunk/; revision=28205
2009-03-22 23:04:37 +00:00
Michael Natterer
bcc31e20e7 use "list" as variable name for iterators to be consistent with the rest
2009-03-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptagentry.c: use "list" as variable name for
	iterators to be consistent with the rest of GIMP; various code
	cleanups.


svn path=/trunk/; revision=28196
2009-03-22 19:10:15 +00:00
Michael Natterer
9ae1fa8872 app/widgets/Makefile.am remove this evil hack.
2009-03-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gtkscalebutton.[ch]: remove this evil hack.

	* app/widgets/gimpscalebutton.[ch]
	* app/widgets/gimppropwidgets.c: minor adjustments so the widget
	from GTK+ gets used.


svn path=/trunk/; revision=28194
2009-03-22 18:12:36 +00:00
Michael Natterer
d85fb156b5 app/widgets/gimpblobeditor.c app/widgets/gimpbrushselect.c
2009-03-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpblobeditor.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimpcolordialog.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpcontrollereditor.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpcurveview.c
	* app/widgets/gimpdasheditor.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimpfgbgeditor.c
	* app/widgets/gimpfgbgview.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphandlebar.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimphistogramview.c
	* app/widgets/gimpmessagedialog.c
	* app/widgets/gimpnavigationview.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppaletteview.c
	* app/widgets/gimppatternselect.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpscalebutton.c
	* app/widgets/gimpselectiondata.c
	* app/widgets/gimpsessioninfo.c
	* app/widgets/gimpsettingsbox.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpview-popup.c
	* app/widgets/gimpview.c
	* app/widgets/gimpviewabledialog.c
	* app/widgets/gimpwidgets-utils.c: use accessors for various
	members of GTK+ structures that don't exist any longer when
	GSEAL_ENABLE is defined.


svn path=/trunk/; revision=28193
2009-03-22 16:35:53 +00:00
Sven Neumann
636757dd12 formatting.
2009-03-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c
	(gimp_container_view_item_selected): formatting.


svn path=/trunk/; revision=28126
2009-03-08 10:46:32 +00:00
Sven Neumann
df8c8610a9 do not attempt to chain up in a signal callback.
2009-03-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainercombobox.c
	(gimp_container_combo_box_changed): do not attempt to chain up 
in
	a signal callback.


svn path=/trunk/; revision=28124
2009-03-07 11:31:32 +00:00
Sven Neumann
003e16dc14 formatting.
2009-03-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpuimanager.c: formatting.


svn path=/trunk/; revision=28113
2009-03-05 21:51:56 +00:00
Sven Neumann
a196a2dbe0 app/widgets/gimpviewrendererimagefile.c
2009-03-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_get_icon)
	* plug-ins/print/print.c (query): removed GTK+ version checks 
that
	have become obsolete.


svn path=/trunk/; revision=28111
2009-03-05 19:59:45 +00:00
Michael Natterer
f1f3913b5e use gtk_paint_layout() instead of fiddling with a PangoRenderer manually.
2009-03-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptagentry.c (gimp_tag_entry_expose): use
	gtk_paint_layout() instead of fiddling with a PangoRenderer
	manually.


svn path=/trunk/; revision=28096
2009-03-02 22:28:57 +00:00
Michael Natterer
7dd3ce30f2 allow to leave the widget with Ctrl+Tab. Handle GDK_KP_Tab and
2009-03-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptagentry.c (gimp_tag_entry_key_press): allow to
	leave the widget with Ctrl+Tab. Handle GDK_KP_Tab and
	GDK_ISO_Left_Tab.


svn path=/trunk/; revision=28095
2009-03-02 22:16:40 +00:00
Michael Natterer
c06c90b545 add gimp_tagged_set_tags() which takes a GList of tags.
2009-03-02  Michael Natterer  <mitch@gimp.org>

	* app/core/gimptagged.[ch]: add gimp_tagged_set_tags() which
	takes a GList of tags.

	* app/widgets/gimptagentry.c (gimp_tag_entry_assign_tags): use it.

	(gimp_tag_entry_item_set_tags): remove.


svn path=/trunk/; revision=28094
2009-03-02 21:48:50 +00:00
Michael Natterer
56198ec77b app/widgets/gimpcombotagentry.c indentation, spacing, some general
2009-03-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcombotagentry.c
	* app/widgets/gimptagentry.c: indentation, spacing, some general
	formatting cleanup.

	(gimp_tag_entry_expose): don't leak the PangoAttrList.


svn path=/trunk/; revision=28093
2009-03-02 21:34:59 +00:00
Sven Neumann
b071dce30b connect to changes of the "user-manual-online" gimprc property and kill
2009-02-26  Sven Neumann  <sven@gimp.org>

	* app/gui/gui.c (gui_restore_callback): connect to changes of 
the
	"user-manual-online" gimprc property and kill the gimp-help
	plug-in as it caches the location of the help pages.

	* app/widgets/gimphelp.[ch]: added 
gimp_help_user_manual_changed()
	for this purpose.


svn path=/trunk/; revision=28073
2009-02-26 22:58:19 +00:00
Aurimas Juška
a31ca23ddb fixed popup list (tag cloud) toggling by querying tags immediately instead
* app/widgets/gimptagentry.c (gimp_tag_entry_set_tag_string):
fixed popup list (tag cloud) toggling by querying tags immediately
instead of adding idle handler.

svn path=/trunk/; revision=28044
2009-02-16 14:44:04 +00:00
Aurimas Juška
cf3e18312e don't cause tag query after focus-out. Fixes annoying bug.
* app/widgets/gimptagentry.c (gimp_tag_entry_commit_tags),
(gimp_tag_entry_strip_extra_whitespace): don't cause tag query
after focus-out. Fixes annoying bug.

svn path=/trunk/; revision=28043
2009-02-16 13:59:31 +00:00
Michael Natterer
712fd0ef5f Bug 567840 – GIMP's GtkScaleButton conflicts with GTK's
2009-02-12  Michael Natterer  <mitch@gimp.org>

	Bug 567840 – GIMP's GtkScaleButton conflicts with GTK's

	* app/widgets/gtkscalebutton.c: rename the type to
	"GimpGtkScaleButton" so we don't crash if the real
	GtkScaleButton type is registered too.


svn path=/trunk/; revision=28015
2009-02-12 18:20:45 +00:00
Michael Natterer
051c051234 Bug 569470 – pls, introduce an option 'how many latest presets for color
2009-02-09  Michael Natterer  <mitch@gimp.org>

	Bug 569470 – pls, introduce an option 'how many latest presets for
	color curves should be saved'

	* app/config/gimprc-blurbs.h
	* app/config/gimpguiconfig.[ch]: add integer property
	"image-map-tool-max-recent" which defaults to ten. Adding a GUI
	for this IMO needs discussion, the value of ten seems appropriate.

	* app/widgets/gimpsettingsbox.[ch]
	(gimp_settings_box_add_current): add "gint max_recent" parameter
	and limit the number of recent settings to this number.

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
	pass the new settings property to above function.


svn path=/trunk/; revision=28004
2009-02-08 23:19:12 +00:00
Martin Nordholts
4d7a6b10d1 Added .gitignore files generated with git svn create-ignore.
svn path=/trunk/; revision=27972
2009-01-31 11:37:44 +00:00
Michael Natterer
b907703040 Bug 568890 – don't rely on GtkAction implementation details
2009-01-24  Michael Natterer  <mitch@gimp.org>

	Bug 568890 – don't rely on GtkAction implementation details

	* app/widgets/gimpuimanager.c (gimp_ui_manager_menu_item_select):
	use gtk_widget_get_action() instead of g_object_get_data(),
	which relies on the name of the data key.


svn path=/trunk/; revision=27939
2009-01-24 17:50:31 +00:00
Tor Lillqvist
fb554e98cd Bug 559408 - Brushes dragged to the image window look strange
2009-01-22  Tor Lillqvist  <tml@iki.fi>

	Bug 559408 - Brushes dragged to the image window look strange 

	* app/widgets/gimppixbuf.c (gimp_pixbuf_format_compare): Drop
	Windows-specific code to prefer BMP. The BMP format written by
	gdk-pixbuf doesn't support alpha. PNG is better. Note that the
	same bug report also takes up a different problem.


svn path=/trunk/; revision=27928
2009-01-22 00:47:18 +00:00
Sven Neumann
e9e48274c5 Bug 568617 – "Plase" misspelled
2009-01-21  Sven Neumann  <sven@gimp.org>

	Bug 568617 – "Plase" misspelled

	* app/widgets/gimpuimanager.c: fixed typo.


svn path=/trunk/; revision=27926
2009-01-21 21:52:15 +00:00
Michael Natterer
d9b5207aa2 Change licence to GPLv3 (and to LGPLv3 for libgimp).
2009-01-17  Michael Natterer  <mitch@gimp.org>

	* all files with a GPL header and all COPYING files:

	Change licence to GPLv3 (and to LGPLv3 for libgimp).

	Cleaned up some copyright headers and regenerated the parsers in
	the ImageMap plugin.


svn path=/trunk/; revision=27913
2009-01-17 22:28:01 +00:00
Michael Natterer
f81dedf355 connect to entry->container's signals with g_signal_connect_object() so
2009-01-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcombotagentry.c
	(gimp_combo_tag_entry_constructor): connect to entry->container's
	signals with g_signal_connect_object() so the entry can be
	destroyed without warning/crashing.


svn path=/trunk/; revision=27895
2009-01-04 19:45:07 +00:00
Martin Nordholts
254ce98ae8 formating
svn path=/trunk/; revision=27882
2009-01-04 10:32:38 +00:00
Martin Nordholts
7c96452329 Make instance members private.
* app/widgets/gimpdock.[ch]: Make instance members private.

(gimp_dock_get_context)
(gimp_dock_get_dialog_factory)
(gimp_dock_get_dockbooks)
(gimp_dock_get_main_vbox)
(gimp_dock_get_vbox)
(gimp_dock_get_id): New getters.

* app/actions/actions.c
* app/actions/dockable-actions.c
* app/actions/dockable-commands.c
* app/actions/windows-actions.c
* app/menus/windows-menu.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpdock.c
* app/widgets/gimpdock.h
* app/widgets/gimpdockable.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpdockseparator.c
* app/widgets/gimpimagedock.c
* app/widgets/gimpmenudock.c
* app/widgets/gimpsessioninfo-book.c
* app/widgets/gimpsessioninfo-dock.c
* app/widgets/gimpsessioninfo-dockable.c
* app/widgets/gimptoolbox-color-area.c
* app/widgets/gimptoolbox-dnd.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptoolbox.c: Use new getters.

svn path=/trunk/; revision=27881
2009-01-04 10:28:31 +00:00
Martin Nordholts
dff24a3d98 Format static function prototypes.
* app/widgets/gimpcontainertreeview.c: Format static function
prototypes.

svn path=/trunk/; revision=27880
2009-01-03 22:27:30 +00:00
Sven Neumann
2d2aec81b9 another small formatting cleanup
svn path=/trunk/; revision=27863
2008-12-31 00:25:20 +00:00
Sven Neumann
d9d657ca19 added GimpTagEntryMode.
2008-12-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-enums.[ch]: added GimpTagEntryMode.

	* app/widgets/gimptagentry.[ch]: removed it here. Also did some
	code cleanup, mostly formatting.

	* app/widgets/gimpcombotagentry.[ch]
	* app/widgets/gimptagpopup.[ch]: some code cleanup, mostly
	formatting.


svn path=/trunk/; revision=27861
2008-12-31 00:01:24 +00:00
Sven Neumann
cf0aee5adb deleted trailing whitespace.
2008-12-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpitemtreeview.h: deleted trailing whitespace.


svn path=/trunk/; revision=27860
2008-12-30 23:25:07 +00:00
Martin Nordholts
6f9ccc51f5 Make instance members private (they were not accessed from the outside).
* app/widgets/gimplayertreeview.[ch]: Make instance members
private (they were not accessed from the outside).

svn path=/trunk/; revision=27830
2008-12-25 12:12:33 +00:00
Martin Nordholts
2e1653ca8b Make instance members private (they were not accessed from the outside).
* app/widgets/gimpchanneltreeview.[ch]: Make instance members
private (they were not accessed from the outside).

svn path=/trunk/; revision=27829
2008-12-25 12:00:18 +00:00
Martin Nordholts
571ce865bd Make instance member private and add getter that didn't already exist.
* app/widgets/gimpitemtreeview.[ch]: Make instance member private
and add getter that didn't already exist.

(gimp_item_tree_view_get_new_button)
(gimp_item_tree_view_get_edit_button): New getters.

* app/actions/actions.c
* app/widgets/gimpvectorstreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpdrawabletreeview.c
* app/widgets/gimpchanneltreeview.c: Use new getters.

svn path=/trunk/; revision=27827
2008-12-25 11:31:51 +00:00
Aurimas Juška
3093ef28ce fixed handling of tags which contain non-ASCII characters.
* app/widgets/gimptagentry.c: fixed handling of tags which contain
non-ASCII characters.

svn path=/trunk/; revision=27822
2008-12-21 16:41:09 +00:00
Martin Nordholts
4255e43681 Bug 555954 – Merge Tagging of Gimp Resources GSoC Project
Merge the rest of the tagging code developed on the tagging branch
by Aurimas Juška. Development will now continue in trunk.

* app/core/gimptag.[ch]: New files (not strictly true but almost)
implementing the represention of a tag.

* app/core/gimptagcache.[ch]: New files implementing functionality
for loading and saving tags to tags.xml, and assigning loaded tags
to tagged objects.

* app/core/gimpfilteredcontainer.[ch]: New files implementing a
tag filtered GimpContainer.

* app/widgets/gimptagentry.[ch]: New files implementing a
GtkEntry-like widget for entering tags.

* app/widgets/gimpcombotagentry.[ch]: New files implementing a
combobox-like widget for selecting tags.

* app/widgets/gimptagpopup.[ch]: New files implementing a popup of
all available tags that can be selected and combined in a
checkbox-like way.

* app/core/gimp.[ch]: Add a GimpTagCache member and manage tag
assignment and saving and loading to/from tags.xml.

* app/widgets/gimpdatafactoryview.c: Add the tag query and tag
assignment widgets to the UI and show the tag filtered items
instead of all items.

* app/core/Makefile.am
* app/widgets/Makefile.am: Add new files.

* app/core/core-types.h
* app/widgets/widgets-types.h: Add new types.

svn path=/trunk/; revision=27816
2008-12-20 14:46:54 +00:00
Martin Nordholts
9c912cf0bb Bug 555954 – Merge Tagging of Gimp Resources GSoC Project
Partial merge of code from Aurimas Juška.

* app/widgets/gimpbrushfactoryview.c: Use the same method for
getting the GimpContainer both when adding and when removing the
spacing-changed handler. It was just a coincidence that the
previously different methods retured the same GimpContainer.

svn path=/trunk/; revision=27815
2008-12-20 13:21:03 +00:00
Martin Nordholts
a4b0297b4b New helper functions to lesser level of indirection in client code.
* app/widgets/gimpdatafactoryview.[ch]
(gimp_data_factory_view_have)
(gimp_data_factory_view_get_children_type)
(gimp_data_factory_view_has_data_new_func): New helper functions
to lesser level of indirection in client code.

* app/actions/data-commands.c: Use them.

svn path=/trunk/; revision=27814
2008-12-20 12:27:52 +00:00
Martin Nordholts
7f733cee43 Make instance members private and add getters for accessed members.
* app/widgets/gimpdatafactoryview.[ch]: Make instance members
private and add getters for accessed members.

(gimp_data_factory_view_get_edit_button)
(gimp_data_factory_view_get_duplicate_button)
(gimp_data_factory_view_get_data_factory): New getters.

* app/actions/data-commands.c
* app/widgets/gimppatternfactoryview.c: Use new getters.

svn path=/trunk/; revision=27813
2008-12-20 12:08:28 +00:00
Martin Nordholts
4981816c0b Make instance members private and add getters for required members.
* app/core/gimpdatafactory.[ch]: Make instance members private and
add getters for required members.

(gimp_data_factory_get_container)
(gimp_data_factory_get_gimp)
(gimp_data_factory_has_data_new_func): The new getters.

* app/actions/context-commands.c
* app/actions/data-commands.c
* app/core/gimp-gradients.c
* app/core/gimp.c
* app/core/gimpcontext.c
* app/core/gimpdatafactory.c
* app/core/gimpdatafactory.h
* app/dialogs/convert-dialog.c
* app/dialogs/palette-import-dialog.c
* app/pdb/gimppdb-utils.c
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpdataeditor.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpselectiondata.c
* app/widgets/gimpviewablebox.c
* tools/pdbgen/pdb/brush_select.pdb
* tools/pdbgen/pdb/brushes.pdb
* tools/pdbgen/pdb/gradient_select.pdb
* tools/pdbgen/pdb/gradients.pdb
* tools/pdbgen/pdb/palette_select.pdb
* tools/pdbgen/pdb/palettes.pdb
* tools/pdbgen/pdb/pattern_select.pdb
* tools/pdbgen/pdb/patterns.pdb: Use the getters.


* app/pdb/brush-select-cmds.c
* app/pdb/brushes-cmds.c
* app/pdb/gradient-select-cmds.c
* app/pdb/gradients-cmds.c
* app/pdb/palette-select-cmds.c
* app/pdb/palettes-cmds.c
* app/pdb/pattern-select-cmds.c
* app/pdb/patterns-cmds.c: Regenerated.

svn path=/trunk/; revision=27812
2008-12-19 21:58:17 +00:00
Martin Nordholts
4cb231f53b Introduce temp_buf_get_data_size() and use it.
* app/base/temp-buf.[ch]
* app/widgets/gimpbrushselect.c
* app/widgets/gimppatternselect.c

svn path=/trunk/; revision=27783
2008-12-13 10:51:16 +00:00
Martin Nordholts
ddaa0b48ec s/temp_buf_data/temp_buf_get_data/
* app/base/pixel-region.c
* app/base/temp-buf.c
* app/base/temp-buf.h
* app/core/gimpbrush-load.c
* app/core/gimpbrush-scale.c
* app/core/gimpbrush.c
* app/core/gimpbrushgenerated.c
* app/core/gimpgradient.c
* app/core/gimpimage.c
* app/core/gimppalette.c
* app/core/gimppattern-load.c
* app/core/gimppattern.c
* app/core/gimppreviewcache.c
* app/core/gimpviewable.c
* app/paint-funcs/paint-funcs-generic.h
* app/paint/gimpbrushcore.c
* app/paint/gimpclone.c
* app/paint/gimperaser.c
* app/paint/gimpheal.c
* app/paint/gimpink.c
* app/paint/gimppaintbrush.c
* app/pdb/brush-cmds.c
* app/pdb/brushes-cmds.c
* app/pdb/drawable-cmds.c
* app/pdb/image-cmds.c
* app/pdb/pattern-cmds.c
* app/pdb/patterns-cmds.c
* app/text/gimpfont.c
* app/tools/gimpiscissorstool.c
* app/vectors/gimpvectors-preview.c
* app/widgets/gimpbrushselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpviewrenderer.c

svn path=/trunk/; revision=27782
2008-12-13 10:35:53 +00:00
Martin Nordholts
bcb13c1378 app/core/gimp.c Sort #includes.
* app/core/gimp.c
* app/widgets/gimpdatafactoryview.c: Sort #includes.

svn path=/trunk/; revision=27766
2008-12-04 21:58:45 +00:00
Sven Neumann
ff6bde0a88 also use the translation context for the tooltips.
2008-12-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.[ch]: also use the translation
	context for the tooltips.

	* app/actions/*.c: added translation context to all tooltips. 
Also
	improved some tooltips while I was on it.


svn path=/trunk/; revision=27757
2008-12-04 10:32:20 +00:00
Sven Neumann
74e76f2c6a added an extra parameter for the translation context to all
2008-12-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.[ch]: added an extra parameter for
	the translation context to all gimp_action_group_add methods.

	* app/actions/*.c: added a translation context to all action
	labels. Also unified and improved the labels and tooltips in a 
few
	places.


svn path=/trunk/; revision=27754
2008-12-03 15:27:42 +00:00
Sven Neumann
6c82108236 check that the action name is unique before adding it to a
2008-12-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.c: check that the action name is
	unique before adding it to a GimpActionGroup.


svn path=/trunk/; revision=27751
2008-12-03 13:20:03 +00:00
Sven Neumann
6b74d8d8d6 inlined local variables that are only used once.
2008-11-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderervectors.c
	(gimp_view_renderer_vectors_draw): inlined local variables that
	are only used once.


svn path=/trunk/; revision=27703
2008-11-21 21:15:29 +00:00
Martin Nordholts
9cb700d7f2 For consistency, prefix the #warning:s with FIXME.
* app/widgets/gimpselectioneditor.c: For consistency, prefix the
#warning:s with FIXME.

svn path=/trunk/; revision=27695
2008-11-21 07:16:00 +00:00
Martin Nordholts
2f25fb132f Use GimpContainer getters instead of poking into the class
instance struct.

* app/actions/context-commands.c
* app/actions/data-commands.c
* app/actions/plug-in-commands.c
* app/actions/templates-commands.c
* app/core/gimp-utils.c
* app/core/gimpdrawablestack.c
* app/core/gimpitemstack.c
* app/core/gimplist.c
* app/gui/gui-vtable.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview-utils.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdataeditor.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpsettingsbox.c
* app/widgets/gimpviewablebutton.c

svn path=/trunk/; revision=27693
2008-11-20 23:43:58 +00:00
Martin Nordholts
5aeb568650 s/gimp_container_children_type/gimp_container_get_children_type/
s/gimp_container_policy/gimp_container_get_policy/
s/gimp_container_num_children/gimp_container_get_n_children/

* app/actions/actions.c
* app/actions/file-actions.c
* app/actions/file-commands.c
* app/actions/tool-options-actions.c
* app/actions/tools-actions.c
* app/actions/tools-commands.c
* app/actions/vectors-actions.c
* app/core/gimpcontainer-filter.c
* app/core/gimpcontainer.c
* app/core/gimpcontainer.h
* app/core/gimpimage-convert.c
* app/core/gimpimage-flip.c
* app/core/gimpimage-merge.c
* app/core/gimpimage-resize.c
* app/core/gimpimage-rotate.c
* app/core/gimpimage-scale.c
* app/core/gimpimage-undo.c
* app/core/gimpimage.c
* app/core/gimpimagefile.c
* app/core/gimplist.c
* app/core/gimpundostack.c
* app/dialogs/palette-import-dialog.c
* app/dialogs/quit-dialog.c
* app/display/gimpdisplay.c
* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpdisplayshell-title.c
* app/gui/gui-vtable.c
* app/menus/tool-options-menu.c
* app/tools/gimp-tools.c
* app/widgets/gimpcontrollerlist.c
* app/widgets/gimpimagepropview.c
* app/widgets/gimpsettingsbox.c
* app/widgets/gimpviewablebutton.c
* app/xcf/xcf-load.c
* app/xcf/xcf-save.c

svn path=/trunk/; revision=27692
2008-11-20 22:45:19 +00:00
Martin Nordholts
35c1687678 app/widgets/gimpcontainertreeview.[ch] Make the renderer_cells and
* app/widgets/gimpcontainertreeview.[ch]
* app/widgets/gimpcontainertreeview-private.h: Make the
renderer_cells and toggle_cells members private.

(gimp_container_tree_view_set_main_column_title)
(gimp_container_tree_view_prepend_toggle_cell_renderer)
(gimp_container_tree_view_prepend_cell_renderer): New interface.

* app/widgets/gimptoolview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpcontrollerlist.c: Use new interface.

svn path=/trunk/; revision=27675
2008-11-16 20:58:53 +00:00
Michael Natterer
176f4c5689 app/dialogs/module-dialog.c app/display/gimpscalecombobox.c
2008-11-16  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/module-dialog.c
	* app/display/gimpscalecombobox.c
	* app/tools/gimpgegltool.c
	* app/tools/gimprectangleoptions.c
	* app/widgets/gimpactionview.[ch]
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainerentry.[ch]
	* app/widgets/gimpcontrollereditor.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimpfileprocview.c: s/NUM_COLUMNS/N_COLUMNS/


svn path=/trunk/; revision=27674
2008-11-16 20:17:43 +00:00
Martin Nordholts
72d733ce8f Move container tree view model column enums here and call the last enum
* app/widgets/gimpcontainertreeview.[ch]: Move container tree view
model column enums here and call the last enum _N_COLUMNS.

* app/widgets/widgets-enums.h: Remove the enum. It was meant only
for the container tree view class hierarchy anyway.

svn path=/trunk/; revision=27672
2008-11-16 19:59:16 +00:00
Martin Nordholts
9eda1bb7c8 New setter function so that we can make the "gboolean dnd_drop_to_empty"
* app/widgets/gimpcontainertreeview.[ch]
(gimp_container_tree_view_set_dnd_drop_to_empty): New setter
function so that we can make the "gboolean dnd_drop_to_empty"
class instance member private.

* app/widgets/gimpcontainertreeview-private.h: Move member here.

* app/widgets/gimpcontainertreeview-dnd.c: Go through priv pointer.

* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_init): Use
the new function.

svn path=/trunk/; revision=27671
2008-11-16 19:48:54 +00:00
Martin Nordholts
4a239bcc82 Complete previous commit
svn path=/trunk/; revision=27667
2008-11-15 20:05:28 +00:00
Martin Nordholts
137734aaed Put the GimpContainerTreeView enums here instead of exposing them through
* app/widgets/widgets-enums.h: Put the GimpContainerTreeView enums
here instead of exposing them through silly class instance
members.

* app/widgets/gimpcontainertreeview.c: 
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpsettingseditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptoolview.c: Clean up and use new enum names.

svn path=/trunk/; revision=27666
2008-11-15 20:01:55 +00:00
Martin Nordholts
e78aa3033e Fix gimpcontainertreeview-private.h
svn path=/trunk/; revision=27663
2008-11-15 18:16:40 +00:00
Martin Nordholts
e9153bf52d Don't expose class instance struct members that is currently only used
* app/widgets/gimpcontainertreeview.[ch]: Don't expose class
instance struct members that is currently only used within the
GimpContainerTreeView implementation.

* app/widgets/gimpcontainertreeview-private.h: New file containing
the definition of the private struct.

* app/widgets/gimpcontainertreeview-dnd.c: Change accordingly.

* app/widgets/Makefile.am: Add new file.

svn path=/trunk/; revision=27662
2008-11-15 18:08:50 +00:00
Martin Nordholts
a3eb78b5c7 Remove unused instance struct member "GQuark
* app/widgets/gimpcontainertreeview.h: Remove unused instance
struct member "GQuark invalidate_preview_handler_id".

svn path=/trunk/; revision=27661
2008-11-15 18:00:39 +00:00
Michael Natterer
fb1660a4ea rename gimp_image_floating_sel() to gimp_image_get_floating_selection().
2008-11-14  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: rename gimp_image_floating_sel() to
	gimp_image_get_floating_selection().

	* app/actions/channels-actions.c
	* app/actions/image-actions.c
	* app/actions/layers-actions.c
	* app/actions/layers-commands.c
	* app/actions/select-actions.c
	* app/core/gimpdrawable.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-quick-mask.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimpselection.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpdisplayshell.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimprectangleselecttool.c
	* app/tools/gimpregionselecttool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimplayertreeview.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/image.pdb: changed accordingly, replaced some
	instances of direct acces by the accessor.

	* app/pdb/image-cmds.c: regenerated.


svn path=/trunk/; revision=27649
2008-11-14 15:01:44 +00:00
Sven Neumann
ada8336822 added gimp_image_get_display_name().
2008-11-13  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: added gimp_image_get_display_name().

	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-title.c
	* app/pdb/gimppdb-utils.c

	* app/widgets/gimpviewabledialog.c: use the new method instead 
of
	getting the image URI and mangling it with
	file_utils_uri_display_basename().


svn path=/trunk/; revision=27637
2008-11-13 12:09:05 +00:00
Sven Neumann
b37c8bcf0a app/core/Makefile.am added GIMP_ERROR as general error domain.
2008-11-12  Sven Neumann  <sven@gimp.org>

	* app/core/Makefile.am
	* app/core/gimperror.[ch]: added GIMP_ERROR as general error 
domain.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimpselection.c
	* app/core/gimptooloptions.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpclone.c
	* app/paint/gimpheal.c
	* app/paint/gimppaintcore-stroke.c
	* app/paint/gimpperspectiveclone.c
	* app/paint/gimpsourcecore.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdesaturatetool.c
	* app/tools/gimpgegltool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c
	* app/vectors/gimpvectors-import.c: use GIMP_ERROR as error 
domain
	instead of 0, which is not accepted by g_set_error_literal().

	* app/gui/session.c
	* app/menus/menus.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimpdevices.c: use G_FILE_ERROR as error domain 
for
	file errors.


svn path=/trunk/; revision=27628
2008-11-12 10:56:06 +00:00
Michael Natterer
069bbbd142 move GimpCursorView typedef from here...
2008-11-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h: move GimpCursorView typedef from
	here...

	* app/display/display-types.h: ...to here.


svn path=/trunk/; revision=27585
2008-11-09 19:34:12 +00:00
Michael Natterer
40f27d6b81 app/core/gimpdrawable.c app/core/gimpimage-convert.c
2008-11-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.c
	* app/core/gimpimage-convert.c
	* app/core/gimpprojection-construct.c
	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimplayertreeview.c
	* app/xcf/xcf-save.c: remove inclusion of "gimplayer-floating-sel.h"


svn path=/trunk/; revision=27582
2008-11-09 18:36:29 +00:00
Martin Nordholts
983c3751c2 Prepare GimpCursorView for a dependency to GimpDisplayShell.
* app/widgets/gimpcursorview.[ch]: Move from here...

* app/display/gimpcursorview.[ch]: ...to here.

* app/widgets/Makefile.am
* app/display/Makefile.am: Change accordingly.

* app/actions/cursor-info-actions.c
* app/dialogs/dialogs-constructors.c
* app/actions/cursor-info-commands.c
* app/display/gimpdisplayshell-cursor.c: Update includes.

svn path=/trunk/; revision=27581
2008-11-09 17:51:43 +00:00
Martin Nordholts
b2379f44b3 Don't expose implementation details, introduce internal helper functions,
* app/widgets/gimpcursorview.[ch]: Don't expose implementation
details, introduce internal helper functions, and make coordinates
outside the image be represented with an italic font instead of
enclosed in parenthesis.

svn path=/trunk/; revision=27578
2008-11-09 14:02:38 +00:00
Sven Neumann
02817081ff use NC_() to mark enum values for translation. Use a lower-case short form
2008-11-06  Sven Neumann  <sven@gimp.org>

	* tools/gimp-mkenums: use NC_() to mark enum values for 
translation.
	Use a lower-case short form of the type name as translation 
context.

	* libgimp/libgimp-intl.h: define the NC_() macro as noop.

	* libgimpbase/gimpbasetypes.[ch]
	* libgimpbase/gimpbase.def: added new functions to set and
	get a translation context on an enum type.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/plug-in/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am:
	* libgimpconfig/Makefile.am
	* libgimpthumb/Makefile.am
	* libgimpwidgets/Makefile.am: register the translation context
	with the enum types.

	* app/display/display-enums.h
	* libgimpbase/gimpbaseenums.h
	* libgimpconfig/gimpcolorconfig-enums.h: removed old-style 
explicit
	translation context.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/plug-in/plug-in-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c
	* libgimpconfig/gimpcolorconfig-enums.c
	* libgimpwidgets/gimpwidgetsenums.c: regenerated.


svn path=/trunk/; revision=27562
2008-11-06 08:28:28 +00:00
Sven Neumann
4762b73403 bumped minimum required version of GLib to 2.18.0.
2008-11-04  Sven Neumann  <sven@sven>

	* configure.in: bumped minimum required version of GLib to 
2.18.0.

	* INSTALL: document the updated dependency.

	* app/core/gimp.[ch]: introduced gimp_message_literal(), a 
variant
	of gimp_message() that takes a literal string.

	* app/errors.[ch]: removed format arguments from 
gimp_fatal_error()
	and gimp_terminate() and let them take a literal string instead.

	* app/tools/gimptool.[ch]: introduced 
gimp_tool_message_literal(),
	a variant of gimp_tool_message() that takes a literal string.

	* app/actions/documents-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/error-console-commands.c
	* app/actions/file-commands.c
	* app/actions/gradients-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/config/gimprc.c
	* app/core/gimp-modules.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimp-units.c
	* app/core/gimpchannel.c
	* app/core/gimpcontainer-filter.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/dialogs/convert-dialog.c
	* app/dialogs/dialogs.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/dialogs/quit-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.c
	* app/file/file-procedure.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/gegl/gimpcurvesconfig.c
	* app/gegl/gimplevelsconfig.c
	* app/gui/gui-message.c
	* app/gui/gui.c
	* app/gui/session.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpclone.c
	* app/paint/gimpheal.c
	* app/paint/gimpperspectiveclone.c
	* app/paint/gimpsourcecore.c
	* app/pdb/gimppdb-utils.c
	* app/pdb/gimpprocedure.c
	* app/plug-in/gimpplugin-message.c
	* app/plug-in/gimpplugin.c
	* app/plug-in/gimppluginmanager-restore.c
	* app/plug-in/gimppluginprocedure.c
	* app/text/gimptextlayer.c
	* app/tools/gimp-tools.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdesaturatetool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpforegroundselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpgegltool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool-settings.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsourcetool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpactionview.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimpcontrollers.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppdbdialog.c
	* app/widgets/gimpsettingsbox.c
	* app/widgets/gimpvectorstreeview.c
	* app/widgets/gimpwidgets-utils.c
	* app/xcf/xcf-load.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/floating_sel.pdb
	* tools/pdbgen/pdb/image.pdb: use the _literal variants for
	g_set_error(), gimp_message() and gimp_tool_message().

	* app/pdb/convert-cmds.c
	* app/pdb/edit-cmds.c
	* app/pdb/floating-sel-cmds.c
	* app/pdb/image-cmds.c: regenerated.


svn path=/trunk/; revision=27548
2008-11-04 12:33:09 +00:00
Martin Nordholts
052a86548e Arrange layer modes into more logical and useful groups.
* app/widgets/gimpwidgets-constructors.c
(gimp_paint_mode_menu_new): Arrange layer modes into more logical
and useful groups.

svn path=/trunk/; revision=27540
2008-11-03 22:56:28 +00:00
Sven Neumann
fe520925b7 app/base/Makefile.am app/core/Makefile.am app/display/Makefile.am
2008-11-03  Sven Neumann  <sven@gimp.org>

	
	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/plug-in/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: 
	* libgimpconfig/Makefile.am
	* libgimpthumb/Makefile.am
	* libgimpwidgets/Makefile.am: micro-optimization in the 
generated
	enum registration code.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/plug-in/plug-in-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c
	* libgimpconfig/gimpcolorconfig-enums.c
	* libgimpwidgets/gimpwidgetsenums.c: regenerated.


svn path=/trunk/; revision=27538
2008-11-03 21:38:13 +00:00
Michael Natterer
b994ab724e app/core/gimp-edit.c app/core/gimpchannel.c
2008-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-edit.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpdrawable.c
	* app/core/gimpdrawablemodundo.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimpselection.c
	* app/text/gimptext-compat.c
	* app/text/gimptextlayer-xcf.c
	* app/vectors/gimpvectorsmodundo.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb: use accessors for item->offset_x,y.
	Some minor unrelated cleanups.

	* app/pdb/layer-cmds.c: regenerated.


svn path=/trunk/; revision=27537
2008-11-03 21:17:50 +00:00
Michael Natterer
740ab5e633 renamed gimp_item_width() to gimp_item_get_width() and gimp_item_height()
2008-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: renamed
	gimp_item_width() to gimp_item_get_width() and
	gimp_item_height() to gimp_item_get_height().

	* app/actions/channels-commands.c
	* app/actions/drawable-commands.c
	* app/actions/layers-commands.c
	* app/core/<many>.c
	* app/dialogs/offset-dialog.c
	* app/dialogs/resize-dialog.c
	* app/dialogs/scale-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimpink.c
	* app/paint/gimppaintcore.c
	* app/paint/gimpsmudge.c
	* app/text/gimptextlayer-xcf.c
	* app/text/gimptextlayer.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpforegroundselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimprectangletool.c
	* app/tools/gimpregionselecttool.c
	* app/tools/gimptexttool.c
	* app/vectors/gimpvectors.c
	* app/vectors/gimpvectorsmodundo.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderervectors.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/drawable.pdb: changed accordingly.

	* app/pdb/drawable-cmds.c: regenerated.


svn path=/trunk/; revision=27531
2008-11-03 00:09:01 +00:00
Michael Natterer
5b68a1d0eb renamed gimp_item_offsets() to gimp_item_get_offset() and
2008-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: renamed
	gimp_item_offsets() to gimp_item_get_offset() and
	gimp_item_set_offsets() to gimp_item_set_offset().

	* app/actions/drawable-commands.c
	* app/actions/layers-commands.c
	* app/core/<many>.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-preview.c
	* app/display/gimpdisplayshell-transform.c
	* app/display/gimpdisplayshell.c
	* app/paint/gimppaintcore-stroke.c
	* app/paint/gimppaintcore.c
	* app/paint/gimpsourcecore.c
	* app/text/gimptextlayer-xcf.c
	* app/tools/<many>.c
	* app/widgets/gimptoolbox-dnd.c
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/drawable_transform.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/transform_tools.pdb
	* tools/pdbgen/pdb/vectors.pdb: changed accordingly.

	* app/pdb/drawable-cmds.c
	* app/pdb/drawable-transform-cmds.c
	* app/pdb/selection-cmds.c
	* app/pdb/vectors-cmds.c
	* app/pdb/transform-tools-cmds.c: regenerated.


svn path=/trunk/; revision=27529
2008-11-02 23:03:29 +00:00
Michael Natterer
a748e3f58e add new functions gimp_get_image_iter(), display_iter() and
2008-11-02  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp.[ch]: add new functions gimp_get_image_iter(),
	display_iter() and tool_info_iter().

	* app/tools/gimp-tools.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c
	* app/dialogs/quit-dialog.c
	* app/gui/gui.c
	* app/menus/windows-menu.c
	* app/actions/images-commands.c
	* app/actions/tools-actions.c
	* app/actions/windows-actions.c
	* app/actions/tool-options-commands.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplay-foreach.c
	* app/widgets/gimptoolbox.c
	* tools/pdbgen/pdb/image.pdb: use them here.

	* app/pdb/image-cmds.c: regenerated.


svn path=/trunk/; revision=27526
2008-11-02 21:34:14 +00:00
Michael Natterer
d1ca165b4e add new functions gimp_image_get_layer_iter(), channel_iter() and
2008-11-02  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: add new functions
	gimp_image_get_layer_iter(), channel_iter() and vectors_iter()
	which return the GList inside the resp. GimpList.

	* app/actions/channels-actions.c
	* app/actions/layers-actions.c
	* app/actions/vectors-actions.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-item-list.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage.c
	* app/core/gimpimage.h
	* app/core/gimpprojection-construct.c
	* app/display/gimpdisplayshell-draw.c
	* app/file/file-open.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpdrawtool.c
	* app/vectors/gimpvectors-compat.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimplayertreeview.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/image.pdb: use the new functions instead of
	peeking both into the image and the list. Remove inclusions of
	"gimplist.h" or change them into "gimpcontainer.h" if needed.

	* app/pdb/image-cmds.c: regenerated.


svn path=/trunk/; revision=27524
2008-11-02 20:46:57 +00:00
Sven Neumann
2fe030bd19 Bug 558660 – help behavior for locales without manual translation
2008-10-31  Sven Neumann  <sven@gimp.org>

	Bug 558660 – help behavior for locales without manual 
translation
	
	* app/widgets/gimphelp.c (gimp_help_user_manual_is_installed):
	as a fallback check for the english user manual.


svn path=/trunk/; revision=27500
2008-10-31 20:00:19 +00:00
Michael Natterer
e616b56880 move the "Antialias" toggle from here...
2008-10-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpstrokeeditor.c: move the "Antialias" toggle from
	here...

	* app/widgets/gimpfilleditor.c: ...to here because it makes sense
	for both filling and stroking.


svn path=/trunk/; revision=27458
2008-10-29 13:30:47 +00:00
Michael Natterer
88db29948b added "gboolean below" to gimp_enum_radio_frame_add() and
2008-10-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added "gboolean below" to
	gimp_enum_radio_frame_add() and gimp_enum_radio_box_add() and
	place the widget right of the radio button unless "below" is TRUE.

	* app/dialogs/convert-dialog.c
	* app/dialogs/layer-add-mask-dialog.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpperspectiveclonetool.c
	* app/widgets/gimpfilleditor.c: pass TRUE so everything stays as-is.


svn path=/trunk/; revision=27450
2008-10-28 17:40:32 +00:00
Michael Natterer
ee414d9e6f Merge on-canvas GSoC project:
2008-10-26  Michael Natterer  <mitch@gimp.org>

	Merge on-canvas GSoC project:

	* configure.in: check for pangocairo.

	* app/Makefile.am
	* app/text/Makefile.am: add its CFLAGS and LIBS.

	* app/text/gimptext-bitmap.[ch]
	* app/text/gimptext-private.h
	* app/text/gimptext-vectors.[ch]
	* app/text/gimptextlayer.c
	* app/text/gimptextlayout-render.c
	* app/text/gimptextlayout.c: port to pangocairo.

	* menus/Makefile.am
	* menus/text-tool-menu.xml
	* app/menus/menus.c
	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/text-tool-actions.[ch]
	* app/actions/text-tool-commands.[ch]: add a context menu for the
	text tool similar to GtkEntry's context menu.

	* app/tools/gimprectangletool.[ch]: add "narrow-mode" property.

	* app/tools/gimptextoptions.[ch]
	* app/widgets/gimptexteditor.[ch]: take a text buffer for the
	standalone text editor window instead of creating one internally.

	* app/tools/gimptexttool.[ch]: all the new wonderful on-canvas
	text editing logic. Wheee!


svn path=/trunk/; revision=27419
2008-10-26 17:39:55 +00:00
Michael Natterer
90c26cf10e add non-serializable properties pattern-view-type and pattern-view-size
2008-10-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpfilloptions.[ch]: add non-serializable properties
	pattern-view-type and pattern-view-size which are used only by the
	new UI below.

	* app/widgets/gimpfilleditor.[ch]: added boolean edit-context
	property. If TRUE, add widgets to edit the context's foreground and
	pattern. Add "edit_context" parameter to gimp_fill_editor_new().

	* app/widgets/gimpstrokeeditor.[ch]: add the same parameter here.

	* app/widgets/gimpwidgets-utils.[ch]: add gimp_enum_radio_box_add()
	which does the same as the existing gimp_enum_radio_frame_add().

	* app/dialogs/stroke-dialog.c: pass FALSE for "edit_context"
	because this dialog takes its foreground and pattern from the user
	context and doesn't need it's own GUI for them.


svn path=/trunk/; revision=27392
2008-10-24 22:34:24 +00:00
Michael Natterer
9c299a8f03 app/widgets/Makefile.am app/widgets/widgets-types.h new widget factored
2008-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfilleditor.[ch]: new widget factored out of
	GimpStrokeEditor.

	* app/widgets/gimpstrokeeditor.[ch]: derive from GimpFillEditor
	and remove UI for the properties of GimpFillOptions.


svn path=/trunk/; revision=27390
2008-10-24 17:55:30 +00:00
Sven Neumann
4260576f0e to be on the safe side, always show hidden dialogs when the Tab key is
2008-10-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c 
(gimp_dialog_factories_toggle):
	to be on the safe side, always show hidden dialogs when the Tab
	key is used. It should not be possible to get a Tab key-press
	while all displays are iconified, but you never know ...


svn path=/trunk/; revision=27385
2008-10-24 07:16:06 +00:00
Sven Neumann
bf97ad3102 Bug 556896 – Dialogs don't get minimized with single image window
2008-10-24  Sven Neumann  <sven@gimp.org>

	Bug 556896 – Dialogs don't get minimized with single image 
window

	* app/widgets/gimpdialogfactory.[ch]: renamed the new methods to
	gimp_dialog_factories_{show|hide}_with_display().
	Remember if the dialogs were hidden using
	gimp_dialog_factories_hide_with_display() or using
	gimp_dialog_factories_toggle() and keep this into account when
	making them visible again. This ensures that dialogs that were
	hidden using the Tab key won't be shown when the image window is
	uniconified.

	* app/display/gimpdisplayshell.c
	(gimp_display_shell_window_state_event): changed accordingly.


svn path=/trunk/; revision=27384
2008-10-24 06:48:56 +00:00
Sven Neumann
45b41a76d1 Bug 556896 – Dialogs don't get minimized with single image window
2008-10-23  Sven Neumann  <sven@gimp.org>

	Bug 556896 – Dialogs don't get minimized with single image 
window

	* app/display/gimpdisplay-foreach.[ch]: added utility function 
to
	get the number of visible (not withdrawn or iconified) displays.

	* app/widgets/gimpdialogfactory.[ch]: added functions to hide 
and
	show the dock windows. Changed gimp_dialog_factories_toggle() to
	use the new functions.

	* app/display/gimpdisplayshell.c
	(gimp_display_shell_window_state_event): hide the docks if the
	last display is iconified. Unhide them if a display is
	uniconified. Probably needs more work ...


svn path=/trunk/; revision=27374
2008-10-23 08:39:46 +00:00
Sven Neumann
883cb6da5b set box->progress to NULL in destroy() and check for progress being NULL
2008-10-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprogressbox.c: set box->progress to NULL in
	destroy() and check for progress being NULL in various places so
	we don't crash on API calls after the widget is destroyed.


svn path=/trunk/; revision=27362
2008-10-22 11:01:15 +00:00
Sven Neumann
90bf1e42e5 Bug 555246 – gimp crashes when a file is opened while a preview is
2008-10-22  Sven Neumann  <sven@gimp.org>

	Bug 555246 – gimp crashes when a file is opened while a preview 
is
	generating

	* app/widgets/gimpthumbbox.c: set box->progress to NULL in
	destroy() and check for progress being NULL in various places so
	we don't crash on API calls after the widget is destroyed.


svn path=/trunk/; revision=27360
2008-10-22 07:26:49 +00:00
Michael Natterer
ff8e73ad0c set dialog->progress to NULL in destroy() and check for progress being
2008-10-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c: set dialog->progress to NULL in
	destroy() and check for progress being NULL in various places so
	we don't crash on API calls after the widget is destroyed.


svn path=/trunk/; revision=27354
2008-10-21 19:23:44 +00:00
Sven Neumann
4c357c5f0d don't make the font size even smaller. We already use a smaller font in
2008-10-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrorconsole.c (gimp_error_console_init): 
don't
	make the font size even smaller. We already use a smaller font 
in
	the dock windows.


svn path=/trunk/; revision=27341
2008-10-20 13:48:55 +00:00
Sven Neumann
8c6a7e8843 use pointer coordinates from the passed event instead of calling
2008-10-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.c (view_events) 
(control_events):
	use pointer coordinates from the passed event instead of calling
	gtk_widget_get_pointer().


svn path=/trunk/; revision=27340
2008-10-20 13:31:59 +00:00
Martin Nordholts
e38ca5490a Rename the convenient channel offset defines from FOO_PIX to FOO as this
* app/base/base-types.h: Rename the convenient channel offset
defines from FOO_PIX to FOO as this increases readability.

* app/base/color-balance.c
* app/base/colorize.c
* app/base/desaturate.c
* app/base/hue-saturation.c
* app/base/siox.c
* app/base/threshold.c

* app/core/gimp-edit.c
* app/core/gimp-transform-region.c
* app/core/gimpchannel.c
* app/core/gimpdrawable-bucket-fill.c
* app/core/gimpdrawable-convert.c
* app/core/gimpdrawable-stroke.c
* app/core/gimpdrawable.c
* app/core/gimpimage-convert.c
* app/core/gimpimage.c
* app/core/gimppalette-import.c
* app/core/gimppickable.c

* app/gegl/gimpoperation*mode.c
* app/gegl/gimpoperationcolorbalance.c
* app/gegl/gimpoperationcolorize.c
* app/gegl/gimpoperationhuesaturation.c
* app/gegl/gimpoperationlevels.c
* app/gegl/gimpoperationposterize.c
* app/gegl/gimpoperationthreshold.c

* app/paint-funcs/subsample-region.c

* app/paint/gimpclone.c
* app/paint/gimppaintbrush.c

* app/widgets/gimpviewrenderer.c: Adapt.

svn path=/trunk/; revision=27324
2008-10-19 13:47:09 +00:00
Sven Neumann
584c70fed2 just some cleanup.
2008-10-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderervectors.c
	(gimp_view_renderer_vectors_draw): just some cleanup.


svn path=/trunk/; revision=27293
2008-10-15 23:04:40 +00:00
Sven Neumann
ce4c2c3bfc let new docks appear at the pointer position.
2008-10-14  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c 
(gimp_dialog_factory_add_dialog):
	let new docks appear at the pointer position.


svn path=/trunk/; revision=27282
2008-10-14 21:39:14 +00:00
Martin Nordholts
a07e8586a5 Initialize 'index'.
* app/widgets/gimpdockseparator.c (gimp_dock_separator_drag_drop):
Initialize 'index'.

svn path=/trunk/; revision=27226
2008-10-11 08:42:57 +00:00
Martin Nordholts
8b459318d4 Add a GtkAnchorType member to GimpDockSeparator that specifies where a
* app/widgets/gimpdockseparator.c (gimp_dock_separator_new): Add a
GtkAnchorType member to GimpDockSeparator that specifies where a
dropped dockable shall be inserted.

(gimp_dock_separator_drag_drop): Get rid of the ugly hack where
the role of a given separator was based on its position as a child
in its container. Simply decide what role the separator has by
loooking at its anchor-member.

* app/widgets/gimpdock.c (gimp_dock_init)
(gimp_dock_add_book): Give the GimpDockSeparators their
appropriate roles directly at their construction.

svn path=/trunk/; revision=27218
2008-10-10 23:10:21 +00:00
Michael Natterer
5503e6a055 Add GEGL_CFLAGS and #includes as if gimpdrawable.h and gimpimage.h had a
2008-10-09  Michael Natterer  <mitch@gimp.org>

	Add GEGL_CFLAGS and #includes as if gimpdrawable.h and gimpimage.h
	had a GEGL dependency (they will have in the next commit, but I
	wanted to keep the commit separate).

	* app/dialogs/Makefile.am
	* app/file/Makefile.am
	* app/gui/Makefile.am
	* app/menus/Makefile.am
	* app/paint/Makefile.am
	* app/plug-in/Makefile.am
	* app/text/Makefile.am
	* app/vectors/Makefile.am
	* app/widgets/Makefile.am
	* app/xcf/Makefile.am: add GEGL_CFLAGS.

	* app/actions/*.c
	* app/core/*.c
	* app/dialogs/*.c
	* app/display/*.c
	* app/file/*.c
	* app/gui/*.c
	* app/menus/*.c
	* app/paint/*.c
	* app/pdb/gimppdb-utils.c
	* app/pdb/gimpprocedure.c
	* app/plug-in/*.c
	* app/text/*.c
	* app/tools/*.c
	* app/vectors/*.c
	* app/widgets/*.c
	* app/xcf/*.c: add <gegl.h> or replace <glib-object.h> by <gegl.h>
	to all files which include a drawable subclass or gimpimage.h

	* tools/pdbgen/app.pl: include <gegl.h> instead of <glib-object.h>
	in all generated files.

	* app/pdb/*-cmds.c: regenerated.

	* data/images/gimp-splash.png: the goat is still sleeping.
	By Aurore Derriennic.


svn path=/trunk/; revision=27202
2008-10-09 20:24:04 +00:00
Michael Natterer
0e4a35a2d8 Remove the last code duplication from the undo system (or if not the last
2008-10-09  Michael Natterer  <mitch@gimp.org>

	Remove the last code duplication from the undo system (or if not
	the last then at least the most ugly):

	* app/core/gimpimage.[ch] (gimp_image_add_layer,channel,vectors):
	add "gboolean push_undo" parameter and add the item without
	touching undo if it's TRUE. Changed assertions from
	g_object_is_floating() to !gimp_item_is_attached() so they also
	take items from the undo stack and not only newly created ones.

	(gimp_image_remove_layer,channel,vectors): add "push_undo"
	parameter here too. Also add a "new_active" parameter where an
	optional new active item can be passed.

	(gimp_image_remove_layer,channel): these functions must not be
	called with push_undo=FALSE and a floating selection attached to
	the layer/channel. This can't currently happen; added warnings in
	case other code is changed and makes it happen anyway.

	* app/core/gimpchannelundo.c
	* app/core/gimplayerundo.c
	* app/vectors/gimpvectorsundo.c: use above functions to add/remove
	items instead of duplicating (parts of) their code. Pass
	push_undo=FALSE and the previously active item to the remove()
	functions.

	* app/actions/channels-commands.c
	* app/actions/edit-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpchannelundo.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-quick-mask.c
	* app/core/gimpimage-scale.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayerundo.c
	* app/core/gimpselection.c
	* app/core/gimptemplate.c
	* app/display/gimpdisplayshell-dnd.c
	* app/text/gimptext-compat.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c
	* app/vectors/gimpvectors-import.c
	* app/vectors/gimpvectorsundo.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimpvectorstreeview.c
	* app/xcf/xcf-load.c
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass TRUE
	unless it's a new image like when loading and XCF file).

	* app/pdb/image-cmds.c
	* app/pdb/paths-cmds.c: regenerated.


svn path=/trunk/; revision=27200
2008-10-09 19:40:41 +00:00
Michael Natterer
e21935a7b9 Bug 134956 – Curves tool doesn't save free curves
2008-10-09  Michael Natterer  <mitch@gimp.org>

	Bug 134956 – Curves tool doesn't save free curves

	* app/core/gimpmarshal.list
	* app/widgets/gimpsettingsbox.[ch]: add signal "file-dialog-setup"
	and emit it when the export/import file chooser is fully
	constructed. Callbacks can then do additional things to the
	dialog, like adding custom buttons.

	* app/tools/gimpcurvestool.h
	* app/tools/gimplevelstool.h: add boolean member
	"export_old_format".

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c (gimp_*_tool_dialog): connect to
	the settings box' "file-dialog-setup".

	(gimp_*_tool_export_setup): new callback which adds a toggle to
	the file choosers that allows to export to the old format.
	Default saving the new format, we defaulted to the old one before.

	(gimp_*_tool_settings_export): check the "export_old_format"
	boolean and only save the cruft format if it is TRUE; chain up
	otherwise, which generically saves the new format.

	* app/tools/gimplevelstool.c (gimp_levels_tool_settings_import):
	add the same file format detection code as in the curves tool
	so it transparently loads old and new levels files.


svn path=/trunk/; revision=27194
2008-10-09 15:25:59 +00:00
Michael Natterer
f6e04aed60 Bug 555362 – gimp-remote is not working properly
2008-10-07  Michael Natterer  <mitch@gimp.org>

	Bug 555362 – gimp-remote is not working properly

	* app/widgets/gimptoolbox-dnd.c (gimp_toolbox_dnd_init): add the
	window itself as drop traget again so gimp-remote works.


svn path=/trunk/; revision=27164
2008-10-07 21:10:29 +00:00
Michael Natterer
321913dd6d Allow to "Open as Layers" in the empty display:
2008-10-05  Michael Natterer  <mitch@gimp.org>

	Allow to "Open as Layers" in the empty display:

	* app/widgets/gimpfiledialog.[ch]: add member
	"gboolean open_as_layers". Rename gimp_file_dialog_set_image() to
	gimp_file_dialog_set_save_image() and add
	gimp_file_dialog_set_open_image() which sets both the image to
	load layers into and the "open_as_layers" boolean.

	* app/dialogs/file-open-dialog.c (file_open_dialog_response): look
	at dialog->open_as_layers instead of dialog->image to decide whether
	to open as layers (that's much more obvious). Enable open as layers
	without existing image by creating the image if it doesn't exist.

	* app/actions/file-commands.c (file_open_dialog_show): add "title"
	parameter and take the uri from the image if none was passed. Use the
	new gimp_file_dialog_set_open_image() instead of poking into the
	dialog struct. Change callers to pass the title and not get the
	uri from the image; instead always pass the image.

	* app/actions/file-actions.c (file_actions_update): keep
	"Open as Layers" sensitive even without image.


svn path=/trunk/; revision=27135
2008-10-05 15:21:02 +00:00
Hans Breuer
d94419a9fd updated include <string.h> for memcmp() include <string.h> for strcmp()
2008-10-03  Hans Breuer  <hans@breuer.org>

	* **/makefie.msc gimpdefs.msc app/gimpcore.def : updated
	* app/core/gimpcurve.c : include <string.h> for memcmp()
	* app/gegl/gimpcurvesconfig.c : include <string.h> for strcmp()

svn path=/trunk/; revision=27118
2008-10-03 19:27:54 +00:00
Michael Natterer
68acc6598c Bug 554646 – Opening Help crashes GIMP with lqr-plugin installed
2008-10-02  Michael Natterer  <mitch@gimp.org>

	Bug 554646 – Opening Help crashes GIMP with lqr-plugin installed

	* app/widgets/gimphelp.c (gimp_help_get_help_domains): need to
	assign (*foo)[i] and not *foo[i] of a gchar** returned via return
	value location.


svn path=/trunk/; revision=27113
2008-10-02 17:16:14 +00:00
Tor Lillqvist
8d024f303d : Don't #define _GNU_SOURCE on Windows as it confuses newest mingw
2008-10-01  Tor Lillqvist  <tml@novell.com>

	* app/widgets/gtkscalebutton.c: : Don't #define _GNU_SOURCE on
	Windows as it confuses newest mingw headers.


svn path=/trunk/; revision=27097
2008-10-01 12:32:31 +00:00
Sven Neumann
ca0b070852 added gimp_pango_layout_set_scale().
2008-09-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added
	gimp_pango_layout_set_scale().

	* app/gui/splash.c: set a smaller font size on the lower label.


svn path=/trunk/; revision=27088
2008-09-30 11:16:28 +00:00
Sven Neumann
945fdb7cc0 actually use the passed weight.
2008-09-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.c 
(gimp_pango_layout_set_weight):
	actually use the passed weight.


svn path=/trunk/; revision=27087
2008-09-30 11:09:06 +00:00
Martin Nordholts
958de4c297 Bug 554125 – Tab key doesn't hide utility windows when there is no
image open.
	
* app/widgets/gimpdialogfactory.[ch]: Add 'toggle_visibility' to
GimpDialogFactory and as a parameter to gimp_dialog_factory_new(),
and set it there.

(gimp_dialog_factories_hide_foreach): Don't hide dialogs belonging
to factories with toggle_visibility FALSE.

* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_canvas_tool_events): Move no-image event
handling to a new helper function, and make pressing Tab hide
windows.

* app/dialogs/dialogs.c (dialogs_init): Allow toggling visibility
for all factories except the display-factory.

svn path=/trunk/; revision=27077
2008-09-29 15:42:56 +00:00
Michael Natterer
a4ff76a5ac remove some casts that were always useless and are even more useless now
2008-09-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factories_show_foreach)
	(gimp_dialog_factories_hide_foreach): remove some casts that were
	always useless and are even more useless now after the recent
	readability improvement.


svn path=/trunk/; revision=27075
2008-09-29 11:08:42 +00:00
Martin Nordholts
6e876e8f7c Increase readability with widget = list->data.
* app/widgets/gimpdialogfactory.c
(gimp_dialog_factories_show_foreach)
(gimp_dialog_factories_hide_foreach): Increase readability with
widget = list->data.

svn path=/trunk/; revision=27068
2008-09-28 07:46:48 +00:00
Michael Natterer
e9958b1bc7 reorder functions and add static prototypes.
2008-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpnavigationview.c: reorder functions and add
	static prototypes.


svn path=/trunk/; revision=27065
2008-09-26 18:21:36 +00:00
Michael Natterer
8fb79f1439 call gimp_controller_editor_sel_changed() with the right GtkTreeSelection
2008-09-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_edit_response): call
	gimp_controller_editor_sel_changed() with the right
	GtkTreeSelection object (the editor's, not the action
	list's). Fixes crash upon selecting an action for a controller
	event. Spotted by Alexander Rabtchevich.


svn path=/trunk/; revision=27041
2008-09-24 09:12:36 +00:00
Sven Neumann
a8cc137009 Move the "Use GEGL" check-box to the Colors menu (bug #548760):
2008-09-23  Sven Neumann  <sven@gimp.org>

	Move the "Use GEGL" check-box to the Colors menu (bug #548760):

	* app/actions/Makefile.am
	* app/actions/config-actions.[ch]
	* app/actions/config-commands.[ch]: new files holding the 
"config"
	action group that includes the "use-gegl" toggle action.

	* app/actions/debug-actions.c
	* app/actions/debug-commands.[ch]: removed the "use-gegl" 
action
	here.

	* app/menus/menus.c
	* app/actions/actions.c: added the new action group.

	* app/widgets/gimphelp-ids.h: added a help ID for the 
"use-gegl"
	action.

	* menus/image-menu.xml.in: moved the "Use GEGL" check-box to 
the
	Colors menu.


svn path=/trunk/; revision=27035
2008-09-23 07:02:24 +00:00
Sven Neumann
5f8befc536 don't set a help ID on the display menu items.
2008-09-21  Sven Neumann  <sven@gimp.org>

	* app/actions/windows-actions.c: don't set a help ID on the
	display menu items.

	* app/widgets/gimphelp-ids.h: removed now unused help ID.

	* app/menus/windows-menu.c: show a larger image preview in the
	tooltip.


svn path=/trunk/; revision=27028
2008-09-21 18:53:14 +00:00
Michael Natterer
651cb5b325 reset the RC styles of the dock's children after parsing the RC file
2008-09-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdock.c (gimp_dock_style_set): reset the RC
	styles of the dock's children after parsing the RC file snippet
	for them. Fixes font size for detached dockables.


svn path=/trunk/; revision=26992
2008-09-18 10:55:53 +00:00
Sven Neumann
0490cd0a75 made the font scale factor for the docks configurable in gtkrc.
2008-09-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdock.c: made the font scale factor for the 
docks
	configurable in gtkrc.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: for documentation purposes, added the
	default value for GimpDock::font-scale here. Changed all style
	property names to use the canonical names.


svn path=/trunk/; revision=26988
2008-09-18 09:33:20 +00:00
Michael Natterer
2f13a57002 cosmetic paranoia.
2008-09-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.c: cosmetic paranoia.


svn path=/trunk/; revision=26971
2008-09-17 11:44:17 +00:00
Michael Natterer
68c21b49e9 Revert the change which adds GError parameters to
2008-09-17  Michael Natterer  <mitch@gimp.org>

	Revert the change which adds GError parameters to
	gimp_image_add_{channel,layer,vectors}():

	* app/actions/channels-commands.c
	* app/actions/edit-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-quick-mask.c
	* app/core/gimpimage.[ch]
	* app/core/gimplayer-floating-sel.c
	* app/core/gimpselection.c
	* app/core/gimptemplate.c
	* app/display/gimpdisplayshell-dnd.c
	* app/text/gimptext-compat.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c
	* app/vectors/gimpvectors-import.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimpvectorstreeview.c
	* app/xcf/xcf-load.c: revert.

	Instead, fix it at the PDB level:

	* app/core/gimpimage.c: turn the "added to wrong image" warning
	into a g_return_val_if_fail() assertion.

	* app/pdb/gimppdb-utils.[ch] (gimp_pdb_item_is_floating): add a
	"dest_image" parameter and fail if the passed item is not for this
	image.

	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/paths.pdb: pass the dest image to
	gimp_pdb_item_is_floating().

	* app/pdb/image-cmds.c
	* app/pdb/layer-cmds.c
	* app/pdb/paths-cmds.c: regenerated.


svn path=/trunk/; revision=26970
2008-09-17 11:41:54 +00:00
Michael Natterer
b0dab70de8 add GError parameter to gimp_image_add_{channel,layer,vectors}() and
2008-09-17  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: add GError parameter to
	gimp_image_add_{channel,layer,vectors}() and remove calls to
	g_warning(). Changed checks to be possible failures at all.

	* app/widgets/gimpitemtreeview.h (GimpAddItemFunc): add the GError
	here too.

	* app/actions/channels-commands.c
	* app/actions/edit-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-quick-mask.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimpselection.c
	* app/core/gimptemplate.c
	* app/display/gimpdisplayshell-dnd.c
	* app/text/gimptext-compat.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c
	* app/vectors/gimpvectors-import.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimpvectorstreeview.c
	* app/xcf/xcf-load.c: pass a NULL error.

	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/paths.pdb: pass the error.

	* app/pdb/image-cmds.c
	* app/pdb/paths-cmds.c: regenerated.


svn path=/trunk/; revision=26963
2008-09-17 08:27:35 +00:00
Michael Natterer
420b60b8de factor out function that selects a path and scrolls to that path. Keep the
2008-09-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.c: factor out function that selects a
	path and scrolls to that path. Keep the selected path visible if
	it is still there after filtering.


svn path=/trunk/; revision=26914
2008-09-10 10:44:41 +00:00
Martin Nordholts
59a62ce7a1 Invalidating the view renderer is just plain wrong, revert to redrawing
* app/widgets/gimpnavigationview.c
(gimp_navigation_view_set_marker): Invalidating the view renderer
is just plain wrong, revert to redrawing the view. We will need to
solve the flicker in some other way.

svn path=/trunk/; revision=26894
2008-09-07 16:19:32 +00:00
Michael Natterer
f1b8cab63d Bug 545325 – Scrollbars do not disappear automatically
2008-09-05  Michael Natterer  <mitch@gimp.org>

	Bug 545325 – Scrollbars do not disappear automatically

	* app/widgets/gimpcontainertreeview.c: autosize the columns after
	each operation that can reduce the treeview's width.


svn path=/trunk/; revision=26875
2008-09-05 14:06:01 +00:00
Michael Natterer
0194327f6d app/widgets/Makefile.am app/widgets/widgets-types.h new simple widget
2008-09-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactioneditor.[ch]: new simple widget which
	contains a GimpActionView plus the search entry.

	* app/dialogs/keyboard-shortcuts-dialog.c: use the new widget
	instead of implementing the search entry here.

	* app/widgets/gimpcontrollereditor.c: use a GimpActionEditor
	instead of GimpActionView so the actions become searchable here
	too.


svn path=/trunk/; revision=26870
2008-09-05 10:37:06 +00:00
Michael Natterer
4bbc40b732 add a column for the casefold label of the action and filter on that.
2008-09-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.[ch]: add a column for the casefold
	label of the action and filter on that.

	* app/dialogs/keyboard-shortcuts-dialog.c: add a button to clear
	the filter entry. Changed the label to "Search:".


svn path=/trunk/; revision=26861
2008-09-04 14:28:00 +00:00
Michael Natterer
ffdb533ab8 add an GtkTreeModelFilter between the GtkTreeView and the actual
2008-09-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.[ch]: add an GtkTreeModelFilter
	between the GtkTreeView and the actual GtkTreeStore. Add API to
	set the filter which is simply a string that's matched with
	strstr(). Quite some things improvable here...

	* app/dialogs/keyboard-shortcuts-dialog.c: add a "Filter" entry
	and set the filter on the action view.


svn path=/trunk/; revision=26859
2008-09-04 13:46:45 +00:00
Sven Neumann
8ec1d65a4a removed trailing whitespace
svn path=/trunk/; revision=26852
2008-09-04 08:37:32 +00:00
Michael Natterer
d6f1bc5cf8 app/widgets/gimpcontrollerkeyboard.c (struct _KeyboardEvent) made the
2008-09-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerkeyboard.c (struct _KeyboardEvent)
	* app/widgets/gimpcontrollerwheel.c (struct _WheelEvent): made the
	blurbs const.


svn path=/trunk/; revision=26845
2008-09-03 20:17:57 +00:00
Michael Natterer
a1e7315643 remove the call to gdk_window_get_pointer() again.
2008-09-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpnavigationview.c
	(gimp_navigation_view_motion_notify): remove the call to
	gdk_window_get_pointer() again.

	(gimp_navigation_view_grab_pointer): instead, grab the pointer
	properly with owner_events=FALSE so all events are reported with
	respect to the widget's window.


svn path=/trunk/; revision=26844
2008-09-03 20:13:35 +00:00
Michael Natterer
017e5ef73a no need to set strlen(sting)+1 bytes on the GtkSelectionData because
2008-09-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.c: no need to set strlen(sting)+1
	bytes on the GtkSelectionData because gtk_selection_data_set()
	zero-terminates all data anyway.


svn path=/trunk/; revision=26835
2008-09-02 12:00:07 +00:00
Michael Natterer
641dbb6593 return a const string, no need to strdup it since it's only used
2008-09-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.c (gimp_selection_data_get_name):
	return a const string, no need to strdup it since it's only used
	temporarily in this file.

	(gimp_selection_data_get_image)
	(gimp_selection_data_get_component)
	(gimp_selection_data_get_item)
	(gimp_selection_data_get_object): changed accordingly. Move
	variables to local scopes and simplify.


svn path=/trunk/; revision=26834
2008-09-02 11:30:28 +00:00
Michael Natterer
d9bc8db7a3 app/widgets/gimplayertreeview.c libgimpwidgets/gimpcolorscales.c
2008-08-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	* libgimpwidgets/gimpcolorscales.c
	* libgimpwidgets/gimppropwidgets.c
	* libgimpwidgets/gimpscaleentry.c
	* libgimpwidgets/gimpwidgets.c: use gtk_adjustment_get_value()
	instead of adjustment->value.


svn path=/trunk/; revision=26815
2008-08-29 15:54:10 +00:00
Michael Natterer
a2bf2da39b #include "gimpwidgets-utils.h", not "gimpwidgets-utils.c" (eek).
2008-08-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp.c: #include "gimpwidgets-utils.h", not
	"gimpwidgets-utils.c" (eek).


svn path=/trunk/; revision=26808
2008-08-29 09:05:49 +00:00
Sven Neumann
176fb24579 allow to disable the Wilber image shown at the top of the toolbox.
2008-08-28  Sven Neumann  <sven@gimp.org>

        * app/config/gimpguiconfig.[ch]: allow to disable the Wilber 
image
        shown at the top of the toolbox.

        * app/widgets/gimptoolbox.c: honor the new gimprc option.

        * app/config/gimprc-blurbs.h: document the old and new toolbox
        preferences.


svn path=/trunk/; revision=26800
2008-08-28 14:30:47 +00:00
Michael Natterer
808ddd311b try the find_widget_under_pointer() hack only if the menu item's parent is
2008-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c (gimp_ui_manager_item_key_press):
	try the find_widget_under_pointer() hack only if the menu item's
	parent is really a GtkMenu (not a GtkMenuBar). Fixes crash spotted
	by rubikcube.


svn path=/trunk/; revision=26796
2008-08-27 19:36:41 +00:00
Martin Nordholts
b5b51b475f libgimpwidgets/gimpwidgets.c
2008-08-26  Martin Nordholts  <martinn@svn.gnome.org>

	* libgimpwidgets/gimpwidgets.c

	* plug-ins/common/file-xbm.c
	* plug-ins/common/file-wmf.c
	* plug-ins/common/file-svg.c
	* plug-ins/common/file-gih.c
	* plug-ins/common/blur-motion.c
	* plug-ins/file-jpeg/jpeg-save.c
	* plug-ins/lighting/lighting-ui.c
	* plug-ins/map-object/map-object-ui.c

	* app/tools/gimpsheartool.c
	* app/tools/gimpaligntool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimplevelstool.c
	* app/dialogs/resize-dialog.c
	* app/dialogs/offset-dialog.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpcolormapeditor.c
	* app/dialogs/layer-options-dialog.c
	* app/display/gimpdisplayshell-scale-dialog.c: Pass page_size = 0
	to gimp_spin_button_new() to adapt to new and correct value
	clamping in GTK+.

svn path=/trunk/; revision=26778
2008-08-26 19:32:14 +00:00
Martin Nordholts
513d0c9b46 Use a define for border width.
2008-08-24  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimpnavigationview.c
	(gimp_navigation_view_draw_marker): Use a define for border width.

svn path=/trunk/; revision=26738
2008-08-24 07:10:31 +00:00
Martin Nordholts
fa3b6cdb1a Don't redraw the view, only invalidate it. This causes the redraw to occur
2008-08-24  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimpnavigationview.c
	(gimp_navigation_view_set_marker): Don't redraw the view, only
	invalidate it. This causes the redraw to occur in an idle-handler
	intead of each time this function is called, which reduces flicker
	when opening new images. Stil some flicker left though...

svn path=/trunk/; revision=26737
2008-08-24 06:02:21 +00:00
Sven Neumann
ec12326ccb app/widgets/gimpnavigationview.c hardcode the colors to black and white.
2008-08-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpnavigationview.c
	* libgimpwidgets/gimpscrolledpreview.c: hardcode the colors to
	black and white. Using theme colors doesn't make sense here.


svn path=/trunk/; revision=26719
2008-08-22 21:44:52 +00:00
Sven Neumann
0b8e67f2b8 formatting
svn path=/trunk/; revision=26717
2008-08-22 21:04:28 +00:00
Sven Neumann
8c5fe3b574 indicate the viewport by shading the outside region using Cairo.
2008-08-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpnavigationview.c: indicate the viewport by
	shading the outside region using Cairo.


svn path=/trunk/; revision=26716
2008-08-22 20:58:46 +00:00
Martin Nordholts
84b0b44d49 Don't confine the cursor to the navigation view window because that
2008-08-22  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimpnavigationview.c
	(gimp_navigation_view_grab_pointer): Don't confine the cursor to
	the navigation view window because that limitation only feels in
	the way with overscroll.

svn path=/trunk/; revision=26714
2008-08-22 16:30:52 +00:00
Sven Neumann
bf89d956a4 removed the "Use GEGL" check-box from the toolbox.
2008-08-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolbox.c: removed the "Use GEGL" check-box
	from the toolbox.

	* app/config/gimpcoreconfig.c: changed the default for 
"use-gegl"
	to FALSE (in preparation of the 2.6 release).

	* app/actions/debug-commands.[ch]
	* app/actions/debug-actions.c
	* menus/image-menu.xml.in: added a "Use GEGL" check-box to the
	Debug menu. Temporary solution until a final decision is made.


svn path=/trunk/; revision=26711
2008-08-22 15:33:02 +00:00
Sven Neumann
961683cc23 app/widgets/gimpaction.c app/widgets/gimpdockable.c
2008-08-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpradioaction.c
	* app/widgets/gimpstringaction.c
	* app/widgets/gimptoggleaction.c: added basic support for icon
	names for actions and dockables. Uses the stock-id as icon name
	if the icon theme provides an icon under this name.

	* app/dialogs/dialogs.c
	* app/actions/documents-actions.c
	* app/actions/dialogs-actions.c: use the "document-open-recent"
	icon for the document history.


svn path=/trunk/; revision=26710
2008-08-22 08:57:11 +00:00
Martin Nordholts
cafc9289fc Adapted to play nicely with the overscroll feature. Basically remove
2008-08-22  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimpnavigationview.c: Adapted to play nicely with
	the overscroll feature. Basically remove limitations of the
	marker, but also draw the marker frame with an inner and outer
	border so it is possible to see on what side the viewport is when
	zoomed out and overscrolled to the max. This is further work on
	bug #362915.

svn path=/trunk/; revision=26709
2008-08-22 06:50:52 +00:00
Michael Natterer
8ea6e59970 reindent prototypes.
2008-08-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c: reindent prototypes.

	Steal find_widget_under_pointer() from gtktooltip.c

	(gimp_ui_manager_item_key_press): use the function to invoke help
	for the widget under the pointer if there is no selected menu
	item. Makes F1 work on insensitive menu items.


svn path=/trunk/; revision=26684
2008-08-20 18:20:42 +00:00
Sven Neumann
1a7bdc570d don't do the background histogram unless the histogram view is actually
2008-08-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_frozen_update): don't do the background
	histogram unless the histogram view is actually visible.


svn path=/trunk/; revision=26523
2008-08-12 19:37:09 +00:00
Sven Neumann
7ee3d7f448 app/actions/edit-commands.[ch] added new action "edit-paste-as-new-layer".
2008-08-07  Sven Neumann  <sven@gimp.org>

	* app/actions/edit-commands.[ch]
	* app/actions/edit-actions.c: added new action
	"edit-paste-as-new-layer".

	* app/widgets/gimphelp-ids.h: added new help-id.

	* menus/image-menu.xml.in: added the new action.


svn path=/trunk/; revision=26424
2008-08-07 16:25:46 +00:00
Sven Neumann
1c7a427e61 app/actions/layers-actions.c added new action "layers-new-from-visible".
2008-08-07  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: added new action
	"layers-new-from-visible".

	* app/widgets/gimphelp-ids.h: added new help-id.

	* menus/layers-menu.xml
	* menus/image-menu.xml.in: added the new action.

	* app/actions/edit-actions.c: improved the blurb for
	"edit-copy-visible".


svn path=/trunk/; revision=26421
2008-08-07 15:53:15 +00:00
Sven Neumann
3b067cba23 added gimp_image_get_projection().
2008-08-07  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: added gimp_image_get_projection().

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell-scroll.c
	* app/paint/gimppaintcore.c
	* app/paint/gimpsourcecore.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpsamplepointeditor.c
	* tools/pdbgen/pdb/image.pdb: use the new accessor function.

	* app/pdb/image-cmds.c: regenerated.


svn path=/trunk/; revision=26413
2008-08-07 09:17:46 +00:00
Sven Neumann
c45fe6b7fa added missing prototypes.
2008-07-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gtkscalebutton.c: added missing prototypes.


svn path=/trunk/; revision=26302
2008-07-24 19:02:07 +00:00
Sven Neumann
7c389ba534 don't report negative offsets, they would be interpreted wrongly.
2008-07-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c 
(gimp_session_info_get_geometry):
	don't report negative offsets, they would be interpreted 
wrongly.


svn path=/trunk/; revision=26292
2008-07-23 11:45:39 +00:00
Sven Neumann
dcbe611b8e app/widgets/gimpcontrollerinfo.c app/widgets/gimpcontrollerlist.c
2008-07-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerinfo.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimpdasheditor.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimppdbdialog.c
	* app/widgets/gimppluginaction.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimpcolorprofilecombobox.c: no need to cast the
	return value of g_value_dup_object().


svn path=/trunk/; revision=26290
2008-07-23 07:47:10 +00:00
Sven Neumann
d77ee21b8c app/core/gimpguideundo.c app/core/gimpitemundo.c
2008-07-23  Sven Neumann  <sven@gimp.org>

	* app/core/gimpguideundo.c
	* app/core/gimpitemundo.c
	* app/core/gimplayermaskundo.c
	* app/core/gimppdbprogress.c
	* app/core/gimpstrokedesc.c
	* app/core/gimptooloptions.c
	* app/core/gimptoolpresets.c
	* app/paint/gimppaintoptions.c
	* app/text/gimpfont.c
	* app/tools/gimptool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcontrollereditor.c: no need to cast the return
	value of g_value_dup_object().


svn path=/trunk/; revision=26289
2008-07-23 06:47:23 +00:00
Sven Neumann
343dbdf241 no need to cast the return value of g_value_dup_object().
2008-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcellrendererviewable.c: no need to cast the
	return value of g_value_dup_object().


svn path=/trunk/; revision=26279
2008-07-22 14:54:12 +00:00
Michael Natterer
f3ffe972eb guard against g_file_query_info() returning NULL (if the file doesn't
2008-07-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_get_icon): guard against
	g_file_query_info() returning NULL (if the file doesn't exist or
	whatever error).


svn path=/trunk/; revision=26277
2008-07-22 14:50:37 +00:00
Sven Neumann
5b374543cb plugged memory leak.
2008-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo-aux.c
	(gimp_session_info_aux_new_from_props): plugged memory leak.

2008-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogramview.c
	(gimp_histogram_view_set_background): fixed refcounting	issue.
	This plugs the memory leak I tried to fix in 
GimpHistogramEditor.


svn path=/trunk/; revision=26271
2008-07-22 10:34:21 +00:00
Sven Neumann
4368010863 added new method gimp_histogram_duplicate().
2008-07-22  Sven Neumann  <sven@gimp.org>

	* app/base/gimphistogram.[ch]: added new method
	gimp_histogram_duplicate().

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_frozen_update): instead of recalculating
	the histogram, use a duplicate for the background histogram.


svn path=/trunk/; revision=26270
2008-07-22 09:29:35 +00:00
Sven Neumann
48e6da318d reverted last change, it did not plug the leak.
2008-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c 
(gimp_histogram_editor_set_image):
	reverted last change, it did not plug the leak.


svn path=/trunk/; revision=26269
2008-07-22 08:53:40 +00:00
Sven Neumann
c610b2daad always unset and ref the histograms. Plugs a memory leak reported by
2008-07-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_set_image): always unset and ref the
	histograms. Plugs a memory leak reported by valgrind.


svn path=/trunk/; revision=26263
2008-07-21 20:27:33 +00:00
Martin Nordholts
aa27ae1bd0 Don't expose implementation details and extend the interface with trivial
2008-07-19  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimpnavigationview.[ch]: Don't expose implementation
	details and extend the interface with trivial new functions.

	* app/display/gimpnavigationeditor.c
	(gimp_navigation_editor_popup): Use the new interface instead of
	directly accessing the members of the navigation view.

svn path=/trunk/; revision=26236
2008-07-19 19:00:08 +00:00
Sven Neumann
fbbf39e138 changed cursor key event prefix from "key-" to "cursor-".
2008-07-14  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerkeyboard.c: changed cursor key event
	prefix from "key-" to "cursor-".

	* etc/controllerrc: changed accordingly. Also removed default
	bindings for cursor keys without modifiers as many tools use the
	cursor keys already.


svn path=/trunk/; revision=26188
2008-07-14 11:43:38 +00:00
Sven Neumann
f56bc8493f app/widgets/Makefile.am app/widgets/gimpdbusservice.[ch] removed here ...
2008-07-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpdbusservice.[ch]
	* app/widgets/dbus-service.xml: removed here ...

	* app/gui/Makefile.am
	* app/gui/gimpdbusservice.[ch]
	* app/gui/dbus-service.xml: ... and moved here.
	(gimp_dbus_service_activate): raise the first display instead of
	the toolbox.

	* app/gui/gui-unique.c (gui_unique_win32_idle_open): same change
	here, raise the display instead of the toolbox.

	* app/unique.c: changed accordingly.


svn path=/trunk/; revision=26184
2008-07-13 19:49:32 +00:00
Martin Nordholts
2e86bdab85 Added VOID__DOUBLE_DOUBLE_DOUBLE_DOUBLE marshaller.
2008-07-12  Martin Nordholts  <martinn@svn.gnome.org>

	* app/core/gimpmarshal.list: Added
	VOID__DOUBLE_DOUBLE_DOUBLE_DOUBLE marshaller.

	* app/widgets/gimpnavigationview.c: Make the "marker-changed"
	signal also pass the marker width and height as parameters.

	* app/display/gimpnavigationeditor.c: Updated accordingly.

svn path=/trunk/; revision=26160
2008-07-12 13:53:31 +00:00
Sven Neumann
ee6c7db882 some changes to the dialog that is shown if the help browser is missing.
2008-07-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: some changes to the dialog that is 
shown
	if the help browser is missing.


svn path=/trunk/; revision=26104
2008-07-10 10:12:34 +00:00
Sven Neumann
11a5d20892 changed button label and added an icon.
2008-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help_query_user_manual_online):
	changed button label and added an icon.


svn path=/trunk/; revision=26085
2008-07-07 18:32:53 +00:00
Sven Neumann
3594f3f572 minor string change
svn path=/trunk/; revision=26081
2008-07-07 13:54:07 +00:00
Sven Neumann
d325324f69 command button labels should be capitalized in header style.
2008-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help_query_user_manual_online):
	command button labels should be capitalized in header style.

svn path=/trunk/; revision=26080
2008-07-07 13:53:25 +00:00
Sven Neumann
b8a0f6b0e9 use GIMP_LOG() for debug output.
2008-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: use GIMP_LOG() for debug output.


svn path=/trunk/; revision=26077
2008-07-07 06:51:20 +00:00
Sven Neumann
91f0b1df46 if the user asks for help and the user manual is not locally installed,
2008-07-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: if the user asks for help and the user
	manual is not locally installed, show a dialog that allows to
	change the preferences so that the online version is used.


svn path=/trunk/; revision=26074
2008-07-06 17:47:24 +00:00
Sven Neumann
1e04306e45 always return TRUE if GIMP2_HELP_URI environment variable is set.
2008-07-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help_user_manual_is_installed):
	always return TRUE if GIMP2_HELP_URI environment variable is 
set.


svn path=/trunk/; revision=26069
2008-07-05 12:11:35 +00:00
Sven Neumann
e1e037ba61 removed debug output
svn path=/trunk/; revision=26068
2008-07-05 12:05:07 +00:00
Sven Neumann
dafeb12c57 app/dialogs/preferences-dialog.c improved test for user manual
2008-07-05  Sven Neumann  <sven@gimp.org>

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimphelp.[ch]: improved test for user manual
	installation and moved the code out of the prefs dialog.


svn path=/trunk/; revision=26067
2008-07-05 12:01:00 +00:00
Sven Neumann
d2d12997b2 minor cleanups to my last commit
svn path=/trunk/; revision=26060
2008-07-04 21:49:17 +00:00
Sven Neumann
9a253efe4a added a function to get the location where the user manual is expected if
2008-07-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.[ch]: added a function to get the 
location
	where the user manual is expected if it is installed locally.

	* app/dialogs/preferences-dialog.c: inform the user about the
	presence or absence of the user manual.


svn path=/trunk/; revision=26058
2008-07-04 18:41:58 +00:00
Sven Neumann
d462e042ea app/widgets/gimpsettingsbox.c (gimp_settings_box_constructor) removed
2008-07-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsettingsbox.c (gimp_settings_box_constructor)
	* app/widgets/gimpsettingseditor.c (gimp_settings_editor_constructor):
	removed trailing period from tooltip texts.

	* app/config/gimprc-blurbs.h: don't mark USER_MANUAL_ONLINE_BLURB
	for translation, it is not used in the user interface.

svn path=/trunk/; revision=26042
2008-07-03 10:17:19 +00:00
Michael Natterer
2bac105982 don't call gtk_adjustment_get_value() on a gint.
2008-06-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogrambox.c
	(gimp_histogram_box_high_adj_update): don't call
	gtk_adjustment_get_value() on a gint.


svn path=/trunk/; revision=26023
2008-06-30 17:36:21 +00:00
Michael Natterer
6aa62a907b app/dialogs/channel-options-dialog.c app/dialogs/palette-import-dialog.c
2008-06-29  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/channel-options-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpnavigationeditor.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpscalebutton.c: replace adjustment->value by
	gtk_adjustment_get_value (adjustment).


svn path=/trunk/; revision=26019
2008-06-29 13:41:24 +00:00
Michael Natterer
27b54c0fb6 add widget parameter so we can get the right icon theme for the screen. If
2008-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_get_icon): add widget parameter so
	we can get the right icon theme for the screen. If building
	against GTK+ >= 2.13.4, use GFile to get proper file type icons.

	(gimp_view_renderer_imagefile_render): pass the widget.

	(get_icon_fallback): remove this unused function.


svn path=/trunk/; revision=26015
2008-06-28 20:44:57 +00:00
Martin Nordholts
b8aa39d01c Remove uses of GSEAL macro to make the thing compile on systems without
2008-06-28  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gtkscalebutton.h: Remove uses of GSEAL macro to make
	the thing compile on systems without bleeding edge GTK+.

svn path=/trunk/; revision=26014
2008-06-28 19:30:45 +00:00
Michael Natterer
07197c4880 This is completely evil:
2008-06-28  Michael Natterer  <mitch@gimp.org>

	This is completely evil:

	* app/widgets/Makefile.am
	* app/widgets/gimpscalebutton.[ch]: copy GtkScaleButton from GTK+
	upstream trunk and hack around until symbol conflicts are gone
	and it builds.

	* app/widgets/gimppropwidgets.c
	* app/widgets/gtkscalebutton.[ch]: use the hacked version instead
	of the one from GTK+. Set the orientation to horizontal.


svn path=/trunk/; revision=26013
2008-06-28 19:01:25 +00:00
Michael Natterer
5e5448c16a add new function gimp_container_tree_view_connect_name_edited() which
2008-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.[ch]: add new function
	gimp_container_tree_view_connect_name_edited() which makes the
	name cell editable and connects a passed "edited" callback.

	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpsettingseditor.c
	* app/widgets/gimptemplateview.c: use it instead of having the
	same code four times.


svn path=/trunk/; revision=26009
2008-06-28 16:05:05 +00:00
Michael Natterer
f53ed53cdb app/widgets/gimpactionview.c app/widgets/gimpblobeditor.c
2008-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.c
	* app/widgets/gimpblobeditor.c
	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpcellrendererdashes.c
	* app/widgets/gimpcellrendererviewable.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpcurveview.c
	* app/widgets/gimpdasheditor.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpdockseparator.c
	* app/widgets/gimpfgbgeditor.c
	* app/widgets/gimpfgbgview.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphandlebar.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimphistogramview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimpmessagebox.c
	* app/widgets/gimppaletteview.c
	* app/widgets/gimpscalebutton.c
	* app/widgets/gimpsessioninfo-book.c
	* app/widgets/gimpsessioninfo-dock.c
	* app/widgets/gimpsettingseditor.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimptoolview.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpviewabledialog.c
	* app/widgets/gimpviewrenderervectors.c
	* app/widgets/gimpwidgets-utils.c: use accessors instead of
	accessing members of GTK+ widgets directly.


svn path=/trunk/; revision=26008
2008-06-28 15:50:27 +00:00
Michael Natterer
29754a4cff include "libgimpbase/gimpbase.h" instead of "libgimpbase/gimpenv.h".
2008-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplanguagestore-parser.c: include
	"libgimpbase/gimpbase.h" instead of "libgimpbase/gimpenv.h".


svn path=/trunk/; revision=26004
2008-06-28 13:55:24 +00:00
Michael Natterer
4329802e1c eek, include "gimpuimanager.h" not "gimpuimanager.c".
2008-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdbusservice.c: eek, include "gimpuimanager.h"
	not "gimpuimanager.c".


svn path=/trunk/; revision=26003
2008-06-28 13:32:45 +00:00
Michael Natterer
09b4adbe04 simplify the logic of setting "color" or "viewable" previews on menuitems.
2008-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): simplify the
	logic of setting "color" or "viewable" previews on menuitems.


svn path=/trunk/; revision=25999
2008-06-28 01:54:05 +00:00
Michael Natterer
e1fa7e31fe hide the popup's plus and minus buttons, they are completely pointless.
2008-06-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpscalebutton.c (gimp_scale_button_init): hide the
	popup's plus and minus buttons, they are completely pointless.


svn path=/trunk/; revision=25993
2008-06-26 15:03:09 +00:00
Michael Natterer
029849b7bd make sure the file dialog goes away when the settings box' toplevel is
2008-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsettingsbox.c: make sure the file dialog goes
	away when the settings box' toplevel is hidden. Set the
	alternative button order on the file dialog.


svn path=/trunk/; revision=25992
2008-06-25 16:41:15 +00:00
Michael Natterer
4bdf9a6d2a add marshaller BOOLEAN__STRING for the change below.
2008-06-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list: add marshaller BOOLEAN__STRING for
	the change below.

	* app/widgets/gimpsettingsbox.[ch]: add the import/export dialogs
	here. Add a bunch of parameters to new() to be used by the
	dialogs, they are not properties yet. Changed import() and
	export() signals to pass the selected filename and return a
	boolean indicating success.

	* app/tools/gimpimagemaptool-settings.c: remove the dialog code
	here and connect the import/export functions directly to above
	GimpSettingsBox signals.

	* app/tools/gimpimagemaptool.[ch]: remove file dialog member.


svn path=/trunk/; revision=25991
2008-06-25 14:25:32 +00:00
Michael Natterer
db8369e7d1 select a neighboring item after deleting the selected one.
2008-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsettingseditor.c
	(gimp_settings_editor_delete_clicked): select a neighboring item
	after deleting the selected one.


svn path=/trunk/; revision=25986
2008-06-24 23:26:42 +00:00
Michael Natterer
bda7399b73 add dummy import and export buttons, give the list a minimum size.
2008-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsettingseditor.[ch]: add dummy import and export
	buttons, give the list a minimum size.

	* app/widgets/gimpsettingsbox.c: use the correct dialog border.


svn path=/trunk/; revision=25985
2008-06-24 23:12:00 +00:00
Michael Natterer
49d4f3cb35 tweak buttons to look the same and have no spacing between them.
2008-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsettingsbox.c (gimp_settings_box_constructor):
	tweak buttons to look the same and have no spacing between them.


svn path=/trunk/; revision=25984
2008-06-24 22:37:39 +00:00
Michael Natterer
5f7733e2e5 move "Add to favorites" out of the menu into a small button showing a '+'
2008-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsettingsbox.c (gimp_settings_box_constructor):
	move "Add to favorites" out of the menu into a small button
	showing a '+' icon. Add a separator between the import/export and
	the manage menu items.


svn path=/trunk/; revision=25983
2008-06-24 22:25:51 +00:00
Michael Natterer
b80fb1ec12 enable renaming the settings objects by editing them directly in the list
2008-06-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsettingseditor.[ch]: enable renaming the
	settings objects by editing them directly in the list (renaming a
	recent setting moves it to the favorites section). Enable deleting
	settings. None of these changes is saved yet (need to trigger a
	save by confirming the tool or storing the current settings as
	favorite).


svn path=/trunk/; revision=25982
2008-06-24 21:37:10 +00:00
Michael Natterer
2d830d2321 don't dereference a NULL GError.
2008-06-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_name_edited):
	don't dereference a NULL GError.


svn path=/trunk/; revision=25981
2008-06-24 21:23:20 +00:00
Michael Natterer
60ca4baeb6 made the model column enum public and namespaced it.
2008-06-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.[ch]: made the model column
	enum public and namespaced it.

	* app/widgets/gimpsettingsbox.c: use the enum value instead of a
	magic number.

	* app/widgets/gimpsettingseditor.c: add a separator between
	recently used settings and favorites.


svn path=/trunk/; revision=25979
2008-06-24 08:42:49 +00:00
Michael Natterer
ba7d6020da app/widgets/Makefile.am app/widgets/widgets-types.h skeleton of a widget
2008-06-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsettingseditor.[ch]: skeleton of a widget to
	manage the list of saved settings for the image map tools. Does
	absolutely nothing yet apart from displaying the list of settings.

	* app/widgets/gimpsettingsbox.[ch]: add "Manage Settings" menu item
	and show a dialog containing the new widget.


svn path=/trunk/; revision=25977
2008-06-22 17:31:25 +00:00
Michael Natterer
f53e9a45db Latest GTK+ trunk deprecations showed some uglyness in gimp:
2008-06-20  Michael Natterer  <mitch@gimp.org>

	Latest GTK+ trunk deprecations showed some uglyness in gimp:

	* app/tools/gimpeditselectiontool.h: we were still using GTK_CHECK
	macros here, use proper G_TYPE type checking instead.

	* app/widgets/gimpuimanager.c
	* app/widgets/gimpdockable.c: s/GtkDestroyNotify/GDestroyNotify/.

	* plug-ins/help-browser/gimpthrobber.c: s/GtkType/GType/.

	* plug-ins/common/filter-pack.c
	* plug-ins/common/sample-colorize.c
	* plug-ins/imagemap/imap_main.c: s/GtkSignalFunc/GCallback/.


svn path=/trunk/; revision=25965
2008-06-20 11:08:42 +00:00
Michael Natterer
8912b68290 app/widgets/Makefile.am app/widgets/widgets-types.h new widget containing
2008-06-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsettingsbox.[ch]: new widget containing the
	combo and menu button for the image map tool settings plus most of
	their logic. Has "import" and "export" signals that might go away
	if I figure a way to nicely abstract that. Contains some minor
	bugfixes and cosmetic improvements compared to the old code.

	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimpimagemaptool-settings.[ch]: changed accordingly,
	mostly removal of lots of code that is now in the widget.


svn path=/trunk/; revision=25943
2008-06-13 11:56:46 +00:00
Sven Neumann
8947cb118f ooops, forgot to make the same change for the web-browser code path
svn path=/trunk/; revision=25939
2008-06-12 20:19:02 +00:00
Sven Neumann
92396c2c2d Added basic support for using the online user manual:
2008-06-12  Sven Neumann  <sven@gimp.org>

	Added basic support for using the online user manual:

	* app/widgets/gimphelp.c
	* plug-ins/help/gimphelp.c: moved some help logic to the core. 
The
	default help domain is now constructed in the core and passed to
	the help plug-ins just like the plug-in help domains.

	* app/config/Makefile.am
	* app/config/gimprc-blurbs.h
	* app/config/gimpguiconfig.[ch]: added gimprc properties to
	specify the location of the online user manual and to decide if 
it
	should be used instead of a locally installed copy.


svn path=/trunk/; revision=25938
2008-06-12 20:14:44 +00:00
Michael Natterer
a24406303a don't set a width request on the info label. It broke horizontal label
2008-06-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): don't set a
	width request on the info label. It broke horizontal label
	positioning and didn't serve any purpose I can remember.


svn path=/trunk/; revision=25911
2008-06-10 13:46:33 +00:00
Sven Neumann
769c4f925a app/core/gimp-gui.[ch] app/widgets/gimphelp.[ch] app/gui/gui-vtable.c
2008-06-10  Sven Neumann  <sven@gimp.org>

	* app/core/gimp-gui.[ch]
	* app/widgets/gimphelp.[ch]
	* app/gui/gui-vtable.c
	* app/gui/gui.c: added a GimpProgress parameter to gimp_help().

	* app/actions/help-commands.c
	* app/widgets/gimpuimanager.c
	* tools/pdbgen/pdb/help.pdb: changed accordingly.

	* app/pdb/help-cmds.c: regenerated.

svn path=/trunk/; revision=25908
2008-06-10 09:54:54 +00:00
Sven Neumann
6554c3e397 app/plug-in/gimpplugin.c app/plug-in/gimppluginmanager-call.c formatting.
2008-06-10  Sven Neumann  <sven@gimp.org>

	* app/plug-in/gimpplugin.c
	* app/plug-in/gimppluginmanager-call.c
	* app/widgets/gimphelp.c: formatting.

svn path=/trunk/; revision=25907
2008-06-10 09:16:48 +00:00
Michael Natterer
b823c752d0 app/display/gimpdisplayshell-scale.c app/gegl/gimpoperationdesaturate.h
2008-06-04  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	* app/gegl/gimpoperationdesaturate.h
	* app/tools/gimprectangletool.c
	* app/widgets/gimpradioaction.h
	* app/widgets/gimptoggleaction.h: various fixes tpo make gtk-doc
	happy.


svn path=/trunk/; revision=25893
2008-06-04 16:09:57 +00:00
Sven Neumann
1d4d2be2dd changed descriptions for GimpHistogramScale enum.
2008-06-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-enums.[ch]: changed descriptions for
	GimpHistogramScale enum.

	* app/tools/gimpimagemaptool.[ch]

	* app/tools/gimpimagemaptool-settings.c: added a GtkSizeGroup for
	aligning with the "Presets" label. Added an accessor for the
	dialog's vbox.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdesaturatetool.c
	* app/tools/gimpgegltool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: use the new accessor. Minor
	dialog cleanups in a few places.

svn path=/trunk/; revision=25884
2008-06-03 10:51:04 +00:00
Sven Neumann
2b2185a052 display a tooltip showing the value.
2008-05-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpscalebutton.c: display a tooltip showing the value.

svn path=/trunk/; revision=25827
2008-05-27 09:56:06 +00:00
Sven Neumann
15bb34de07 rotated the button graphics and fixed it for 'right-to-left' rendering.
2008-05-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpscalebutton.c (gimp_scale_button_image_expose):
	rotated the button graphics and fixed it for 'right-to-left'
	rendering.


svn path=/trunk/; revision=25825
2008-05-27 09:05:40 +00:00
Michael Natterer
020831e2a2 use GTK_ICON_SIZE_MENU for the scale button.
2008-05-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpscalebutton.c (gimp_scale_button_new): use
	GTK_ICON_SIZE_MENU for the scale button.


svn path=/trunk/; revision=25817
2008-05-26 20:00:58 +00:00
Sven Neumann
081a273f99 some more fiddling to simplify the API
svn path=/trunk/; revision=25811
2008-05-26 16:41:34 +00:00
Sven Neumann
b059874979 app/widgets/gimppropwidgets.c some fiddling to get the step and page sizes
2008-05-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpscalebutton.[ch]: some fiddling to get the step
	and page sizes right.

svn path=/trunk/; revision=25810
2008-05-26 16:14:34 +00:00
Sven Neumann
c5f309fad1 align on the pixel grid horizontally as well
svn path=/trunk/; revision=25808
2008-05-26 15:43:35 +00:00
Sven Neumann
e9768a5111 fine-tuning
svn path=/trunk/; revision=25807
2008-05-26 15:40:56 +00:00
Sven Neumann
dd256b38b0 fixed drawing routine of the new GimpScaleButton widget
svn path=/trunk/; revision=25806
2008-05-26 15:33:25 +00:00
Sven Neumann
b715b2912e fixed some bugs in the scale button support
svn path=/trunk/; revision=25805
2008-05-26 15:27:24 +00:00
Sven Neumann
c6e378f604 support for GimpScaleButton.
2008-05-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: support for GimpScaleButton.

svn path=/trunk/; revision=25804
2008-05-26 15:18:31 +00:00
Sven Neumann
5abe098abe app/widgets/Makefile.am app/widgets/widgets-types.h added simple scale
2008-05-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpscalebutton.[ch]: added simple scale button widget
	derived from GtkScaleButton.

svn path=/trunk/; revision=25803
2008-05-26 15:01:36 +00:00
Martin Nordholts
d228bf7398 Kill the Polygon Select Tool. The Free Select Tool now provides a superset
2008-05-24  Martin Nordholts  <martinn@svn.gnome.org>

	Kill the Polygon Select Tool. The Free Select Tool now provides a
	superset of the old Polygon Select Tool functionality. We still
	keep the tool icons etc around though, they might come in useful
	in the future.

	* app/tools/gimppolygonselecttool.[ch]: Removed.

	* app/tools/Makefile.am: Removed gimppolygonselecttool.[ch].

	* app/tools/gimp-tools.c (gimp_tools_init): Don't register the
	Polygon Select Tool.

	* app/widgets/gimphelp-ids.h: Remove
	GIMP_HELP_TOOL_POLYGON_SELECT.

svn path=/trunk/; revision=25783
2008-05-24 07:21:55 +00:00
Michael Natterer
598da617b0 Stop including single headers from gtk+ to be prepared for the upcoming
2008-05-23  Michael Natterer  <mitch@gimp.org>

	Stop including single headers from gtk+ to be prepared
	for the upcoming GTK_DISABLE_SINGLE_INCLUDES:

	* configure.in: add -DGTK_DISABLE_SINGLE_INCLUDES to CPPFLAGS.

	* app/display/gimpcanvas.h
	* app/display/gimpscalecombobox.h
	* app/display/gimpstatusbar.h
	* app/widgets/*.h
	* libgimp/gimpprogressbar.h
	* libgimp/gimpselectbutton.h
	* libgimpwidgets/*.h
	* libgimpwidgets/gimpstock.c
	* plug-ins/uri/gimpmountoperation.h: remove inclusion of parent
	classes and single files from gtk+.

	* app/widgets/gtkwrapbox.h
	* libgimp/gimpbrushmenu.c
	* libgimp/gimpfontmenu.c
	* libgimp/gimpgradientmenu.c
	* libgimp/gimppalettemenu.c
	* libgimp/gimppatternmenu.c
	* libgimp/gimpselectbutton.c: #include <gtk/gtk.h>

	* plug-ins/common/poppler.c: undef GTK_DISABLE_SINGLE_INCLUDES
	when including <poppler.h>.


svn path=/trunk/; revision=25781
2008-05-23 20:38:52 +00:00
Sven Neumann
e86e003224 Add Desaturate as an image-map tool with live preview (bug #533808):
2008-05-21  Sven Neumann  <sven@gimp.org>

	Add Desaturate as an image-map tool with live preview (bug #533808):

	* app/gegl/Makefile.am
	* app/gegl/gegl-types.h
	* app/gegl/gimpdesaturateconfig.[ch]: added config object for the
	desaturate point filter.
	
	* app/gegl/gimpoperationdesaturate.[ch]: derive from
	GimpOperationPointFilter. Unrolled the inner loop.

	* app/core/gimpdrawable-desaturate.c: changed accordingly.

	* app/tools/Makefile.am
	* app/tools/gimpdesaturatetool.[ch]: added desaturate as an
	imagemap tool. So far only the GEGL code path is implemented.

	* app/tools/gimp-tools.c: register the new tool.

	* app/dialogs/dialogs.c: register the new tool dialog.

	* app/dialogs/Makefile.am
	* app/dialogs/desaturate-dialog.[ch]: removed the desaturate dialog.

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.[ch]: removed action
	"drawable-desaturate".

	* app/widgets/gimphelp-ids.h: changed help IDs accordingly.

	* menus/image-menu.xml.in: replaced "drawable-desaturate" with
	"tools-desaturate".

	* libgimpwidgets/gimpstock.h: added a define for
	GIMP_STOCK_TOOL_DESATURATE.

svn path=/trunk/; revision=25726
2008-05-21 13:11:06 +00:00
Sven Neumann
9a63a43566 app/widgets/Makefile.am app/widgets/gimptoggleaction.[ch] added new action
2008-05-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimptoggleaction.[ch]
	* app/widgets/gimpradioaction.[ch]: added new action types derived
	from GtkToggleAction and GtkRadioAction. These types override the
	"connect_proxy" method to enable tooltips in menus.

	* app/widgets/gimpactiongroup.c: use the new action types.

	* app/actions/dockable-actions.c: added a tooltip for the
	"dockable-lock-tab" action.

svn path=/trunk/; revision=25717
2008-05-20 09:51:04 +00:00
Sven Neumann
33b5a890cc app/widgets/gimpdockable.[ch] added a "locked" propery to GimpDockable. A
2008-05-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.[ch]
	* app/widgets/gimpdockbook.[ch]: added a "locked" propery to
	GimpDockable. A locked dockable cannot be moved by drag-n-drop.
	Allows users to protect their dockables from accidental changes,
	mainly when working with a tablet.

	* app/widgets/gimpsessioninfo-dockable.[ch]: store the "locked"
	property in the session info.

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]: added an action for 
toggling
	the "locked" state.

	* app/widgets/gimphelp-ids.h: new help-id "gimp-dock-tab-lock".

	* menus/dockable-menu.xml.in: show the new menu item.

	* app/actions/plug-in-actions.c: formatting.


svn path=/trunk/; revision=25715
2008-05-19 21:11:03 +00:00
Michael Natterer
9670b467e2 renamed public function set_dash_pattern() to take_dash_pattern() to
2008-05-18  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpstrokeoptions.[ch]: renamed public function
	set_dash_pattern() to take_dash_pattern() to clarify memory
	management of the passed GArray.

	* app/widgets/gimpdasheditor.c
	* app/widgets/gimpstrokeeditor.c: changed accordingly.


svn path=/trunk/; revision=25700
2008-05-18 15:15:07 +00:00
Michael Natterer
2a38f864f2 add new function gimp_stock_button_new() which creates a button with icon
2008-05-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-constructors.[ch]: add new function
	gimp_stock_button_new() which creates a button with icon and label
	which is *not* the stock_id's label.

	* app/dialogs/preferences-dialog.c (prefs_button_add)
	* app/tools/gimplevelstool.c (gimp_levels_tool_dialog): use it.


svn path=/trunk/; revision=25688
2008-05-17 14:29:25 +00:00
Michael Natterer
a3bde5d64c add help IDs for the stuff in the Windows menu.
2008-05-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: add help IDs for the stuff in the
	Windows menu.

	* app/actions/windows-actions.c: use them.


svn path=/trunk/; revision=25687
2008-05-17 14:08:19 +00:00
Michael Natterer
fe395446aa add tooltips to the menu items of open and recently closed docks.
2008-05-17  Michael Natterer  <mitch@gimp.org>

	* app/actions/windows-actions.c: add tooltips to the menu items of
	open and recently closed docks.

	* app/widgets/gimpaction.c: connect to "notify::tooltip" and make
	sure gimp_help_set_help_data() gets called when the action's
	tooltip changes.


svn path=/trunk/; revision=25684
2008-05-17 12:53:07 +00:00
Michael Natterer
ff5310a4ea Implement the presistent menu of recently closed docks, still somewhat
2008-05-16  Michael Natterer  <mitch@gimp.org>

	Implement the presistent menu of recently closed docks, still
	somewhat hackish but fully functional. Fixes bug #132744.

	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.[ch]
	* menus/image-menu.xml.in: remove the menu items that were
	creating the hardcoded preconfigured docks.

	* app/dialogs/dialogs.[ch]: add GimpContainer of recently closed
	docks and API to load and save it.

	* app/gui/session.c: call the recent dock load and save functions.

	* app/widgets/gimpsessioninfo.[ch]: implement the GimpConfig interface
	and (de)serialize via proper interface methods.

	* app/gui/session.c
	* app/widgets/gimpdialogfactory.c: use the GimpConfig API
	to (de)serialize session infos and added the code that was
	formerly in the info's (de)serialize functions but didn't belong
	there.

	* app/widgets/gimpaction.[ch]: add "max-width-chars" property and
	set it on proxy menu item labels.

	* app/actions/windows-actions.[ch]
	* app/actions/windows-commands.[ch]
	* app/menus/windows-menu.c: add actions and menu of recently
	closed docks and code to restore the dock when the menu items are
	selected. Use above new action property to ensure a minimum
	width of the menu.

	* app/widgets/gimpmenudock.c: use '-' instead of '|' for
	separating notebooks in the window title. Menu items don't like	'|'.

	* app/widgets/gimpdock.c: removed the confirmation dialog when
	closing docks and simply add them to the recent docks container.
	This code is totally misplaced and will move to another file soon.


svn path=/trunk/; revision=25671
2008-05-16 16:06:42 +00:00
Sven Neumann
c1c17203a4 fixed use of uninitialized value.
2008-05-14  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_motion_notify):
	fixed use of uninitialized value.

svn path=/trunk/; revision=25668
2008-05-14 15:38:43 +00:00
Michael Natterer
9ca46cca70 remove widget member from struct GimpSessionInfoBook. Return the created
2008-05-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo-book.[ch]: remove widget member from
	struct GimpSessionInfoBook. Return the created GimpDockbook from
	restore().

	* app/widgets/gimpsessioninfo-dock.c (restore): use the returned
	book instead of the struct member.


svn path=/trunk/; revision=25658
2008-05-14 00:00:41 +00:00
Michael Natterer
5766498fff Made session info serialization independent from widgets so it can be used
2008-05-14  Michael Natterer  <mitch@gimp.org>

	Made session info serialization independent from widgets so it can
	be used on stored dock layouts which are not open:

	* app/widgets/gimpsessioninfo-book.[ch]
	* app/widgets/gimpsessioninfo-dock.[ch]
	* app/widgets/gimpsessioninfo-dockable.[ch]: add from_widget()
	functions which return newly allocated session info structs.
	Changed serialize() functions to take these structs instead of
	widgets. Changed deserialize() functions to return the structs
	instead of appending them to lists in their parent structs. Don't
	free anything in restore().

	* app/widgets/gimpsessioninfo-aux.[ch]
	(gimp_session_info_aux_serialize): take a GList of aux_info
	instead of a widget.

	* app/widgets/gimpsessioninfo.[ch]: add new functions get_info()
	which collects above session info details from dialogs and
	clear_info() which clears that info. Call clear_info() from
	finalize(). Don't free anything in restore().

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factories_save_foreach): collect the session info
	detials from the dialogs before serializing because serialize()
	doesn't know about the widget any longer. Clear the infos after
	serializing.

	(gimp_dialog_factories_restore_foreach): clear the session info
	details after creating the dialogs because restore() doesn't clear
	the info by itself any longer.


svn path=/trunk/; revision=25657
2008-05-13 23:43:57 +00:00
Michael Natterer
24a7aa75bd turn "info != NULL" checks into "GIMP_IS_SESSION_INFO (info)".
2008-05-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.c: turn "info != NULL" checks into
	"GIMP_IS_SESSION_INFO (info)".


svn path=/trunk/; revision=25656
2008-05-13 21:29:00 +00:00
Michael Natterer
0b0d0aad78 turn into a GimpObject subclass. No logical changes yet.
2008-05-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]: turn into a GimpObject
	subclass. No logical changes yet.

	* app/widgets/widgets-types.h
	* app/widgets/gimpdialogfactory.c: changed accordingly.


svn path=/trunk/; revision=25655
2008-05-13 21:17:11 +00:00
Simon Budig
80039486aa app/vectors/gimpvectors.[ch] app/vectors/gimpstroke.[ch] Implement
2008-05-12  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpvectors.[ch]
	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpbezierstroke.c: Implement functionality to
	get a bezier description a la moveto/curveto/closepath.

	* app/vectors/vectors-types.h: implement an evil hack to avoid
	the inclusion of cairo.h in most C files...

	* app/vectors/Makefile.am: link against cairo

	* app/widgets/gimpviewrenderervectors.c: use the new functionality
	for preview rendering.


svn path=/trunk/; revision=25645
2008-05-12 21:47:07 +00:00
Sven Neumann
6e6a0355aa app/core/Makefile.am
2008-05-11  Sven Neumann  <sven@gimp.org>

	* app/core/Makefile.am
	* app/core/gimpcurve.[ch]:
	* app/core/gimpcurve-map.[ch]: split curve map functions into
	seperate files.

	* app/gegl/gimpoperationcurves.c
	* app/tools/gimpcurvestool.c
	* app/widgets/gimpcurveview.c: changed accordingly.

	* app/Makefile.am (AM_LDFLAGS): make it link.


svn path=/trunk/; revision=25642
2008-05-11 14:56:57 +00:00
Sven Neumann
a392a231d3 renamed gimp_curve_map() to gimp_curve_map_value(). Added new function
2008-05-11  Sven Neumann  <sven@gimp.org>

	* app/core/gimpcurve.[ch]: renamed gimp_curve_map() to
	gimp_curve_map_value(). Added new function 
gimp_curve_map_pixels()
	which will allow for better optimization.

	* app/gegl/gimpoperationcurves.c 
(gimp_operation_curves_process):
	use gimp_curve_map_pixels().

	* app/tools/gimpcurvestool.c
	* app/widgets/gimpcurveview.c: follow API change.


svn path=/trunk/; revision=25641
2008-05-11 14:48:22 +00:00
Michael Natterer
1e50d79b17 add an "ellipsize" property that is applied to all proxy menu items'
2008-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpaction.[ch]: add an "ellipsize" property that is
	applied to all proxy menu items' labels.

	* app/actions/windows-actions.c: set the dock actions to
	PANGO_ELLIPSIZE_END because their labels can be insanely long.


svn path=/trunk/; revision=25635
2008-05-11 09:26:17 +00:00
Michael Natterer
a0e6800c0d small cleanup.
2008-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): small cleanup.


svn path=/trunk/; revision=25634
2008-05-11 08:55:13 +00:00
Michael Natterer
fb904ad1cb add signals "dock-added" and "dock-removed".
2008-05-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: add signals "dock-added" and
	"dock-removed".

	(gimp_dialog_factory_add_dialog)
	(gimp_dialog_factory_remove_dialog): emit them when docks get
	added and removed.


svn path=/trunk/; revision=25629
2008-05-10 19:11:18 +00:00
Michael Natterer
4717f727df fix parameter name.
2008-05-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.h: fix parameter name.


svn path=/trunk/; revision=25625
2008-05-10 18:37:46 +00:00
Sven Neumann
6859c9f642 reset the translation on the cairo context. Resurrects brush emblems which
2008-05-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_real_draw):
	reset the translation on the cairo context. Resurrects brush
	emblems which were drawn in the wrong position.

	* app/widgets/gimpviewrendererbrush.c 
(gimp_view_renderer_brush_draw):
	formatting.


svn path=/trunk/; revision=25614
2008-05-10 11:58:25 +00:00
Sven Neumann
7a8abc28b3 move the focus to the canvas on button-press events.
2008-05-08  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_events): move the focus to the canvas on
	button-press events.

	* app/widgets/gimpwindow.c (gimp_window_key_press_event): 
removed
	a use of G_UNLIKELY() that is somewhat bogus here.


svn path=/trunk/; revision=25587
2008-05-08 12:34:27 +00:00
Sven Neumann
62fdd17b23 added infrastructure to access and set some state information of the
2008-05-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: added infrastructure to 
access
	and set some state information of the GtkFileChooser.

	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-save-dialog.c: don't keep the file-chooser
	dialogs around. Instead keep the state attached to the Gimp 
object
	(one state for load, one for save dialogs). Closes bug #528811.


svn path=/trunk/; revision=25586
2008-05-08 11:30:54 +00:00
Sven Neumann
7bacfae912 app/widgets/widgets-types.h formatting.
2008-05-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-types.h 
	* app/widgets/gimpfiledialog.c: formatting.


svn path=/trunk/; revision=25585
2008-05-08 10:44:05 +00:00
Sven Neumann
a780a37830 formatting.
2008-04-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwindow.c (gimp_window_key_press_event): 
formatting.


svn path=/trunk/; revision=25548
2008-04-29 08:47:52 +00:00
Sven Neumann
f23d046965 app/widgets/Makefile.am app/widgets/widgets-types.h added GimpWindow class
2008-04-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpwindow.[ch]: added GimpWindow class and moved
	key-press-event handler from GimpDock to this class.

	* app/widgets/gimpdock.[ch]:
	* app/display/gimpdisplayshell.[ch]: derive from GimpWindow.


svn path=/trunk/; revision=25541
2008-04-28 16:30:55 +00:00
Michael Natterer
561ec036b5 app/widgets/gimpdock.c minor cosmetics.
2008-04-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdock.c
	* libgimpwidgets/gimpcellrenderertoggle.c: minor cosmetics.


svn path=/trunk/; revision=25522
2008-04-25 08:53:11 +00:00
Sven Neumann
97861975b1 do not any longer accept middle-mouse-button paste on the toolbox buttons
2008-04-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolbox.c: do not any longer accept
	middle-mouse-button paste on the toolbox buttons but use the
	toolbox drop area for that.


svn path=/trunk/; revision=25521
2008-04-25 07:05:48 +00:00
Sven Neumann
d8ad4cfa7c added "label-scale" style property.
2008-04-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpunitcombobox.c: added "label-scale" style 
property.

	* app/display/gimpscalecombobox.[ch]: ditto. Also removed the
	support for extra action items.

	* app/display/gimpstatusbar.c: changed accordingly.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: use a smaller font for the combo-box 
labels
	in the statusbar.


svn path=/trunk/; revision=25475
2008-04-13 17:01:19 +00:00
Martin Nordholts
a8bbf6b29b Applied modified patch from Daniel Hornung that changes the mouse cursor
2008-04-12  Martin Nordholts  <martinn@svn.gnome.org>

	Applied modified patch from Daniel Hornung that changes the mouse
	cursor to a "clicking will create a selection"-icon when hovering
	the center of a pending Scissors Select Tool selection (bug #493370)

	* app/tools/gimpiscissorstool.c
	(gimp_iscissors_tool_cursor_update): Use the new cursor icon.

	* cursors/modifier-select.png
	* cursors/xbm/modifier-select.xbm
	* cursors/xbm/modifier-select-mask.xbm: New cursor icon.

	* cursors/makefile.msc
	* cursors/Makefile.am 
	* app/widgets/gimpcursor.c
	* app/widgets/widgets-enums.h: Changed accordingly.

svn path=/trunk/; revision=25473
2008-04-12 11:40:52 +00:00
Michael Natterer
ff492c52a3 implement GimpDocked::set_context() and set the GimpViewRenderers'
2008-04-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.c: implement
	GimpDocked::set_context() and set the GimpViewRenderers'
	contexts. Unclear how this could have been missed since it
	warned badly about NULL contexts.


svn path=/trunk/; revision=25460
2008-04-10 12:54:35 +00:00
Sven Neumann
08a4422c1a disabled the language entry until it works.
2008-04-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptexteditor.c (gimp_text_editor_new): disabled
	the language entry until it works.

svn path=/trunk/; revision=25432
2008-04-09 14:16:45 +00:00
Sven Neumann
3f2385dcc2 added new methods gimp_container_get_{first,last}_child().
2008-04-09  Sven Neumann  <sven@gimp.org>

	* app/core/gimpcontainer.[ch]: added new methods
	gimp_container_get_{first,last}_child().

	* app/actions/file-actions.c (file_actions_close_all_update)
	* app/dialogs/layer-add-mask-dialog.c (layer_add_mask_dialog_new)
	* app/dialogs/palette-import-dialog.c (palette_import_image_callback)
	* app/gui/gui-vtable.c (gui_get_empty_display): 
	* app/widgets/gimpmenudock.c (gimp_menu_dock_image_changed): use
	the new GimpContainer methods.

	* app/core/gimpundostack.c: use the new GimpContainer methods and
	cleaned up the code.

svn path=/trunk/; revision=25426
2008-04-09 09:50:29 +00:00
Michael Natterer
231497046d set GDK_HINT_MIN_SIZE on dialogs which had no previous sessionrc entry.
2008-04-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factory_set_user_pos): set GDK_HINT_MIN_SIZE on
	dialogs which had no previous sessionrc entry. Fixes the minimum
	size of the very first empty display of a new GIMP installation
	and shouldn't have any ill effects on other windows.


svn path=/trunk/; revision=25409
2008-04-08 08:26:48 +00:00
Sven Neumann
1ea02d38b3 removed unused include
svn path=/trunk/; revision=25372
2008-04-05 16:57:57 +00:00
Sven Neumann
af8f8ed645 corrected fix for bug #511926.
2008-04-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.c (gimp_colormap_editor_draw):
	corrected fix for bug #511926.


svn path=/trunk/; revision=25371
2008-04-05 16:15:18 +00:00
Michael Natterer
a346d25c40 Add missing code for the "spacing" property. Spotted by Jerry Baker.
2008-03-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbrusheditor.c (gimp_brush_editor_notify_brush):
	Add missing code for the "spacing" property. Spotted by Jerry Baker.


svn path=/trunk/; revision=25323
2008-03-31 14:17:14 +00:00
Martin Nordholts
16f4a5d5e0 Make all code paths result in a call to gtk_drag_finish() if we return
2008-03-30  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimpcontainertreeview-dnd.c
	(gimp_container_tree_view_drag_drop): Make all code paths result
	in a call to gtk_drag_finish() if we return TRUE. Fixes bug
	#317992.

svn path=/trunk/; revision=25320
2008-03-30 18:26:44 +00:00
Sven Neumann
b131f8011c added a finalizer that frees the memory allocated for the cell lists.
2008-03-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c: added a finalizer that 
frees
	the memory allocated for the cell lists.


svn path=/trunk/; revision=25316
2008-03-30 17:20:36 +00:00
Michael Natterer
8088b64c72 app/display/gimpcanvas.c app/widgets/gimpcoloreditor.c
2008-03-30  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpcanvas.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpcurveview.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdockseparator.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimpsamplepointeditor.c
	* app/widgets/gimptoolbox.c: chain up unconditionally in
	GtkWidget::style_set() because there is has a default
	implementation.


svn path=/trunk/; revision=25307
2008-03-29 23:43:39 +00:00
Michael Natterer
e21528d4f3 when the "Auto" button gets enabled, always copy both display and image to
2008-03-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpmenudock.c (gimp_menu_dock_auto_clicked): when
	the "Auto" button gets enabled, always copy both display and image
	to the local context (because there can be displays without image
	now).


svn path=/trunk/; revision=25306
2008-03-29 22:29:55 +00:00
Sven Neumann
fc93cc19ce deprecate gimp_memsize_to_string() in favor of
2008-03-28  Sven Neumann  <sven@gimp.org>

	* libgimpbase/gimpmemsize.[ch]: deprecate gimp_memsize_to_string()
	in favor of g_format_size_for_display().

	* app/actions/edit-commands.c
	* app/core/gimpimagefile.c
	* app/dialogs/image-new-dialog.c
	* app/dialogs/image-scale-dialog.c
	* app/display/gimpdisplayshell-title.c
	* app/widgets/gimpimagepropview.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimpthumbbox.c
	* plug-ins/uri/uri-backend-gnomevfs.c
	* plug-ins/uri/uri-backend-gvfs.c
	* plug-ins/uri/uri-backend-libcurl.c
	* plug-ins/uri/uri-backend-wget.c: use g_format_size_for_display()
	instead of gimp_memsize_to_string().

svn path=/trunk/; revision=25285
2008-03-28 16:33:24 +00:00
Sven Neumann
cca470e093 open the new dock window at the mouse pointer position.
2008-03-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_detach): open the new
	dock window at the mouse pointer position.

svn path=/trunk/; revision=25262
2008-03-27 12:35:56 +00:00
Michael Natterer
ed7268c043 make the wilber area a bit smaller.
2008-03-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c: make the wilber area a bit smaller.


svn path=/trunk/; revision=25251
2008-03-26 21:04:20 +00:00
Michael Natterer
e842dbe625 store the toolbox area's vbox in the widget struct.
2008-03-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.[ch]: store the toolbox area's vbox in
	the widget struct.

	* app/widgets/gimptoolbox-dnd.c (gimp_toolbox_dnd_init): use it as
	DND target instead of the wbox with the tool buttons.


svn path=/trunk/; revision=25250
2008-03-26 20:47:45 +00:00
Michael Natterer
e00d4e423f big wilber is watching you from the toolbox! Removed forgotten menubar
2008-03-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.[ch]: big wilber is watching you from
	the toolbox! Removed forgotten menubar cruft.


svn path=/trunk/; revision=25249
2008-03-26 20:27:44 +00:00
Sven Neumann
86cf30dd1d hide ugly details behind a sane API.
2008-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcairo-wilber.[ch]: 
	* app/display/gimpcanvas.c (gimp_canvas_draw_drop_zone): hide 
ugly
	details behind a sane API.


svn path=/trunk/; revision=25248
2008-03-26 19:25:55 +00:00
Sven Neumann
3f2120ed09 include a better Wilber path, thanks to Jimmac.
2008-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcairo-wilber.c: include a better Wilber path,
	thanks to Jimmac.

	* app/display/gimpcanvas.c (gimp_canvas_draw_drop_zone): undid
	scaling "fix", instead take the offset into account. Draw with
	transparency.

svn path=/trunk/; revision=25246
2008-03-26 17:25:00 +00:00
Sven Neumann
93dcbb1904 app/widgets/Makefile.am new files that renders a Wilber image as a Cairo
2008-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-wilber.[ch]: new files that renders a
	Wilber image as a Cairo path. Or at least it is supposed to do
	this at some point...

	* app/display/gimpcanvas.c (gimp_canvas_draw_drop_zone): use the
	scalable Wilber path. Needs more work...

svn path=/trunk/; revision=25244
2008-03-26 15:59:52 +00:00
Sven Neumann
809f4fe608 focus the image window after all docks have been created.
2008-03-25  Sven Neumann  <sven@gimp.org>

	* app/gui/gui.c (gui_restore_after_callback): focus the image
	window after all docks have been created.

	* app/widgets/gimpdock.c (gimp_dock_init): unset focus-on-map on
	all dock windows.

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factories_show_foreach): removed the focus hacks here
	as they are not any longer needed.

svn path=/trunk/; revision=25216
2008-03-25 10:00:33 +00:00
Sven Neumann
244b50a357 app/widgets/gimplanguagestore.[ch] code cleanup.
2008-03-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplanguagestore.[ch]
	* app/widgets/gimplanguageentry.[ch]: code cleanup.


svn path=/trunk/; revision=25211
2008-03-24 22:31:08 +00:00
Sven Neumann
3adca61a80 don't reset the mime-type info when we can't load a thumbnail.
2008-03-24  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumbnail.c: don't reset the mime-type info
	when we can't load a thumbnail.

	* app/core/gimpimagefile.c (gimp_imagefile_get_new_pixbuf): 
don't
	set a stock-id depending on the state.

	* app/widgets/gimpviewrendererimagefile.[ch]: removed commented
	out hack that used to access semi-private API from 
GtkFilesystem.
	Instead lifted some code from GtkRecentManager that looks up 
icons
	by mime-type.


svn path=/trunk/; revision=25195
2008-03-24 16:41:42 +00:00
Michael Natterer
391d78fe30 don't set the dialog's window geometry if it is already visible. Fixes
2008-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c (gimp_dialog_factory_add_dialog):
	don't set the dialog's window geometry if it is already visible.
	Fixes empty display moving and shouldn't affect anything else
	since we always want to position dialogs before they are shown.


svn path=/trunk/; revision=25184
2008-03-23 18:36:16 +00:00
Michael Natterer
f9f24c59f0 cleanup (move variables to local scopes), improve debugging outout.
2008-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c: cleanup (move variables to
	local scopes), improve debugging outout.

	(gimp_dialog_factory_remove_dialog): disconnect signal handlers
	and unset any session management data which is attached to the
	widget, so this function can really be used to remove a dialog
	from the factory.


svn path=/trunk/; revision=25176
2008-03-23 13:33:19 +00:00
Michael Natterer
f720839757 use gdk_drawable_get_size() instead of looking at widget->allocation since
2008-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.c (gimp_session_info_get_geometry):
	use gdk_drawable_get_size() instead of looking at
	widget->allocation since the latter is not yet updated if this
	function is called from the dialog factory's "configure-event"
	callback. Fixes remembering of dialog sizes within one session.


svn path=/trunk/; revision=25175
2008-03-23 13:30:03 +00:00
Sven Neumann
f8d1aba0e4 removed leftover debug output
svn path=/trunk/; revision=25170
2008-03-22 01:22:31 +00:00
Sven Neumann
39377e970e themes/Default/gtkrc reduced minimum dock width to 200 pixels.
2008-03-22  Sven Neumann  <sven@gimp.org>

	* themes/Default/gtkrc
	* app/widgets/gimpmenudock.c: reduced minimum dock width to 200
	pixels.

	* etc/sessionrc: use -0 instead of -1, just like in X geometry
	strings. Changed default dock sizes to be taller but less wide.

	* app/widgets/gimpsessioninfo.c: changed code to parse -0 from 
the
	sessionrc file and to deal more correctly with negative offsets.


svn path=/trunk/; revision=25169
2008-03-22 01:10:51 +00:00
Sven Neumann
17b27bc768 simplified the logic of gimp_session_info_set_geometry()
svn path=/trunk/; revision=25168
2008-03-21 23:54:46 +00:00
Sven Neumann
985015ca06 deal with negative positions read from the sessionrc file and interpret
2008-03-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c 
(gimp_session_info_set_geometry):
	deal with negative positions read from the sessionrc file and
	interpret them as a hint to align the window with the right,
	respective bottom edge of the screen.

	* etc/sessionrc: position the toolbox in the upper left, the
	additional dock in the upper right corner of the screen.


svn path=/trunk/; revision=25167
2008-03-21 23:43:21 +00:00
Michael Natterer
f63a7153ef Remove the toolbox menu:
2008-03-21  Michael Natterer  <mitch@gimp.org>

	Remove the toolbox menu:

	* configure.in: remove --enable-toolbox-menu option.

	* menus/Makefile.am
	* menus/toolbox-menu.xml.in: removed.

	* menus/image-menu.xml.in: add the debug menu here.

	* menus/menus.xsl: remove transformations depending on whether
	there is a toolbox menu or not.

	* app/menus/Makefile.am
	* app/menus/toolbox-menu.[ch]: removed.

	* app/menus/menus.c: remove the toolbox menu but keep the
	<Toolbox> UI manager around so we can configure its actions
	separate from normal docks.

	* app/actions/image-actions.c (image_actions): remove the action
	for the toolbox menubar.

	* app/widgets/gimptoolbox.c: remove all menu code.

	* app/plug-in/plug-in-menu-path.c: map plug-in registered toolbox
	menu items to their new location in the image menu
	unconditionally.

	* plug-ins/common/screenshot.c
	* plug-ins/common/uniteditor.c
	* plug-ins/script-fu/script-fu.c
	* plug-ins/script-fu/scripts/web-browser.scm
	* plug-ins/twain/twain.c
	* plug-ins/winsnap/winsnap.c: remove menu registrations under
	<Toolbox>/File and change <Toolbox>/Help to <Image>/Help. Leave
	<Toolbox>/Xtns untouched until its final location and name are
	decided.


svn path=/trunk/; revision=25156
2008-03-21 17:55:32 +00:00
Michael Natterer
d7c9c3c96c added member "ID" for themeing.
2008-03-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdock.h (struct GimpDock): added member "ID"
	for themeing.

	* app/widgets/gimpdock.c (gimp_dock_init): assign unique IDs
	and set unique widget names based on the ID.

	(gimp_dock_style_set): set individual styles for each dock based
	on the widget name so docks on different screens get the correct
	font size. Use PANGO_SCALE_SMALL instead of a hardcoded factor of
	0.8.


svn path=/trunk/; revision=25152
2008-03-21 13:34:09 +00:00
Michael Natterer
98eb3d2a2c some experimental and pretty evil code which reduces the font size in
2008-03-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdock.c (gimp_dock_style_set): some experimental
	and pretty evil code which reduces the font size in docks by 20%.


svn path=/trunk/; revision=25150
2008-03-21 12:15:32 +00:00
Sven Neumann
13e3e81e8c changed default values for "toolbox-window-hint" and "dock-window-hint" to
2008-03-20  Sven Neumann  <sven@gimp.org>

	* app/config/gimpguiconfig.c: changed default values for
	"toolbox-window-hint" and "dock-window-hint" to "utility".

	* app/widgets/gimptoolbox.c (gimp_toolbox_new): changed window
	title to "Toolbox".

svn path=/trunk/; revision=25142
2008-03-20 14:44:44 +00:00
Sven Neumann
a355f1777b app/widgets/gimpdockable.c moved utility function for setting attributes
2008-03-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c
	* app/widgets/gimpwidgets-utils.[ch]: moved utility function for
	setting attributes on a PangoLayout out of gimpdockable.c.

	* app/display/gimpcanvas.c (gimp_canvas_draw_drop_zone): use a
	bold font and paint the layout with transparency.

svn path=/trunk/; revision=25116
2008-03-19 09:29:30 +00:00
Michael Natterer
bc9424a2b5 app/actions/data-commands.c app/actions/debug-commands.c
2008-03-12  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c
	* app/actions/debug-commands.c
	* app/actions/dockable-commands.c
	* app/dialogs/stroke-dialog.c
	* app/display/gimpdisplayshell-handlers.c
	* app/gui/gui-message.c
	* app/gui/gui.c
	* app/tools/gimpforegroundselectoptions.c
	* app/tools/gimpinkoptions-gui.c
	* app/widgets/gimpcolordialog.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpcontainerview-utils.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpsessioninfo-book.c
	* app/widgets/gimpsessioninfo-dock.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpunitcombobox.c
	* app/widgets/gimpviewablebox.c
	* libgimp/gimpexport.c
	* libgimpmodule/gimpmodule.h
	* libgimpwidgets/gimpenumwidgets.c
	* libgimpwidgets/gimpframe.c
	* libgimpwidgets/gimpoldwidgets.c
	* libgimpwidgets/gimpwidgets.c
	* plug-ins/MapObject/mapobject_ui.c
	* plug-ins/common/papertile.c
	* plug-ins/common/sinus.c
	* plug-ins/flame/flame.c
	* plug-ins/helpbrowser/gimpthrobber.c
	* plug-ins/script-fu/scheme-wrapper.c
	* plug-ins/script-fu/script-fu-console.c: use accessors instead of
	accessing GtkBin.child and GtkPaned.child1,2 directly.


svn path=/trunk/; revision=25095
2008-03-12 16:58:28 +00:00
Sven Neumann
c317f937e1 app/widgets/gimpdockable.[ch] moved code for the drag widget to
2008-03-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.[ch]
	* app/widgets/gimpdockbook.c: moved code for the drag widget to
	GimpDockable. Use semi-bold text for the drag widget also.

svn path=/trunk/; revision=25082
2008-03-10 16:01:48 +00:00
Michael Natterer
32a1de9167 app/tools/Makefile.am app/tools/gimpiscissorsoptions.[ch] new options
2008-03-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpiscissorsoptions.[ch]
	* app/tools/gimpregionselectoptions.[ch]: new options classes.

	* app/tools/gimpselectionoptions.[ch]: remove the options here.
	Also remove some leftover rectangle options cruft that is in its
	own files since long ago.

	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpiscissorstool.[ch]
	* app/tools/gimpregionselecttool.[ch]
	* app/widgets/gimpselectioneditor.c: changed accordingly.


svn path=/trunk/; revision=25071
2008-03-09 15:05:54 +00:00
Sven Neumann
2cf19eacee Experimental attempt to gain a little more horizontal space for the tool
2008-03-08  Sven Neumann  <sven@gimp.org>

	Experimental attempt to gain a little more horizontal space for
	the tool options:
	
	* app/widgets/gimptooloptionseditor.c: removed the shadow from 
the
	viewport and the border from the vbox.

	* app/widgets/gimpdockable.c: use a semibold label for the 
title.


svn path=/trunk/; revision=25065
2008-03-08 14:33:16 +00:00
Michael Natterer
f4378d6237 get rid of fixed-size arrays and allocate the points and curve arrays
2008-02-28  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcurve.[ch]: get rid of fixed-size arrays and
	allocate the points and curve arrays dynamically. Added "n-points"
	and "n-samples" CONSTRUCT_ONLY properties. Renamed member "curve"
	to "samples". Lots of code changes to work with dynamic limits
	rather than 17 and 256.

	* app/core/gimpdrawable-curves.c
	* app/gegl/gimpcurvesconfig.c
	* app/tools/gimpcurvestool.c
	* app/widgets/gimpcurveview.c: changed accordingly.


svn path=/trunk/; revision=24995
2008-02-28 12:34:46 +00:00
Michael Natterer
96645da002 cursors/Makefile.am cursors/gimp-tool-cursors.xcf
2008-02-28  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/gimp-tool-cursors.xcf
	* cursors/tool-polygon-select.png
	* cursors/xbm/tool-polygon-select.xbm
	* cursors/xbm/tool-polygon-select-mask.xbm
	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c: new cursor for polygon select.

	* app/tools/gimppolygonselecttool.c: use it.


svn path=/trunk/; revision=24994
2008-02-28 12:16:42 +00:00
Michael Natterer
23456dc253 app/display/gimpdisplayshell-callbacks.c
2008-02-16  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/tools/gimpforegroundselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimppolygonselecttool.c
	* app/tools/gimprectangletool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimppaletteview.c
	* libgimpwidgets/gimpcolorhexentry.c
	* libgimpwidgets/gimpnumberpairentry.c
	* plug-ins/script-fu/script-fu-console.c: Unify the handling of
	various "Enter" and "Space" keysyms all over the place. Fixes bug
	#516544 (also see gtk bug #515047).


svn path=/trunk/; revision=24894
2008-02-16 17:51:02 +00:00
William Skaggs
9ffdd63b63 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpcolormapeditor.c:  change wording of new
	hint for non-indexed images.

svn path=/trunk/; revision=24881
2008-02-13 20:26:25 +00:00
Sven Neumann
d552e8983d show a hint on non-indexed images. Based on a patch from Olof Frahm.
2008-02-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.[ch]: show a hint on 
non-indexed
	images. Based on a patch from Olof Frahm. Closes bug #438217.


svn path=/trunk/; revision=24870
2008-02-12 08:26:04 +00:00
Sven Neumann
9f43c5282c inverted logic; #ifdef is IMO easier to read than #ifndef.
2008-02-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplanguagestore-parser.c: inverted logic; #ifdef
	is IMO easier to read than #ifndef.


svn path=/trunk/; revision=24868
2008-02-12 07:24:34 +00:00
Tor Lillqvist
0d6c96b1a2 Don't use the compile-time paths to iso-codes on Windows. Instead assume
2008-02-12  Tor Lillqvist  <tml@novell.com>

	* app/widgets/gimplanguagestore-parser.c
	(gimp_language_store_populate): Don't use the compile-time paths
	to iso-codes on Windows. Instead assume iso-codes is installed in
	the same location as GIMP. Make sure translated language names are
	in UTF-8 by calling bind_textdomain_codeset().


svn path=/trunk/; revision=24867
2008-02-11 23:10:58 +00:00
Sven Neumann
384835d7e2 app/widgets/Makefile.am app/widgets/widgets-types.h
2008-02-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimplanguageentry.[ch]
	* app/widgets/gimptexteditor.c: turned language entry into a 
widget.


svn path=/trunk/; revision=24866
2008-02-11 20:19:03 +00:00
Michael Natterer
3c10d32272 enable wrapping so the text doesn't scroll out horizontally.
2008-02-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptexteditor.c (gimp_text_editor_new): enable
	wrapping so the text doesn't scroll out horizontally.


svn path=/trunk/; revision=24861
2008-02-11 17:02:50 +00:00
Michael Natterer
168566ad3e add gimp_curve_get_point().
2008-02-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcurve.[ch]: add gimp_curve_get_point().

	* app/gegl/gimpcurvesconfig.c
	* app/widgets/gimpcurveview.c: use it instead of accessing the
	points array directly.


svn path=/trunk/; revision=24857
2008-02-11 10:22:59 +00:00
Michael Natterer
3c5edcacbd add button-relief style property which defaults to NONE.
2008-02-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpeditor.c: add button-relief style property which
	defaults to NONE.


svn path=/trunk/; revision=24853
2008-02-10 20:50:21 +00:00
William Skaggs
5533bec51e Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpeditor.c: draw editor buttons without
	relief, see bug #515621.

svn path=/trunk/; revision=24852
2008-02-10 20:38:15 +00:00
Michael Natterer
797309b220 keep the anchor points as an array of GimpVector2 instead of plain
2008-02-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcurve.[ch]: keep the anchor points as an array of
	GimpVector2 instead of plain doubles.

	* app/gegl/gimpcurvesconfig.c
	* app/widgets/gimpcurveview.c: changed accordingly.


svn path=/trunk/; revision=24842
2008-02-09 17:40:57 +00:00
Michael Natterer
437becc44a cleanup.
2008-02-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_draw_point): cleanup.


svn path=/trunk/; revision=24841
2008-02-09 17:24:04 +00:00
Michael Natterer
58c0ba65fc port internal cursor stuff to gdouble, fix off-by-one in curve drawing,
2008-02-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcurveview.[ch]: port internal cursor stuff to
	gdouble, fix off-by-one in curve drawing, fix drawing artefact in
	handle drawing by starting drawing on the handle's outline and not
	its center.


svn path=/trunk/; revision=24839
2008-02-09 11:14:40 +00:00
Michael Natterer
e831300587 port the "xpos" API to [0.0..1.0] doubles too.
2008-02-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcurveview.[ch]: port the "xpos" API
	to [0.0..1.0] doubles too.

	* app/tools/gimpcurvestool.[ch]: rename "col_value" member to
	"picked_color" and use gdouble instead of gint. Also use GimpCurve
	API to map the values instead of accessing the curve directly.
	Fixes setting curve anchor points by color picking.


svn path=/trunk/; revision=24838
2008-02-09 10:56:25 +00:00
Michael Natterer
044359f93d changed all values to be [0.0..1.0] doubles instead of [0..255] integers.
2008-02-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcurve.[ch]: changed all values to be [0.0..1.0]
	doubles instead of [0..255] integers. Also changed the API to use
	doubles instead of ints. Still have the fixed-size arrays though.

	(gimp_curve_map): new function to map values.

	* app/gegl/gimpoperationcurves.c: remove private map() function
	and use the one from GimpCurve.

	* app/gegl/gimpcurvesconfig.c
	* app/core/gimpdrawable-curves.c: port to the new gdouble API.

	* app/tools/gimpcurvestool.c: use gimp_curve_get_uchar() to get
	the arrays for the color bars.

	* app/widgets/gimpcurveview.[ch]: port to gdouble and some cleanup.


svn path=/trunk/; revision=24837
2008-02-09 10:01:51 +00:00
Sven Neumann
67854fce82 moved language selection to toolbar
svn path=/trunk/; revision=24836
2008-02-08 21:03:18 +00:00
Sven Neumann
41276c600f works better with inline completion
svn path=/trunk/; revision=24835
2008-02-08 20:52:03 +00:00
Sven Neumann
98ae72715b use an entry with completion for language selection. Still not functional.
2008-02-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptexteditor.c: use an entry with completion 
for
	language selection. Still not functional.


svn path=/trunk/; revision=24834
2008-02-08 20:42:34 +00:00
Sven Neumann
904abbfd11 app/widgets/gimplanguagestore.[ch] actually populate the language store.
2008-02-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplanguagestore.[ch]
	* app/widgets/gimplanguagestore-parser.c: actually populate the
	language store. Still work in progress...

	* app/widgets/gimptexteditor.c: added a combo-box for language
	selection. Not functional yet; just something to play with.

svn path=/trunk/; revision=24833
2008-02-08 13:50:34 +00:00
Sven Neumann
5bcb542896 implemented the parser.
2008-02-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplanguagestore-parser.c: implemented the parser.

	* app/dialogs/tips-parser.c: minor cleanup.

svn path=/trunk/; revision=24832
2008-02-08 12:28:36 +00:00
Sven Neumann
7f2a8fc35a added configure checks for the iso-codes package.
2008-02-07  Sven Neumann  <sven@gimp.org>

	* configure.in: added configure checks for the iso-codes package.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimplanguagestore.[ch]:
	* app/widgets/gimplanguagestore-parser.[ch]: added rough outline
	of GtkListStore for language selection.

svn path=/trunk/; revision=24828
2008-02-07 16:50:11 +00:00
Michael Natterer
3a66deae00 add get_pid() which returns getpid().
2008-02-07  Michael Natterer  <mitch@gimp.org>

	* app/base/base-utils.[ch]: add get_pid() which returns getpid().

	* app/base/base.c
	* app/base/tile-swap.c
	* app/core/gimp-utils.c
	* app/plug-in/gimppluginshm.c
	* app/widgets/gimpselectiondata.c
	* tools/pdbgen/pdb/misc.pdb: use it instead of getpid() and remove
	all the #ifdef'ed includes getpid() needs.

	* tools/pdbgen/app.pl: remove support for these includes. Also
	remove some perl cruft in the include handling which is not needed
	any longer.

	* app/pdb/misc_cmds.c: regenerated.


svn path=/trunk/; revision=24827
2008-02-07 13:19:15 +00:00
Michael Natterer
fdb9060f73 app/tools/gimpgegltool.c (gimp_param_spec_duplicate) add support for
2008-02-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpgegltool.c (gimp_param_spec_duplicate)
	* app/widgets/gimppropwidgets.c (gimp_prop_table_new): add support
	for GParamSpecEnum.

	* app/core/gimpimagemap.c (gimp_image_map_apply): add even better
	checks for input and output pads of the passed operation.


svn path=/trunk/; revision=24824
2008-02-06 18:38:29 +00:00
Michael Natterer
f4272e69e7 app/paint/gimpclone.c app/paint/gimpheal.c app/paint/gimpink.c remove
2008-02-06  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpclone.c
	* app/paint/gimpheal.c
	* app/paint/gimpink.c
	* app/widgets/gimphistogrameditor.c: remove includes that are
	not needed any longer.


svn path=/trunk/; revision=24823
2008-02-06 18:12:57 +00:00
Michael Natterer
84939f1652 app/tools/gimpgegltool.c (gimp_param_spec_duplicate) support multiline
2008-02-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpgegltool.c (gimp_param_spec_duplicate)
	* app/widgets/gimppropwidgets.c (gimp_prop_table_new): support
	multiline text and file paths. The multiline support is hacked up
	and needs some proper solution.


svn path=/trunk/; revision=24818
2008-02-06 09:09:34 +00:00
Michael Natterer
d258d331dc don't forget the label for entry widgets.
2008-02-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_table_new): don't forget
	the label for entry widgets.


svn path=/trunk/; revision=24815
2008-02-05 19:43:17 +00:00
Michael Natterer
b4255ae3cd new function which creates a table of prop widgets for all properties of
2008-02-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.[ch] (gimp_prop_table_new): new
	function which creates a table of prop widgets for all properties
	of an object (pretty incomplete, does exactly what's needed in
	GimpGeglTool, or even less).

	* app/tools/gimpgegltool.c: create a proxy config class for each
	GegĺOperation and create a prop table on the config class'
	properties as GUI for the GEGL operation. Write the proxy object's
	properties back to the GeglNode in map().


svn path=/trunk/; revision=24809
2008-02-05 13:20:11 +00:00
Michael Natterer
50ad5cfd32 add refcounting and replace free() API by ref() and unref().
2008-02-04  Michael Natterer  <mitch@gimp.org>

	* app/base/gimphistogram.[ch]: add refcounting and replace free()
	API by ref() and unref().

	* app/core/gimpdrawable-equalize.c
	* app/core/gimpdrawable-levels.c
	* app/widgets/gimphistogrameditor.c
	* tools/pdbgen/pdb/color.pdb: replace calls to
	gimp_histogram_free() by gimp_histogram_unref().

	* app/pdb/color_cmds.c: regenerated.

	* app/widgets/gimphistogramview.c: reference the histograms so we
	don't need the widget's users to keep them around while the widget
	exists.

	* app/tools/gimpcurvestool.[ch]: remove the histogram from the
	tool struct and just create one locally to set it on the histogram
	view widget.

	Unrelated:

	* app/tools/gimplevelstool.[ch]
	* app/tools/gimpthresholdtool.[ch]: renamed "hist" members to
	"histogram" plus some cleanup.


svn path=/trunk/; revision=24792
2008-02-04 21:41:57 +00:00
Michael Natterer
a1c5cbdcca refuse containers if their children are not GimpViewables instead of
2008-02-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerview.c
	(gimp_container_view_set_container): refuse containers if their
	children are not GimpViewables instead of crashing later.


svn path=/trunk/; revision=24769
2008-02-01 11:49:12 +00:00
Martin Nordholts
919a298092 Added a Polygon Select Tool which is a primitive selection tool based on
2008-01-30  Martin Nordholts  <martinn@svn.gnome.org>

	Added a Polygon Select Tool which is a primitive selection tool
	based on Free Hand Select. Code filtered through David Gowers who
	also made the tool icon. This version of the tool is a for-now
	solution to bug #119646.

	* app/tools/gimppolygonselecttool.[ch]: The new tool.

	* app/tools/gimp-tools.c: Add the tool.

	* app/tools/Makefile.am: Add tool source.

	* app/widgets/gimphelp-ids.h: Add help id for the tool.

	* libgimpwidgets/gimpstock.[ch]: Setup for the new tool icon.

	* menus/image-menu.xml.in: Add action entry for the tool.

	* themes/Default/images/tools/stock-tool-polygon-select-{16,24}.png:
	Tool icon graphics.

	* themes/Default/images/Makefile.am: Add tool icon graphics.

svn path=/trunk/; revision=24753
2008-01-30 20:33:58 +00:00
Michael Natterer
2abe1667eb don't emit signals/notifications if the setting didn't change.
2008-01-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogramview.c
	(gimp_histogram_view_set_channel)
	(gimp_histogram_view_set_scale)
	(gimp_histogram_view_set_range): don't emit signals/notifications
	if the setting didn't change.


svn path=/trunk/; revision=24751
2008-01-30 18:19:12 +00:00
Sven Neumann
4624bc84d4 avoid crashing when the widget allocation is small (bug #511926).
2008-01-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.c (gimp_colormap_editor_draw):
	avoid crashing when the widget allocation is small (bug 
#511926).


svn path=/trunk/; revision=24704
2008-01-25 07:39:33 +00:00
Michael Natterer
8191536f8b fix the ID of the "histogram-channel" property.
2008-01-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorbar.c (gimp_color_bar_class_init): fix the
	ID of the "histogram-channel" property.


svn path=/trunk/; revision=24660
2008-01-21 16:18:51 +00:00
Sven Neumann
cba937480e gracefully deal with a NULL return value from gtk_ui_manager_get_widget().
2008-01-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpuimanager.c (gimp_ui_manager_ui_popup):
	gracefully deal with a NULL return value from
	gtk_ui_manager_get_widget(). This happens when the XML menu
	definitions are not found.


svn path=/trunk/; revision=24594
2008-01-10 22:17:28 +00:00
Sven Neumann
4aa7e67c67 removed "add_alpha" parameter from gimp_item_duplicate() and
2008-01-08  Sven Neumann  <sven@gimp.org>

	* app/core/gimpitem.[ch]: removed "add_alpha" parameter from
	gimp_item_duplicate() and gimp_item_convert(). This is a relict
	from the time when only the bottom layer was allowed to have no
	alpha channel.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-quick-mask.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimpselection.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.c
	* app/pdb/channel_cmds.c
	* app/pdb/layer_cmds.c
	* app/text/gimptextlayer.c
	* app/vectors/gimpvectors.c
	* app/vectors/gimpvectorsmodundo.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/layer.pdb: changed accordingly.

svn path=/trunk/; revision=24570
2008-01-08 11:46:15 +00:00
Hans Breuer
9a1d5f3453 **/makefile.msc app/gimpcore.def : updated so it compiles and links
2008-01-04  Hans Breuer  <hans@breuer.org>

	**/makefile.msc app/gimpcore.def : updated so it compiles and links
	(almost, see bug #507298)

svn path=/trunk/; revision=24533
2008-01-04 18:42:07 +00:00
Michael Natterer
dd97e60591 add "use-gegl" property but don't serialize it.
2008-01-04  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpcoreconfig.[ch]: add "use-gegl" property but
	don't serialize it.

	* app/widgets/gimptoolbox.c: add super ugly "Use GEGL" toggle to
	the toolbox so we don't need to have prefs open all the time when
	experimenting with gegl.

	* app/tools/gimpimagemaptool.[ch]: remove "Use GEGL" toggle from
	the tool dialogs and connect to the config property instead.

	* app/core/gimpdrawable-desaturate.c
	* app/core/gimpdrawable-invert.c: made them runtime-switchable by
	looking at the config property.


svn path=/trunk/; revision=24530
2008-01-04 17:28:49 +00:00
Sven Neumann
0d818d9ad3 app/display/gimpstatusbar.[ch] only update the GtkProgressBar if that
2007-12-30  Sven Neumann  <sven@gimp.org>

	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpprogressbox.[ch]: only update the 
GtkProgressBar
	if that would cause a visible change.


svn path=/trunk/; revision=24487
2007-12-30 17:25:58 +00:00
Sven Neumann
3d48f1bcc9 removed GIMP_RENDER_BUF_WIDTH and GIMP_RENDER_BUF_HEIGHT definitions.
2007-12-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimprender.h: removed GIMP_RENDER_BUF_WIDTH and
	GIMP_RENDER_BUF_HEIGHT definitions.

	* app/display/gimpdisplayshell.h: define the size of the display
	render buffer here.

	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-draw.c
	* app/widgets/gimprender.c: changed accordingly.


svn path=/trunk/; revision=24456
2007-12-28 22:12:17 +00:00
Sven Neumann
787b01005d don't use the render buffer. Use a white background until this widget is
2007-12-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.c: don't use the render buffer.
	Use a white background until this widget is rewritten.


svn path=/trunk/; revision=24455
2007-12-28 21:40:02 +00:00
Michael Natterer
0b27e1e596 fix my last commit to this file (don't access sample points of NULL
2007-12-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsamplepointeditor.c
	(gimp_sample_point_editor_points_changed): fix my last commit to
	this file (don't access sample points of NULL images).


svn path=/trunk/; revision=24454
2007-12-28 21:02:16 +00:00
Sven Neumann
b194e6fb62 addec const qualifiers to GimpRGB parameters.
2007-12-28  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcairo-utils.[ch]: addec const qualifiers to
	GimpRGB parameters.

	* app/widgets/gimprender.[ch]: removed global variables for
	checkerboard colors and introduced functions to get the
	checkerboard colors as pointers to GimpRGB structs.

	* app/actions/view-actions.c
	* app/display/gimpdisplayshell-appearance.c
	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpcolormapeditor.c: changed accordingly.


svn path=/trunk/; revision=24451
2007-12-28 19:14:36 +00:00
Sven Neumann
26f6ca6d1d added light and dark check color parameters to
2007-12-28  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcairo-utils.[ch]: added light and dark 
check
	color parameters to gimp_cairo_checkerboard_create().

	* libgimpwidgets/gimpcellrenderercolor.c
	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_real_draw):
	changed accordingly.


svn path=/trunk/; revision=24450
2007-12-28 18:44:32 +00:00
Sven Neumann
6312375edd cache the checkerboard pattern.
2007-12-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.c: cache the checkerboard 
pattern.


svn path=/trunk/; revision=24447
2007-12-28 17:54:01 +00:00
Sven Neumann
f97ebdf72d if the surface has CAIRO_CONTENT_COLOR_ALPHA, render it on a checkerboard
2007-12-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_real_draw):
	if the surface has CAIRO_CONTENT_COLOR_ALPHA, render it on a
	checkerboard background.

	* app/widgets/gimpviewrenderergradient.[ch]: just draw the
	gradient with alpha-transparency instead of doing the blend on 
the
	checkerboard here.

	* app/widgets/gimpcolormapeditor.c: formatting.


svn path=/trunk/; revision=24446
2007-12-28 17:17:10 +00:00
Sven Neumann
1ad4d1260b enable line wrapping on the info label.
2007-12-27  Sven Neumann  <sven@gimp.org>

        * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): enable line
        wrapping on the info label.


svn path=/trunk/; revision=24439
2007-12-27 15:42:20 +00:00
Michael Natterer
1e8371361e app/actions/image-commands.c app/actions/select-commands.c
2007-12-26  Michael Natterer  <mitch@gimp.org>

	* app/actions/image-commands.c
	* app/actions/select-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpdrawable-stroke.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-preview.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimageundo.c
	* app/core/gimpitem-preview.c
	* app/dialogs/grid-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/dialogs/offset-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpstatusbar.c
	* app/paint/gimppaintoptions.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectangletool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimptexttool.c
	* app/vectors/gimpvectors-export.c
	* app/vectors/gimpvectors-import.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpimagepropview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrendererimage.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c: use gimp_image_get/set_resolution() instead
	of accessing the GimpImage members directly.


svn path=/trunk/; revision=24436
2007-12-26 17:33:41 +00:00
Michael Natterer
6074f7e248 app/core/gimpimage-guides.[ch] add accessors for the lists of guides and
2007-12-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-guides.[ch]
	* app/core/gimpimage-sample-points.[ch]: add accessors for the lists
	of guides and sample points.

	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-snap.c
	* app/core/gimpimage.c
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell.c
	* app/widgets/gimpsamplepointeditor.c
	* app/xcf/xcf-save.c: use the new accessors.


svn path=/trunk/; revision=24434
2007-12-25 17:09:04 +00:00
Michael Natterer
0d31cf5521 : renamed "cmap" to "colormap" and "num_cols" to "n_colors".
2007-12-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.h (struct GimpImage):: renamed "cmap" to
	"colormap" and "num_cols" to "n_colors".

	* app/core/gimpimage.c
	* app/core/gimpimage-colormap.[ch]
	* app/widgets/gimpcolormapeditor.c: changed accordingly.


svn path=/trunk/; revision=24433
2007-12-25 16:33:04 +00:00
Michael Natterer
75061fccfd app/actions/channels-commands.c app/actions/colormap-actions.c
2007-12-25  Michael Natterer  <mitch@gimp.org>

	* app/actions/channels-commands.c
	* app/actions/colormap-actions.c
	* app/actions/colormap-commands.c
	* app/actions/image-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpdrawable-preview.c
	* app/core/gimpimage-colorhash.c
	* app/core/gimpimage-colormap.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-guides.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-preview.c
	* app/core/gimpimage-quick-mask.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-sample-points.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-snap.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/core/gimpimageundo.c
	* app/core/gimpitem-preview.c
	* app/core/gimpitem.c
	* app/core/gimplayer.c
	* app/core/gimppalette-import.c
	* app/core/gimpprojection-construct.c
	* app/core/gimpprojection.c
	* app/core/gimpselection.c
	* app/core/gimpundo.c
	* app/dialogs/layer-options-dialog.c
	* app/dialogs/print-size-dialog.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-scroll.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell-transform.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpstatusbar.c
	* app/file/file-open.c
	* app/paint/gimppaintoptions.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpcolortool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimpperspectiveclonetool.c
	* app/tools/gimprectangleselecttool.c
	* app/tools/gimprectangletool.c
	* app/tools/gimprotatetool.c
	* app/vectors/gimpvectors-export.c
	* app/vectors/gimpvectors-import.c
	* app/vectors/gimpvectors.c
	* app/widgets/gimpimagepropview.c
	* app/widgets/gimpnavigationview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrendererimage.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/guides.pdb
	* tools/pdbgen/pdb/image.pdb: use accessors for many image properties.

	* app/pdb/guides_cmds.c
	* app/pdb/image_cmds.c: regenerated.


svn path=/trunk/; revision=24432
2007-12-25 16:21:40 +00:00
Michael Natterer
ecb2c46dc8 app/actions/layers-commands.c app/core/gimpchannel-combine.c
2007-12-23  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-commands.c
	* app/core/gimpchannel-combine.c
	* app/core/gimpchannel-select.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-convert.c
	* app/core/gimpdrawable.c
	* app/core/gimpdrawablemodundo.c
	* app/core/gimpfloatingselundo.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage.c
	* app/core/gimpitem-preview.c
	* app/core/gimpitem.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimplayerundo.c
	* app/core/gimpmaskundo.c
	* app/core/gimppalette-import.c
	* app/core/gimpprojection-construct.c
	* app/core/gimpselection.c
	* app/dialogs/offset-dialog.c
	* app/text/gimptextlayer-xcf.c
	* app/text/gimptextlayer.c
	* app/vectors/gimpvectors-compat.c
	* app/vectors/gimpvectors.c
	* app/vectors/gimpvectorsmodundo.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderervectors.c: use accessors for item,
	layer, channel and mask attributes.


svn path=/trunk/; revision=24429
2007-12-23 16:58:41 +00:00
Sven Neumann
318bcd396d added code for adding a shortcut to the default ICC profile location on
2007-12-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprofilechooserdialog.c: added code for adding 
a
	shortcut to the default ICC profile location on Windows. Based 
on
	a patch by John Marshall (bug #503410).


svn path=/trunk/; revision=24407
2007-12-20 08:26:13 +00:00
Sven Neumann
45b5ffb7cf don't rely on the pointer position in the GdkEventMotion struct, query the
2007-12-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.c: don't rely on the pointer
	position in the GdkEventMotion struct, query the pointer instead.

svn path=/trunk/; revision=24395
2007-12-18 17:51:32 +00:00
Sven Neumann
325d7d0f8f minor cleanup.
2007-12-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpnavigationeditor.c: minor cleanup.

	* app/widgets/gimpnavigationview.c
	(gimp_navigation_view_motion_notify): fixed handling of motion
	events that broke when I introduced the call to
	gdk_event_request_motions().

svn path=/trunk/; revision=24394
2007-12-18 17:43:01 +00:00
Sven Neumann
75614f65cc added new function gimp_cairo_set_focus_line_pattern().
2007-12-16  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcairo-utils.[ch]: added new function
	gimp_cairo_set_focus_line_pattern().

	* libgimpwidgets/gimpcellrenderercolor.c
	(gimp_cell_renderer_color_render): use the focus line pattern to
	emphasize the selected entry.

	* app/widgets/gimppaletteview.c (gimp_palette_view_expose): use 
the
	new utility function.

	* libgimpwidgets/gimpwidgets.def: updated.


svn path=/trunk/; revision=24371
2007-12-16 11:15:36 +00:00
William Skaggs
6d92a4a67f Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphelp-ids.h
	* app/display/gimpdisplayshell-scale.[ch]
	* app/display/gimpnavigationeditor.[ch]
	* app/actions/view-commands.[ch]
	* app/actions/view-commands.c:

	Changed "Fit Image to Window" to "Fill Window", and changed
	"fit-to" to "fill" in all the related things.  Fixes
	bug #490364.

svn path=/trunk/; revision=24370
2007-12-16 02:06:15 +00:00
Sven Neumann
d8d68bd5b5 added utility function to reduce code duplication.
2007-12-14  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: added utility function to reduce
	code duplication.


svn path=/trunk/; revision=24367
2007-12-14 20:08:39 +00:00
William Skaggs
4bab078cbe Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): add
	shortcut to user's DOCUMENTS dir, fixes bug #325294.

svn path=/trunk/; revision=24357
2007-12-13 21:19:44 +00:00
Sven Neumann
daf03994b0 export the light and dark check color so that places that just need this
2007-12-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimprender.[ch]: export the light and dark check
	color so that places that just need this information don't have to
	access the gimp_render_blend_{dark,light}_check arrays.

	* app/actions/view-actions.c
	* app/display/gimpdisplayshell-appearance.c
	* app/widgets/gimpcolormapeditor.c: changed accordingly.

svn path=/trunk/; revision=24351
2007-12-13 14:54:23 +00:00
Sven Neumann
dbb325eba6 renamed gimp_cairo_set_source_color() to gimp_cairo_set_source_rgb() and
2007-12-12  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcairo-utils.[ch]: renamed
	gimp_cairo_set_source_color() to gimp_cairo_set_source_rgb() and
	added an RGBA variant.

	* libgimpwidgets/gimpcellrenderercolor.c
	(gimp_cell_renderer_color_render)
	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_draw): changed
	accordingly.

	* libgimpwidgets/gimpwidgets.def: updated.

svn path=/trunk/; revision=24342
2007-12-12 16:14:49 +00:00
Sven Neumann
5faf644bbb added new function gimp_cairo_checkerboard_create() and renamed
2007-12-12  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcairo-utils.[ch]: added new function
	gimp_cairo_checkerboard_create() and renamed
	gimp_cairo_create_surface_from_pixbuf() to
	gimp_cairo_surface_create_from_pixbuf().

	* libgimpwidgets/gimpcellrenderercolor.c
	(gimp_cell_renderer_color_render): use Cairo utils here.

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_create_pattern):
	changed accordingly.

	* libgimpwidgets/gimpwidgets.def: updated.

svn path=/trunk/; revision=24340
2007-12-12 14:41:25 +00:00
Sven Neumann
a44fa674f0 app/widgets/Makefile.am removed here...
2007-12-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-utils.[ch]: removed here...

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpcairo-utils.[ch]: and added here after some
	cleanup.

	* libgimpwidgets/gimpwidgets.h: include gimpcairo-utils.h.

	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererpalette.c: changed accordingly.

	* libgimpwidgets/gimpwidgets.def: updated for Cairo utils.

	* libgimp/gimp.def: added gimp_image_get_vectors_by_tattoo.


svn path=/trunk/; revision=24339
2007-12-12 14:17:19 +00:00
Michael Natterer
dfaf761dc0 added GError to GimpItem::rename().
2007-12-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: added GError to GimpItem::rename().

	* app/core/gimplayer.c
	* app/core/gimplayermask.c: set errors when renaming is impossible.

	* app/text/gimptextlayer.c
	* app/core/gimpimage-quick-mask.c: changed accordingly.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c
	* app/widgets/gimpitemtreeview.c: handle the returned errors.

	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/vectors.pdb: pass the error.

	* app/pdb/drawable_cmds.c
	* app/pdb/vectors_cmds.c: regenerated.


svn path=/trunk/; revision=24338
2007-12-12 13:57:11 +00:00
Sven Neumann
5523cc8178 INSTALL configure.in bumped minimum required version of gtk+ to 2.12.1.
2007-12-12  Sven Neumann  <sven@gimp.org>

	* INSTALL
	* configure.in
	* app/gui/gui.c (GTK_REQUIRED_MICRO): bumped minimum required
	version of gtk+ to 2.12.1.

	* app/widgets/gimpdockbook.c (gimp_dockbook_tab_drag_motion):
	removed unused parameter that was needed for gtk+ < 2.12.1.

svn path=/trunk/; revision=24334
2007-12-12 12:25:26 +00:00
Hans Breuer
6f5bbfe0bd updated and removed -GD to let msvc9 complain less
2007-12-09  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated and removed -GD to let msvc9 complain less


svn path=/trunk/; revision=24305
2007-12-09 14:11:09 +00:00
Sven Neumann
915ac64ad5 use GError for error reporting in PDB invoker methods.
2007-12-02  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/app.pl: use GError for error reporting in PDB
	invoker methods.

	* tools/pdbgen/pdb/vectors.pdb: use the GError for the 
procedures
	introduced for bug #497159.

	* tools/pdbgen/pdb/fileops.pdb: use the GError from file-load 
and
	file-save procedures.

	* app/pdb/*_cmds.c: regenerated.

	* app/pdb/Makefile.am

	* app/pdb/gimppdberror.[ch]: new file introducing the
	GIMP_PDB_ERROR domain.

	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/batch.c
	* app/core/gimpimagefile.c
	* app/core/gimppdbprogress.c
	* app/file/file-open.[ch]
	* app/file/file-save.c
	* app/plug-in/gimpplugin-message.c
	* app/plug-in/gimppluginmanager-restore.c
	* app/plug-in/gimppluginprocedure.c
	* app/plug-in/gimptemporaryprocedure.c
	* app/plug-in/plug-in-icc-profile.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c
	* app/widgets/gimppdbdialog.[ch]: changed accordingly.


svn path=/trunk/; revision=24255
2007-12-02 18:05:54 +00:00
Sven Neumann
0c118652fe escape text before using it in Pango text markup.
2007-11-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_widget_accel_changed):
	escape text before using it in Pango text markup.

svn path=/trunk/; revision=24235
2007-11-26 17:04:39 +00:00
Sven Neumann
1c223060aa corrected rendering of the blob (bug #499281).
2007-11-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpblobeditor.c (gimp_blob_editor_draw_blob):
	corrected rendering of the blob (bug #499281).


svn path=/trunk/; revision=24231
2007-11-26 07:34:15 +00:00
Michael Natterer
8fba0a2f27 derive from GtkEventBox instead of GtkMisc, but use an input-only window.
2007-11-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorbar.[ch]: derive from GtkEventBox instead
	of GtkMisc, but use an input-only window.

	* app/tools/gimplevelstool.c: redirect the events of the color
	bars to te handle bars. The historgram dialog has this change
	already. Functionality should be 100% restored now.


svn path=/trunk/; revision=24218
2007-11-22 17:07:33 +00:00
Sven Neumann
dc5d601675 use gtk_widget_set_tooltip_text() from gimp_help_set_help() and added
2007-11-22  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimphelpui.[ch]: use
	gtk_widget_set_tooltip_text() from gimp_help_set_help() and added
	gimp_help_set_help_data_with_markup() for the cases where markup
	is needed.

	* libgimpwidgets/gimpwidgets.def: updated.

	* app/tools/gimpselectionoptions.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpwidgets-utils.c: use the new function where markup
	in tooltips is being used.

	* app/widgets/gimptoolbox-color-area.c: no need to escape the
	ampersand any longer.

svn path=/trunk/; revision=24217
2007-11-22 13:59:06 +00:00
Michael Natterer
f2da134d27 set the combo insensitive when it has no items. Fixes bug #498511.
2007-11-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.c: set the combo insensitive
	when it has no items. Fixes bug #498511.


svn path=/trunk/; revision=24204
2007-11-20 19:08:24 +00:00
Sven Neumann
07e3fd31f3 added const qualifiers.
2007-11-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorbar.c (gimp_color_bar_expose): added const
	qualifiers.

svn path=/trunk/; revision=24199
2007-11-20 09:14:05 +00:00
Michael Natterer
c22ca3f4f6 app/widgets/widgets-types.h app/widgets/Makefile.am new widget
2007-11-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h
	* app/widgets/Makefile.am
	* app/widgets/gimphandlebar.[ch]: new widget implementing the slider
	bar known from histogram and levels.

	* app/widgets/gimphistogrambox.[ch]: use the new widget. General
	cleanup and UI streamlining.


svn path=/trunk/; revision=24198
2007-11-20 09:10:39 +00:00
Michael Natterer
f5bd538118 app/widgets/gimpcolorbar.c cosmetic.
2007-11-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorbar.c
	* app/widgets/gimphistogramview.c: cosmetic.


svn path=/trunk/; revision=24197
2007-11-19 23:39:56 +00:00
Sven Neumann
cb7b0d1ff5 draw a base-line with the grid. Not sure if this should stay enabled for
2007-11-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.[ch]: draw a base-line with the 
grid.
	Not sure if this should stay enabled for the Curves tool...


svn path=/trunk/; revision=24196
2007-11-19 20:06:30 +00:00
Michael Natterer
f4621424a7 add DIALOG_FACTORY log domain.
2007-11-18  Michael Natterer  <mitch@gimp.org>

	* app/gimp-log.[ch]: add DIALOG_FACTORY log domain.

	* app/widgets/gimpdialogfactory.c: port debug output to GIMP_LOG().


svn path=/trunk/; revision=24185
2007-11-18 17:40:24 +00:00
Michael Natterer
f6efd04039 add HELP log domain.
2007-11-16  Michael Natterer  <mitch@gimp.org>

	* app/gimp-log.[ch]: add HELP log domain.

	* app/widgets/gimphelp.c: port debug output to GIMP_LOG() and
	improve it.


svn path=/trunk/; revision=24177
2007-11-16 18:56:10 +00:00
Michael Natterer
b9a63e1b49 app/display/gimpdisplayshell-dnd.c app/widgets/gimpdnd-xds.c use
2007-11-15  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpselectiondata.c: use GIMP_LOG(DND) here too.


svn path=/trunk/; revision=24164
2007-11-15 13:54:15 +00:00
Michael Natterer
df792bf8e8 add DND log domain.
2007-11-15  Michael Natterer  <mitch@gimp.org>

	* app/gimp-log.[ch]: add DND log domain.

	* app/widgets/gimpdnd.c: use GIMP_LOG().


svn path=/trunk/; revision=24163
2007-11-15 13:21:23 +00:00
Michael Natterer
2ff7c79caf add read-only property "frozen" and new API
2007-11-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpviewable.[ch]: add read-only property "frozen" and
	new API gimp_viewable_preview_is_fozen(). Emit property notifications.

	* app/widgets/gimphistogramview.[ch]: add API to show a second
	histogram in the background. Remove member "light_histogram" from
	the GimpHistogramViewClass struct.

	* app/widgets/gimpcurveview.c: don't set "light_histogram".

	* app/tools/gimpcurvestool.c: set the background histogram instead.

	* app/widgets/gimphistogrameditor.[ch]: connect to "notify::frozen"
	of the drawable and show its histogram at the freezing point in
	the background. This way the original histogram is visible while
	we are doing color corrections.


svn path=/trunk/; revision=24158
2007-11-15 10:26:25 +00:00
Michael Natterer
43b503df95 replaced the number label with a big Cairo-drawn number below the color
2007-11-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorframe.[ch]: replaced the number label with
	a big Cairo-drawn number below the color value labels.


svn path=/trunk/; revision=24157
2007-11-14 14:53:45 +00:00
Michael Natterer
10ccddfb93 app/display/gimpcanvas.c free the cached PangoLayouts in
2007-11-14  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpcanvas.c
	* app/widgets/gimpcurveview.c: free the cached PangoLayouts in
	GtkWidget::style_set().

	* app/widgets/gimppaletteview.c: draw the focus rectangle in
	hardcoded black/white since we also hardcode the grid color to
	black.

	* app/display/gimpstatusbar.c
	* app/widgets/gimpdockable.c: small cleanups while reviewing
	layout code.


svn path=/trunk/; revision=24156
2007-11-14 14:42:05 +00:00
Michael Natterer
614932021c replaced the number label with a big Cairo-drawn number below the color
2007-11-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorframe.[ch]: replaced the number label with
	a big Cairo-drawn number below the color value labels.


svn path=/trunk/; revision=24155
2007-11-14 14:33:23 +00:00
Michael Natterer
77c400e776 port to Cairo drawing.
2007-11-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteview.[ch]: port to Cairo drawing.


svn path=/trunk/; revision=24154
2007-11-14 09:19:09 +00:00
Michael Natterer
ac39ccfb91 use cairo_save()/cairo_restore() around calling the virtual function
2007-11-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_draw): use
	cairo_save()/cairo_restore() around calling the virtual function
	instead of restoring the clipping area manually.


svn path=/trunk/; revision=24148
2007-11-13 16:00:13 +00:00
Michael Natterer
6bdca50d0b naive port to Cairo. Somebody should check if this isn't better done with
2007-11-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrenderervectors.c
	(gimp_view_renderer_vectors_draw): naive port to Cairo. Somebody
	should check if this isn't better done with proper curve_to()
	drawing using the original vectors data instead of interpolation.

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_draw): reset
	clipping before drawing the border because a subclass' draw()
	might have done additional clipping.


svn path=/trunk/; revision=24147
2007-11-13 14:27:29 +00:00
Sven Neumann
efa6b2b820 Fix for bug #494049 (painting doesn't update the histogram):
2007-11-13  Sven Neumann  <sven@gimp.org>

	Fix for bug #494049 (painting doesn't update the histogram):

	* app/paint/gimppaintcore.c: freeze the drawable preview while we
	are painting. Update the drawable instead of the image.

	* app/widgets/gimphistogrameditor.c: use a short timeout instead
	of an idle handler to update the histogram.

svn path=/trunk/; revision=24143
2007-11-13 10:59:32 +00:00
Sven Neumann
e9bb7af53a corrected offset
svn path=/trunk/; revision=24105
2007-11-09 16:08:04 +00:00
Sven Neumann
9559d388fd align the overlay with the pixel grid.
2007-11-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_expose): align 
the
	overlay with the pixel grid.


svn path=/trunk/; revision=24104
2007-11-09 15:53:47 +00:00
Sven Neumann
8d1725525f draw the selected point filled and outlines for the unselected points.
2007-11-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.c: draw the selected point filled 
and
	outlines for the unselected points.


svn path=/trunk/; revision=24103
2007-11-09 15:23:10 +00:00
Sven Neumann
2954518846 draw the center grid lines slightly stronger than the other grid lines.
2007-11-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_expose): draw the
	center grid lines slightly stronger than the other grid lines.


svn path=/trunk/; revision=24102
2007-11-09 14:49:34 +00:00
Sven Neumann
ad6be0c138 draw the cursor position using a translucent overlay.
2007-11-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_expose): draw the
	cursor position using a translucent overlay.


svn path=/trunk/; revision=24101
2007-11-09 14:30:51 +00:00
Sven Neumann
fdbf34cc8c added construct-only properties to control the number of grid rows and
2007-11-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcurveview.[ch]: added construct-only 
properties
	to control the number of grid rows and columns. Increased the
	default values to 8.


svn path=/trunk/; revision=24099
2007-11-09 13:45:01 +00:00
Michael Natterer
a446f3d7fb use the new tooltip API instead of the old deprecated one. Removed
2007-11-09  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimphelpui.[ch]: use the new tooltip API instead
	of the old deprecated one. Removed _gimp_help_init(). Remember
	whether tooltips are enabled or not in a local variable that can
	only be altered at startup time and not after. The API now expects
	markup instead of plain text which might cause warnings and
	perhaps needs to be changed.

	* libgimpwidgets/gimpwidgets-private.c: don't call _gimp_help_init().

	* app/config/gimpguiconfig.c: made show-tooltips a
	GIMP_CONFIG_PARAM_RESTART property.

	* app/widgets/gimptoolbox-color-area.c: don't add the tooltip here...

	* app/widgets/gimptoolbox.c: ...but here (as for all other
	indicators). Also escape '&' properly because we now use markup.

	* app/tools/gimpselectionoptions.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpwidgets-utils.c: print modifiers and
	shortcuts in bold instead of in ().

	* app/widgets/gimpcontainertreeview.c: show tooltips on rows if
	gimp_viewable_get_description() returns a tip.

	* app/dialogs/preferences-dialog.c
	* plug-ins/jpeg/jpeg-save.c
	* plug-ins/MapObject/mapobject_ui.c
	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/common/animationplay.c
	* plug-ins/common/warp.c: no need to add event boxes just to have
	tooltips, the new ones work on all widgets.


svn path=/trunk/; revision=24093
2007-11-09 11:17:00 +00:00
Sven Neumann
5d229df1f2 ported to Cairo drawing.
2007-11-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpblobeditor.c: ported to Cairo drawing.


svn path=/trunk/; revision=24073
2007-11-06 09:01:24 +00:00
Michael Natterer
36e1fa8d29 translate by 0.5,0.5 instead of adding 0.5 to all coordinates (we always
2007-11-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_expose): translate
	by 0.5,0.5 instead of adding 0.5 to all coordinates (we always
	want to draw on pixel centers here). Some cleanup.


svn path=/trunk/; revision=24072
2007-11-05 21:41:01 +00:00
Sven Neumann
b36f958a29 use Cairo to draw the controls.
2007-11-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.[ch]: use Cairo to draw the 
controls.


svn path=/trunk/; revision=24069
2007-11-05 20:11:16 +00:00
Sven Neumann
c197362e9d introduced macros to set a single pixel in a Cairo surface without having
2007-11-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcairo-utils.h: introduced macros to set a 
single
	pixel in a Cairo surface without having to worry about 
endianness.

	* app/widgets/gimpcairo-utils.c
	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererpalette.c: use the new macros.


svn path=/trunk/; revision=24065
2007-11-05 15:54:15 +00:00
Michael Natterer
f164d4bad3 port to Cairo.
2007-11-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcurveview.c (gimp_curve_view_expose): port to
	Cairo.


svn path=/trunk/; revision=24064
2007-11-05 15:21:04 +00:00
Michael Natterer
21b3675ea8 don't recalculate the curve if the data object is frozen. Recalculate on
2007-11-05  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcurve.[ch]: don't recalculate the curve if the data
	object is frozen. Recalculate on thaw instead. Made
	gimp_curve_calculate() private and emit some GimpData::dirty
	signals where appropriate.

	* app/tools/gimpcurvestool.c
	* app/widgets/gimpcurveview.c
	* tools/pdbgen/pdb/color.pdb: changed accodingly (connect to "dirty"
	instead of "notify" and added some freeze/thaw where approproate).

	* app/pdb/color_cmds.c: regenerated.


svn path=/trunk/; revision=24063
2007-11-05 10:02:20 +00:00
Michael Natterer
2d827be2f3 added event handling and completely edit the curve here.
2007-11-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcurveview.[ch]: added event handling and
	completely edit the curve here.

	* app/tools/gimpcurvestool.[ch]: remove all event handling and
	curve editing code and only listen to curve signals.


svn path=/trunk/; revision=24060
2007-11-05 08:59:09 +00:00
Sven Neumann
f6994c34f5 implement GimpViewRenderer::draw and draw the overlays with Cairo.
2007-11-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererbrush.c: implement
	GimpViewRenderer::draw and draw the overlays with Cairo.

	* app/widgets/gimpviewrenderer.[ch]
	* app/widgets/gimpviewrenderervectors.c: minor cleanups.


svn path=/trunk/; revision=24058
2007-11-04 20:30:38 +00:00
Sven Neumann
fa7e312a2c replaced the RGB buffer with a Cairo surface.
2007-11-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.[ch]: replaced the RGB buffer 
with
	a Cairo surface.

	* app/widgets/gimpviewrendererbuffer.c
	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimage.c
	* app/widgets/gimpviewrendererpalette.c
	* app/widgets/gimpviewrenderervectors.c: changed accordingly. 
There
	are some loose ends here that will be fixed over the next days.

	* app/widgets/gimprender.c: removed gimp_render_temp_buf; it is
	not any longer needed.

	* app/core/gimpgradient.c (gimp_gradient_get_preview_size): 
return
	an odd preview height to make the border align with the pixel 
grid.


svn path=/trunk/; revision=24056
2007-11-04 19:14:32 +00:00
Sven Neumann
8f377f2748 app/widgets/gimpgradienteditor.c use gdk_event_request_motions() to handle
2007-11-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpnavigationview.c: use
	gdk_event_request_motions() to handle motion hint events.


svn path=/trunk/; revision=24052
2007-11-04 13:12:04 +00:00
Michael Natterer
ae1f2eb2bc app/widgets/Makefile.am app/widgets/widgets-types.h new GimpHistogramView
2007-11-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcurveview.[ch]: new GimpHistogramView subclass
	which does all the curve stuff.

	* app/widgets/gimphistorgramview.[ch]: removed all curve code again.

	* app/tools/gimpcurvestool.c: changed accordingly.


svn path=/trunk/; revision=24051
2007-11-04 13:09:10 +00:00
Michael Natterer
6c64c64b07 added API to set the selected point.
2007-11-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogramview.[ch]: added API to set the
	selected point.

	* app/tools/gimpcurvestool.c: use it.


svn path=/trunk/; revision=24046
2007-11-02 17:08:42 +00:00
Michael Natterer
e5927feba1 added API to modify free-form curves and properties to listen to curve
2007-11-02  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcurve.[ch]: added API to modify free-form curves
	and properties to listen to curve changes.

	* app/widgets/gimphistogramview.[ch]: added everything that's
	needed for rendering a curve with all its color and cursor
	indicators on top of a histogram. This code will move to a
	subclass soon.

	* app/tools/gimpcurvestool.[ch]: removed all curve rendering here.
	Also removed all explicit updating by connecting to curve signals
	and updating in the callback.


svn path=/trunk/; revision=24045
2007-11-02 16:51:18 +00:00
Sven Neumann
b572dec957 moved function calls out of the loop
svn path=/trunk/; revision=24044
2007-11-02 13:44:15 +00:00
Sven Neumann
a8cc4b0f97 added utility function to create a Cairo surface from a GdkPixbuf.
2007-11-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcairo-utils.[ch]: added utility function to create
	a Cairo surface from a GdkPixbuf.

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_create_pattern):
	use it from here.

svn path=/trunk/; revision=24043
2007-11-02 13:39:52 +00:00
Sven Neumann
1edac75743 also use the color's alpha channel. Added gtk-doc documentation.
2007-11-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcairo-utils.c (gimp_cairo_set_source_color):
	also use the color's alpha channel. Added gtk-doc documentation.


svn path=/trunk/; revision=24040
2007-11-02 07:00:48 +00:00
Sven Neumann
734e02f121 app/widgets/Makefile.am new files holding Cairo utility functions.
2007-11-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-utils.[ch]: new files holding Cairo
	utility functions.

	* app/widgets/gimpviewrenderer.[ch]: ported partly to Cairo 
drawing.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpview.c: removed calls to
	gimp_view_renderer_unrealize() which are not needed anymore
	because we don't allocate a GC in the renderer any longer.

	* app/widgets/gimpcellrendererdashes.c: removed a redundant 
cast.


svn path=/trunk/; revision=24039
2007-11-01 23:37:00 +00:00
Sven Neumann
efb2eb16ea removed code that draws a diagonal line across a renderer without context.
2007-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_draw):
	removed code that draws a diagonal line across a renderer 
without
	context. Emit a warning instead; this shouldn't happen any 
longer.


svn path=/trunk/; revision=24038
2007-11-01 20:24:02 +00:00
Sven Neumann
b58562d511 draw using Cairo.
2007-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdasheditor.c (gimp_dash_editor_expose): draw
	using Cairo.


svn path=/trunk/; revision=24037
2007-11-01 19:51:22 +00:00
Sven Neumann
00e7711788 combined drawing into a single fill
svn path=/trunk/; revision=24036
2007-11-01 19:05:21 +00:00
Sven Neumann
2d01e5ba7f draw using Cairo.
2007-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcellrendererdashes.c
	(gimp_cell_renderer_dashes_render): draw using Cairo.


svn path=/trunk/; revision=24035
2007-11-01 19:02:38 +00:00
Michael Natterer
36bda892a9 libgimpbase/Makefile.am removed.
2007-10-31  Michael Natterer  <mitch@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/xdg-user-dir.[ch]: removed.

	* libgimpbase/gimpbaseenums.[ch]: deprecate enum GimpUserDirectory.

	* libgimpbase/gimpenv.[ch]: deprecate gimp_user_directory() and make
	the implementation call g_get_user_special_dir().

	* libgimp/Makefile.am: #undef GIMP_DISABLE_DEPRECATED in gimpenums.c

	* app/widgets/gimpfiledialog.c: use g_get_user_special_dir() instead.

	* plug-ins/pygimp/gimpmodule.c: #undef GIMP_DISABLE_DEPRECATED.


svn path=/trunk/; revision=24018
2007-10-31 13:09:46 +00:00
Sven Neumann
58e6c9ad4d close the file handle.
2007-10-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_text_buffer_load): close
	the file handle.


svn path=/trunk/; revision=23978
2007-10-27 20:34:32 +00:00
Sven Neumann
45361763c9 connect to GimpDrawable::update instead of
2007-10-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_layer_changed): connect to
	GimpDrawable::update instead of GimpViewable::invalidate-preview.

svn path=/trunk/; revision=23953
2007-10-26 08:16:25 +00:00
Sven Neumann
a5fa311290 removed a frame.
2007-10-17  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpselectionoptions.c: removed a frame.

	* app/tools/gimptransformoptions.c: tweaked layout to reduce
	horizontal extent.

	* app/widgets/gimpviewablebox.c (gradient_box_new): use an icon
	for the "Reverse" check button.

svn path=/trunk/; revision=23857
2007-10-17 14:36:12 +00:00
Sven Neumann
c1c7afb03a libgimp/gimppatternselectbutton.c libgimp/gimpbrushselectbutton.c
2007-10-16  Sven Neumann  <sven@gimp.org>

	* libgimp/gimppatternselectbutton.c
	* libgimp/gimpbrushselectbutton.c
	* libgimpwidgets/gimpcolorarea.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdockbook.c: set GDK_WINDOW_TYPE_HINT_DND on
	popup windows used to implement a DND cursor.

svn path=/trunk/; revision=23841
2007-10-16 13:56:34 +00:00
Michael Natterer
0a824ddba0 added parameter "gboolean property_is_pixel" which indicates that the
2007-10-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimppropwidgets.[ch] (gimp_prop_size_entry_new):
	added parameter "gboolean property_is_pixel" which indicates that
	the stored property value is always in pixels and not in the
	selected unit.

	* app/tools/gimptextoptions.c
	* app/widgets/gimpstrokeeditor.c: pass FALSE to keep the old
	behavior.

	* app/tools/gimprectangleoptions.c (gimp_rectangle_options_gui):
	added property "fixed-unit" which is used for all fixed values
	now. Perhaps we need separate units for width/height/size. Enable
	the unit menu on the "Width" and "Height" size entries of the
	"Fixed" section and configure them to store the value in
	pixels. This was the easy part, some other widgets still need unit
	support.

	* app/tools/gimprectangletool.c (gimp_rectangle_tool_start): set
	the image's resolution on the size entries changed above.


svn path=/trunk/; revision=23821
2007-10-14 18:51:58 +00:00
Michael Natterer
ab83cf1150 #include "gimp-intl.h"
2007-10-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorselectorpalette.c: #include "gimp-intl.h"


svn path=/trunk/; revision=23808
2007-10-12 10:19:54 +00:00
Sven Neumann
ace8b024b6 marked strings for translation (bug #485937).
2007-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorselectorpalette.c: 
	* plug-ins/twain/twain.c: marked strings for translation (bug #485937).

svn path=/trunk/; revision=23807
2007-10-12 09:10:06 +00:00
Sven Neumann
5a910a3a19 app/widgets/gimpcontrollerinfo.c formatting.
2007-10-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerinfo.c
	* app/widgets/gimpcontrollers.c: formatting.


svn path=/trunk/; revision=23790
2007-10-10 05:52:45 +00:00
Sven Neumann
be1aa48cac app/widgets/gimpactionview.c specify alternative button order for message
2007-10-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactionview.c
	* app/widgets/gimphelp.c: specify alternative button order for
	message dialogs.

	* app/dialogs/user-install-dialog.c: removed trailing 
whitespace.


svn path=/trunk/; revision=23771
2007-10-09 08:04:31 +00:00
Sven Neumann
1446520338 as some kind of workaround for bug #459518, show the fallback icon when
2007-10-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererimage.c
	(gimp_view_renderer_image_render): as some kind of workaround 
for
	bug #459518, show the fallback icon when rendering the preview 
for
	an invisible channel.


svn path=/trunk/; revision=23768
2007-10-08 20:13:58 +00:00
Sven Neumann
fd38d818d1 reverted the live update change from bug #451568. It causes breakage such
2007-10-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorpanel.[ch]: reverted the live update change
	from bug #451568. It causes breakage such as bug #484757.

svn path=/trunk/; revision=23762
2007-10-08 16:11:35 +00:00
Michael Natterer
6435c669b8 removed gimp_get_accel_string() and use gtk_accelerator_get_label()
2007-10-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: removed
	gimp_get_accel_string() and use gtk_accelerator_get_label()
	instead.

	* app/widgets/gimpactionview.c: ditto.


svn path=/trunk/; revision=23704
2007-10-01 13:10:40 +00:00
Sven Neumann
c9635dddec fixed check for modifier keys and always return on a matched event(bug
2007-09-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerwheel.c (gimp_controller_wheel_scroll):
	fixed check for modifier keys and always return on a matched
	event(bug #480319). Also reordered the list of events as the code
	does not any longer rely on a certain order.

svn path=/trunk/; revision=23657
2007-09-26 09:55:09 +00:00
Sven Neumann
5297f9bd3e left-align the image.
2007-09-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c (gimp_message_box_constructor):
	left-align the image.

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/templates-commands.c: use more meaningful stock
	icons for message dialogs.

svn path=/trunk/; revision=23651
2007-09-25 14:03:33 +00:00
Sven Neumann
501231ddd9 show the keyboard shortcut in brackets, as we do in other places.
2007-09-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_widget_accel_changed):
	show the keyboard shortcut in brackets, as we do in other places.

svn path=/trunk/; revision=23649
2007-09-25 11:12:56 +00:00
Sven Neumann
84409a2a7c avoid the crash reported in bug #470304.
2007-09-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptooloptionseditor.c
	(gimp_tool_options_editor_get_title): avoid the crash reported 
in
	bug #470304.


svn path=/trunk/; revision=23632
2007-09-23 19:09:37 +00:00
Sven Neumann
0370078297 added a load_proc member to GimpImage and getters and setters for it.
2007-09-20  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: added a load_proc member to GimpImage
	and getters and setters for it.

	* app/file/file-open.c (file_open_image): set the load 
procedure,
	but only if it hasn't been set already. Use the MIME type from 
the
	load procedure that is set on the image.

	* tools/pdbgen/pdb/fileops.pdb (file_load_invoker): set the load
	procedure. This causes it to be set when the URI plug-in calls
	gimp-file-load to load the image.

	* app/pdb/fileops_cmds.c: regenerated.

	* app/widgets/gimpimagepropview.c
	(gimp_image_prop_view_label_set_filetype): use the MIME type 
from
	the load procedure, in case that no save procedure is set.


svn path=/trunk/; revision=23597
2007-09-20 21:23:05 +00:00
Michael Natterer
26e11d5fc3 replaced HAVE_GDK_QUARTZ conditional by --disable-toolbox-menu configure
2007-09-18  Michael Natterer  <mitch@gimp.org>

	* configure.in: replaced HAVE_GDK_QUARTZ conditional by
	--disable-toolbox-menu configure switch which defaults to "yes"
	normally and to "no" on quartz.

	* app/widgets/gimptoolbox.c: changed #ifdef accordingly.

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-menu-path.[ch]: new generic machanism to map
	around menu locations. If ENABLE_TOOLBOX_MENU is false, map
	"Xtns" and "Help" from <Toolbox> to <Image>.

	* app/plug-in/gimppluginmanager-menu-branch.c
	* app/plug-in/gimppluginprocedure.c: run all menu paths through the
	new mapping function.

	* menus/Makefile.am
	* menus/menus.xsl
	* menus/image-menu.xml.in: add both the "Xtns" and "Help" menus to
	the image menubar if TOOLBOX_MENU is false.


svn path=/trunk/; revision=23581
2007-09-18 14:39:52 +00:00
Michael Natterer
534833b638 when DND-hovering > 500ms over a notebook tab, switch to that tab's page.
2007-09-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockbook.[ch]: when DND-hovering > 500ms over a
	notebook tab, switch to that tab's page. Suggested by Saul Goode.


svn path=/trunk/; revision=23573
2007-09-17 15:40:01 +00:00
Nils Philippsen
0691f94df6 app/file/file-save.[ch] (file_save) app/dialogs/file-save-dialog.c
* app/file/file-save.[ch] (file_save)
* app/dialogs/file-save-dialog.c (file_save_dialog_save_image)
* app/actions/file-commands.c (file_save_cmd_callback)
* app/widgets/gimpdnd-xds.c (gimp_dnd_xds_save_image): don't pass
Gimp instance to file_save() calls as it's not needed

svn path=/trunk/; revision=23528
2007-09-13 14:48:32 +00:00
Nils Philippsen
8ff9c4c84c drop own recently used files code in favour of GtkRecentManager:
* app/core/gimp-gui.c (gimp_recent_list_add_uri), app/core/gimp-gui.h,
app/gui/gui-vtable.c (gui_recent_list_add_uri): add
{gimp,gui}_recent_list_add_uri(), gui_recent_list_add_uri() dispatches to
GtkRecentManager

* app/dialogs/file-save-dialog.c (file_save_dialog_save_image),
app/actions/file-commands.c (file_save_cmd_callback),
app/widgets/gimpdnd-xds.c (gimp_dnd_xds_save_image): pass Gimp instance to
file_save() calls

* app/file/file-open.c (file_open_with_proc_and_display,
file_open_layers), app/file/file-save.c (file_save), app/file/file-save.h:
pass Gimp instance to gimp_recent_list_add_uri() calls

* app/file/gimprecentitem.c, app/file/gimprecentitem.h,
app/file/gimprecentlist.c, app/file/gimprecentlist.h: removed

* app/file/Makefile.am: drop reference to removed files

svn path=/trunk/; revision=23526
2007-09-13 14:19:30 +00:00
Sven Neumann
6c3fe663b0 corrected Pango version number in comment.
2007-09-13  Sven Neumann  <sven@gimp.org>

	* app/text/gimpfontlist.c (gimp_font_list_add_font): corrected
	Pango version number in comment.

	* app/widgets/gimpundoeditor.c (gimp_undo_editor_set_context):
	chain up after initializing the context. Fixes a warning about
	gimp_viewable_get_new_preview() being called with a NULL context.

svn path=/trunk/; revision=23523
2007-09-13 12:42:24 +00:00
Michael Natterer
c3f89cc7f0 Bring back our menus when building on OS X but not against the quartz GDK
2007-09-12  Michael Natterer  <mitch@gimp.org>

	Bring back our menus when building on OS X but not against the
	quartz GDK backend:

	* configure.in: added conditional HAVE_GDK_QUARTZ.

	* menus/Makefile.am: use it when moving the help menu around.

	* app/dialogs/preferences-dialog.c
	* app/display/gimpdisplayshell.c
	* app/gui/gtk-macmenu.c
	* app/gui/gui.c
	* app/widgets/gimptoolbox.c: use #ifdef GDK_WINDOWING_QUARTZ
	instead of #ifdef HAVE_CARBON when enabling the global menubar.


svn path=/trunk/; revision=23512
2007-09-12 16:26:04 +00:00
Michael Natterer
3736ea8284 First version of global menubar support for OSX. Work in progress.
2007-08-30  Michael Natterer  <mitch@gimp.org>

	First version of global menubar support for OSX. Work in progress.

	* app/gui/Makefile.am
	* app/gui/sync-menu.[ch]: new files containing code that takes
	a GtkMenuShell and proxies it in the OSX global menubar. Taken
	from http://developer.imendio.com/projects/gtk-macosx/menubar

	* app/gui/gui.c: put the global image popup menu to the menubar.

	* app/dialogs/preferences-dialog.c
	* app/display/gimpdisplayshell.c
	* app/widgets/gimptoolbox.c: #ifdef out all menubars in windows.

	* app/Makefile.am (AM_LDFLAGS): add $(CARBON_LDFLAGS)


svn path=/trunk/; revision=23408
2007-08-30 11:19:00 +00:00
Michael Natterer
da32f5a002 remove GimpPlugInDebug typedef.
2007-08-15  Michael Natterer  <mitch@gimp.org>

	* app/core/core-types.h: remove GimpPlugInDebug typedef.

	* app/plug-in/plug-in-types.h: added it here instead.

	* app/core/gimpchannel-combine.h
	* app/widgets/gimppropwidgets.[ch]: match parameter names
	in .c, .h and API docs to make gtk-doc happy.


svn path=/trunk/; revision=23275
2007-08-15 16:40:39 +00:00
Sven Neumann
7cdc24d69e libgimpwidgets/gimpcolorprofilecombobox.[ch]
2007-08-14  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcolorprofilecombobox.[ch]
	* libgimpwidgets/gimpcolorprofilestore.[ch]
	* libgimpwidgets/gimpcolorprofilestore-private.h: changed API to
	deal with filenames instead of URIs.

	* app/widgets/gimpprofilechooserdialog.[ch]: same here.

	* app/dialogs/preferences-dialog.c
	* plug-ins/common/lcms.c: changed accordingly.


svn path=/trunk/; revision=23260
2007-08-14 22:12:37 +00:00
Sven Neumann
f3675a45ad libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgets.h
2007-08-14  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcolorprofilecombobox.[ch]
	* libgimpwidgets/gimpcolorprofilestore.[ch]
	* libgimpwidgets/gimpcolorprofilestore-private.h: new widget to
	select color profiles.

	* libgimpwidgets/gimpwidgets.def: updated.

	* app/widgets/gimpprofilechooserdialog.[ch]: remember the name of
	the last previewed profile.

	* app/dialogs/preferences-dialog.c: use the new color profile
	combo-box.

	* plug-ins/common/lcms.c: use the new color profile combo-box.

svn path=/trunk/; revision=23253
2007-08-14 16:01:04 +00:00
Michael Natterer
0d17856e58 libgimpbase/gimpbaseenums.[ch] changed enum GimpUserDirectory and API of
2007-08-11  Michael Natterer  <mitch@gimp.org>

	* libgimpbase/gimpbaseenums.[ch]
	* libgimpbase/gimpenv.[ch]: changed enum GimpUserDirectory and API
	of gimp_user_directory() so that g_get_user_special_dir() can be
	used instead as soon as we depend on GLib 2.14.

	* tools/pdbgen/enums.pl: regenerated.

	* app/widgets/gimpfiledialog.c
	* plug-ins/pygimp/gimpmodule.c: changed accordingly.


svn path=/trunk/; revision=23212
2007-08-11 17:15:52 +00:00
Sven Neumann
cd92f46891 pass the maximum value double and draw the histogram one pixel less high.
2007-08-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogramview.c 
(gimp_histogram_view_draw_spike):
	pass the maximum value double and draw the histogram one pixel 
less
	high. Fixes bug #465669.


svn path=/trunk/; revision=23208
2007-08-11 15:27:11 +00:00
Martin Nordholts
113f932ae0 Only set config user override property when it changed, to avoid deadlock.
2007-08-11  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimppropwidgets.c
	(gimp_prop_number_pair_entry_number_pair_user_override_notify):
	Only set config user override property when it changed, to avoid
	deadlock.

svn path=/trunk/; revision=23200
2007-08-11 07:56:18 +00:00
Martin Nordholts
0f0a52a301 Fixed bug where property notifications were checked againts hardcoded
2007-08-10  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimppropwidgets.c
	(gimp_prop_number_pair_entry_config_notify): Fixed bug where
	property notifications were checked againts hardcoded property
	names instead of the ones configured to the
	GimpPropNumberPairEntryData object.

svn path=/trunk/; revision=23191
2007-08-10 15:59:26 +00:00
Martin Nordholts
49df5ada5b Added "default-aspect-numerator", "default-aspect-denominator",
2007-08-10  Martin Nordholts  <martinn@svn.gnome.org>

	* app/tools/gimprectangleoptions.c: Added
	"default-aspect-numerator", "default-aspect-denominator",
	"default-fixed-size-width" and "default-fixed-size-height" as
	non-serialized tool options, and "overridden-fixed-aspect" and
	"overridden-fixed-size" as serialized ones.

	* app/widgets/gimppropwidgets.c (gimp_prop_number_pair_entry_*):
	Added support for the new GimpRectangleOptions.

svn path=/trunk/; revision=23187
2007-08-10 14:57:27 +00:00
Martin Nordholts
a8907b94be Merged gimp_prop_size_2d_* and gimp_prop_aspect_ratio_* to
2007-08-10  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimppropwidgets.[ch]: Merged gimp_prop_size_2d_* and
	gimp_prop_aspect_ratio_* to gimp_prop_number_pair_*.

	* app/tools/gimprectangleoptions.c (gimp_rectangle_options_gui):
	Use the merged gimp_prop_number_pair_entry_new.

svn path=/trunk/; revision=23184
2007-08-10 10:52:35 +00:00
Sven Neumann
4c10b41b37 minor cleanup.
2007-08-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): minor
	cleanup.

svn path=/trunk/; revision=23180
2007-08-10 08:27:11 +00:00
Martin Nordholts
93d4dc68de Renamed GimpRatioEntry to GimpNumberPairEntry, and generalized the code a
2007-08-08  Martin Nordholts  <martinn@svn.gnome.org>

	Renamed GimpRatioEntry to GimpNumberPairEntry, and generalized the
	code a lot, so that it can be used both for 'Fixed: Aspect ratio'
	and 'Fixed: Size'. Support is also added for having default values
	and a 'user overrided' value mode.

	* libgimpwidgets/gimpnumberpairentry.[ch]: Now contains the
	rewrite and generalization of GimpRatioEntry.
	(gimp_number_pair_entry_get_type)
	(gimp_number_pair_entry_new)
        (gimp_number_pair_entry_set_default_values)
	(gimp_number_pair_entry_set_values)
        (gimp_number_pair_entry_get_values): New libgimpwidget API.

	* app/widgets/gimppropwidgets.[ch] (gimp_prop_size_2d_new): Added
	new helper widget for setting up a GimpNumberPairEntry for the
	Fixed: Size entry in the Rectangle Options.

	* app/tools/gimprectangleoptions.c (gimp_rectangle_options_gui):
	Use the new gimp_prop_size_2d_entry for the Fixed: Size entry.

	* libgimpwidgets/gimpwidgets.def: Removed gimp_ratio_entry_* and
	added gimp_number_pair_entry_*.

	* libgimpwidgets/gimpwidgets.h * libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/Makefile.am (libgimpwidgets_2_0_la_sources)
	(libgimpwidgetsinclude_HEADERS): Updated accordingly.

svn path=/trunk/; revision=23154
2007-08-08 18:08:24 +00:00
Sven Neumann
46fc994030 use a text view in a scrolled window for the preview area.
2007-08-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprofilechooserdialog.[ch]: use a text view in a
	scrolled window for the preview area.

svn path=/trunk/; revision=23152
2007-08-08 14:33:03 +00:00
Sven Neumann
6213c7ab19 added buttons to unset the color profiles.
2007-08-08  Sven Neumann  <sven@gimp.org>

	* app/dialogs/preferences-dialog.c: added buttons to unset the
	color profiles.

	* app/widgets/gimppropwidgets.c
	* libgimpwidgets/gimppropwidgets.c: minor cleanup.

svn path=/trunk/; revision=23145
2007-08-08 09:56:51 +00:00
Martin Nordholts
d050042232 Remove fixed_aspect_property.
2007-08-08  Martin Nordholts  <martinn@svn.gnome.org>

	* app/widgets/gimppropwidgets.[ch]
	(gimp_prop_aspect_ratio_new)
	(gimp_prop_aspect_ratio_changed): Remove fixed_aspect_property.

	* app/tools/gimprectangleoptions.c (gimp_rectangle_options_gui):
	Changed accordingly.

svn path=/trunk/; revision=23141
2007-08-08 06:32:45 +00:00
Sven Neumann
900f54e69f as a workaround for bug #360106, set a timeout that presents the dialog
2007-08-07  Sven Neumann  <sven@gimp.org>

	* app/gui/gui-vtable.c (gui_pdb_dialog_new): as a workaround for
	bug #360106, set a timeout that presents the dialog window.

	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property):
	formatting.

svn path=/trunk/; revision=23133
2007-08-07 13:15:47 +00:00
Sven Neumann
a737408eeb added GimpColorConfig and GimpColorManaged as construct-only properties.
2007-08-06  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcolordisplay.[ch]: added GimpColorConfig 
and
	GimpColorManaged as construct-only properties.
	Deprecated gimp_color_display_new().

	* libgimpwidgets/gimpwidgets.def: updated for new symbols.

	* app/widgets/gimpcolordisplayeditor.c: use g_object_new() 
instead
	of gimp_color_display_new().

	* modules/cdisplay_lcms.c: use the image's embedded color 
profile
	for the display filter. Assume sRGB if no monitor profile is
	configured.

	* app/display/gimpdisplayshell.c: 
	* app/display/gimpdisplayshell-filter.[ch]: pass the display as
	color-managed object to the display filter.


svn path=/trunk/; revision=23127
2007-08-06 22:10:09 +00:00
Hans Breuer
024ef60a49 updated msvc build
2007-08-05  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc app/gimpcore.def : updated msvc build


svn path=/trunk/; revision=23118
2007-08-05 15:16:02 +00:00
Michael Natterer
26edfdec1a no need to set the tool cursor here, we already do that in init() and
2007-08-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c (gimp_crop_tool_cursor_update): no need
	to set the tool cursor here, we already do that in init() and
	never change it.

	* app/widgets/gimpcursor.c (gimp_cursor_new): don't show the move
	cursor and the move modifier at the same time. Some small
	cleanups.


svn path=/trunk/; revision=23104
2007-08-02 13:33:38 +00:00
Sven Neumann
faed28c054 don't leak the GtkTreePath.
2007-07-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolview.c (gimp_tool_view_eye_clicked): don't
	leak the GtkTreePath.

svn path=/trunk/; revision=23082
2007-07-31 12:49:36 +00:00
Sven Neumann
7963f0fc30 added convenience function gimp_action_group_activate_action().
2007-07-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.[ch]: added convenience function
	gimp_action_group_activate_action().

svn path=/trunk/; revision=22973
2007-07-23 13:01:55 +00:00
Sven Neumann
a5d10b2ff0 renamed gimp_image_active_drawable() to gimp_image_get_active_drawable().
2007-07-19  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: renamed gimp_image_active_drawable() to
	gimp_image_get_active_drawable().

	* app/[lots of files]
	* tools/pdbgen/pdb/paths.pdb
	* tools/pdbgen/pdb/image.pdb: changed accordingly.

svn path=/trunk/; revision=22958
2007-07-19 14:59:51 +00:00
Sven Neumann
ca8bac4c0c gracefully deal with empty colormaps.
2007-07-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.c: gracefully deal with empty
	colormaps.

svn path=/trunk/; revision=22946
2007-07-17 16:32:18 +00:00
Sven Neumann
83898a0cf8 unref the context.
2007-07-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmenudock.c (gimp_menu_dock_new): unref the context.

svn path=/trunk/; revision=22942
2007-07-17 10:55:21 +00:00
Michael Natterer
78be6549f1 renamed action "selection-editor-popup" to "selection-popup". Fixes bug
2007-07-08  Michael Natterer  <mitch@gimp.org>

	* app/actions/select-actions.c (select_actions): renamed action
	"selection-editor-popup" to "selection-popup". Fixes bug #454364.

	* app/widgets/gimpdockable.c (gimp_dockable_show_menu): warn when
	above bug happens instead of failing silently.


svn path=/trunk/; revision=22894
2007-07-08 12:23:44 +00:00
Sven Neumann
b7c967a9de removed debug output. (gimp_container_tree_view_clear_items)
2007-07-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_name_canceled): removed debug output.
	(gimp_container_tree_view_clear_items)
	(gimp_container_tree_view_remove_item): removed warning; the bug
	this warning referred to has been closed as WONTFIX.

svn path=/trunk/; revision=22889
2007-07-06 14:33:52 +00:00
Sven Neumann
5a41fd121a don't count the number of repeated messages when the error messages are
2007-07-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.c (gimp_error_dialog_add): don't
	count the number of repeated messages when the error messages are
	being redirected to stderr already.

svn path=/trunk/; revision=22876
2007-07-05 15:39:22 +00:00
Sven Neumann
8f17d458dc fixed spelling error.
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagecommenteditor.[ch]: fixed spelling error.

	* app/widgets/gimpcolorpanel.[ch]: applied slightly modified patch
	from Tor Lillqvist that changes the ColorPanel to provide live
	updates (bug #451568).

svn path=/trunk/; revision=22850
2007-06-27 11:54:41 +00:00
Sven Neumann
c8102e617a use GTK_STOCK_PROPERTIES instead of GTK_STOCK_EDIT.
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerlist.c (gimp_controller_list_init):
	use GTK_STOCK_PROPERTIES instead of GTK_STOCK_EDIT.

svn path=/trunk/; revision=22849
2007-06-27 10:50:29 +00:00
Sven Neumann
12813eb1cd show the full filename instead of the basename and ellipsize it. The
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagepropview.c: show the full filename instead
	of the basename and ellipsize it. The tooltip was too hard to
	discover.

svn path=/trunk/; revision=22847
2007-06-27 10:07:07 +00:00
Sven Neumann
718ca7c790 app/widgets/Makefile.am app/widgets/widgets-types.h new widget derived
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagecommenteditor.[ch]: new widget derived from
	GimpImageParasiteView. Basically the code that used to live in
	image-properties-dialog.c.

	* app/dialogs/image-properties-dialog.c: use the comment editor.

svn path=/trunk/; revision=22846
2007-06-27 09:46:00 +00:00
Sven Neumann
02b3fcea43 allow to edit the comment.
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/dialogs/image-properties-dialog.c: allow to edit the comment.

	* app/widgets/gimpimageprofileview.c: enable line wrapping.

svn path=/trunk/; revision=22845
2007-06-27 09:06:32 +00:00
Sven Neumann
6a61d33aea app/dialogs/image-properties-dialog.c added margins to text views.
2007-06-26  Sven Neumann  <sven@gimp.org>

	* app/dialogs/image-properties-dialog.c
	* app/widgets/gimpimageprofileview.c: added margins to text 
views.


svn path=/trunk/; revision=22841
2007-06-26 22:09:43 +00:00
Michael Natterer
d8c632cb93 Invalidate the image preview after the projection is completely
2007-06-26  Michael Natterer  <mitch@gimp.org>

	Invalidate the image preview after the projection is
	completely constructed. Fixes bug #449141.

	* app/core/gimpmarshal.list: add VOID:BOOLEAN

	* app/core/gimpimage.[ch]: add boolean parameter
	invalidate_preview to the "flush" signal.

	* app/core/gimpprojection.[ch]: add boolean member
	invalidate_preview to the GimpProjection struct. Set it to TRUE if
	it was TRUE in the image's "flush" signal. When the projection is
	completely constructed after a flush, invalidate the image's
	preview.

	* app/display/gimpdisplay-handlers.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpimagedock.c
	* app/widgets/gimpimageeditor.c: changed callback signatures
	accordingly.


svn path=/trunk/; revision=22840
2007-06-26 21:39:51 +00:00
Sven Neumann
48738dbbdd use the name if the description is empty.
2007-06-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimageprofileview.c 
(gimp_image_profile_view_query):
	use the name if the description is empty.


svn path=/trunk/; revision=22839
2007-06-26 20:16:43 +00:00
Sven Neumann
bb4b805243 app/dialogs/image-properties-dialog.c show comment and color profile in
2007-06-26  Sven Neumann  <sven@gimp.org>

	* app/dialogs/image-properties-dialog.c
	* app/widgets/gimpimageprofileview.[ch]: show comment and color
	profile in text views instead of using labels. Deals much better
	with longer texts.

svn path=/trunk/; revision=22837
2007-06-26 15:07:58 +00:00
Sven Neumann
fd19774c3f set the full name as tooltip.
2007-06-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagepropview.c
	(gimp_image_prop_view_label_set_filename): set the full name as
	tooltip.


svn path=/trunk/; revision=22835
2007-06-26 07:22:54 +00:00
Sven Neumann
09578ea070 removed extra check for gthread and fold it into the GLIB and GTK checks.
2007-06-25  Sven Neumann  <sven@gimp.org>

	* configure.in: removed extra check for gthread and fold it into
	the GLIB and GTK checks.

	* */Makefile.am: changed accordingly.

	* app/main.c (main): always call g_thread_init().

svn path=/trunk/; revision=22832
2007-06-25 12:41:59 +00:00
Sven Neumann
13e518b138 initialize width and height to zero. Fixes bug #446005.
2007-06-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.c (gimp_view_renderer_init):
	initialize width and height to zero. Fixes bug #446005.


svn path=/trunk/; revision=22757
2007-06-11 20:01:54 +00:00
Sven Neumann
54caf4fbd4 don't disable image previews when layer previews are disabled. We do not
2007-06-11  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-preview.c: don't disable image previews 
when
	layer previews are disabled. We do not any longer create the 
image
	preview from the layer previews.

	* app/core/gimpimagefile.c
	* app/widgets/gimpthumbbox.c
	* tools/pdbgen/pdb/image.pdb: thumbnail rendering is not any
	longer disabled if layer previews are turned off.

	* app/config/gimprc-blurbs.h (THUMBNAIL_SIZE_BLURB): removed 
note
	that has become invalid by the change above.

	* app/core/gimpitem-preview.c: cosmetics.

	* app/pdb/image_cmds.c: regenerated.


svn path=/trunk/; revision=22756
2007-06-11 19:26:31 +00:00
Sven Neumann
65385a4781 added gimp_image_resize_to_selection().
2007-06-09  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-resize.[ch]: added
	gimp_image_resize_to_selection().

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: added an action and a menu item for 
it.
	Fixes bug #335672.

	* plug-ins/common/align_layers.c: resolved a conflicting 
mnemonic.


svn path=/trunk/; revision=22749
2007-06-09 17:17:30 +00:00
Sven Neumann
3ce8d74b14 #define GIMP_VIEWABLE_PRIORITY_IDLE, which is even lower than
2007-06-08  Sven Neumann  <sven@gimp.org>

	* app/core/gimpviewable.h: #define GIMP_VIEWABLE_PRIORITY_IDLE,
	which is even lower than G_PRIORITY_LOW.

	* app/core/gimpundo.c
	* app/widgets/gimpviewrenderer.c: create previews with
	GIMP_VIEWABLE_PRIORITY_IDLE so that they are run after the
	projection has been invalidated.


svn path=/trunk/; revision=22743
2007-06-07 23:05:02 +00:00
Sven Neumann
f322854007 app/text/Makefile.am app/core/Makefile.am app/tools/Makefile.am
2007-06-07  Sven Neumann  <sven@gimp.org>

	* app/text/Makefile.am
	* app/core/Makefile.am
	* app/tools/Makefile.am
	* app/display/Makefile.am
	* app/widgets/Makefile.am
	* app/base/Makefile.am
	* app/paint/Makefile.am
	* app/plug-in/Makefile.am
	* libgimp/Makefile.am
	* libgimpthumb/Makefile.am
	* tools/pdbgen/Makefile.am
	* libgimpwidgets/Makefile.am: applied the remaining parts of the
	patch from Daniel Richard G. to fix out-of-source-tree builds
	(bug #444960).

svn path=/trunk/; revision=22735
2007-06-07 13:19:44 +00:00
Michael Natterer
3fef65025a app/display/gimpdisplayshell-dnd.c app/widgets/gimpitemtreeview.c set the
2007-06-02  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpchanneltreeview.c: set the "linked" property of
	newly dropped items to FALSE.

	* app/widgets/gimptoolbox-dnd.c (gimp_toolbox_drop_drawable):
	stylistic cleanup.


svn path=/trunk/; revision=22693
2007-06-02 11:45:54 +00:00
Michael Natterer
6ef6576ab3 set "linked" and "lock-alpha" to FALSE too.
2007-05-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox-dnd.c (gimp_toolbox_drop_drawable): set
	"linked" and "lock-alpha" to FALSE too.


svn path=/trunk/; revision=22649
2007-05-29 09:12:42 +00:00
Michael Natterer
18d586fb1d also set the mode of the new layer to NORMAL and its opacity to OPAQUE.
2007-05-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox-dnd.c (gimp_toolbox_drop_drawable): also
	set the mode of the new layer to NORMAL and its opacity to OPAQUE.


svn path=/trunk/; revision=22647
2007-05-29 09:03:16 +00:00
Michael Natterer
11f6b6d005 app/display/gimpdisplayshell-dnd.c make drop-duplicated drawables visible
2007-05-29  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimptoolbox-dnd.c: make drop-duplicated drawables
	visible before adding them to the image. Spotted by Jimmac.


svn path=/trunk/; revision=22645
2007-05-28 23:44:38 +00:00
Michael Natterer
53f70a7eea derive from GtkWidget instead of GtkDrawingArea so we save a GdkWindow and
2007-05-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfgbgview.[ch]: derive from GtkWidget instead of
	GtkDrawingArea so we save a GdkWindow and render on the correct
	background color also for inactive notebook tabs.


svn path=/trunk/; revision=22641
2007-05-28 14:08:15 +00:00
Michael Natterer
65ef13729f new utility function which returns the neighbor of a container's active
2007-05-27  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-utils.[ch] (gimp_container_get_neighbor_of_active):
	new utility function which returns the neighbor of a container's
	active item.

	* app/widgets/gimpcontainerview-utils.[ch]
	(gimp_container_view_remove_active): remove a container view's
	active item, using above function to select its neighbor.

	* app/actions/data-commands.c
	* app/actions/buffers-commands.c
	* app/actions/documents-commands.c
	* app/actions/templates-commands.c: use above functions to select
	reasonable items when deleting from a list (instead of always
	jumping to the first item).



svn path=/trunk/; revision=22632
2007-05-27 15:13:45 +00:00
Sven Neumann
1dd7562dcd removed unused struct member.
2007-05-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.c (GimpSizeBoxPrivate): removed unused
	struct member.


svn path=/trunk/; revision=22630
2007-05-26 20:11:58 +00:00
Michael Natterer
1a5cfac5e6 app/widgets/gimpsessioninfoaux.[ch] app/widgets/gimpsessioninfobook.[ch]
2007-05-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfoaux.[ch]
	* app/widgets/gimpsessioninfobook.[ch]
	* app/widgets/gimpsessioninfodock.[ch]
	* app/widgets/gimpsessioninfodockable.[ch]: renamed these...

	* app/widgets/gimpsessioninfo-aux.[ch]
	* app/widgets/gimpsessioninfo-book.[ch]
	* app/widgets/gimpsessioninfo-dock.[ch]
	* app/widgets/gimpsessioninfo-dockable.[ch]: ...to these.

	* app/widgets/Makefile.am
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdocked.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpsessioninfo.c: changed accordingly.


svn path=/trunk/; revision=22614
2007-05-25 11:42:28 +00:00
Michael Natterer
736b651d24 app/widgets/gimpsessioninfo.[ch] app/widgets/gimpsessioninfoaux.[ch]
2007-05-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]
	* app/widgets/gimpsessioninfoaux.[ch]
	* app/widgets/gimpsessioninfobook.[ch]
	* app/widgets/gimpsessioninfodock.c
	* app/widgets/gimpsessioninfodockable.[ch]: cleanup.


svn path=/trunk/; revision=22606
2007-05-24 20:42:56 +00:00
Michael Natterer
2bf21338a3 removed more code and cleaned up the API.
2007-05-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]: removed more code and cleaned
	up the API.

	* app/widgets/Makefile.am
	* app/widgets/gimpsessioninfodock.[ch]: added the removed code here.

	* app/widgets/gimpdialogfactory.c: changed accordingly.


svn path=/trunk/; revision=22604
2007-05-24 20:06:34 +00:00
Michael Natterer
616ba659f3 removed lots of code...
2007-05-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]: removed lots of code...

	* app/widgets/Makefile.am
	* app/widgets/gimpsessioninfoaux.[ch]
	* app/widgets/gimpsessioninfobook.[ch]
	* app/widgets/gimpsessioninfodockable.[ch]: ...and added it here.
	Also allocate all structs using GSLice.

	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdocked.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppaletteeditor.c: changed accordingly.


svn path=/trunk/; revision=22603
2007-05-24 19:22:06 +00:00
Sven Neumann
c7bffbceaa app/dialogs/tips-parser.c app/display/gimpdisplayshell-autoscroll.c
2007-05-23  Sven Neumann  <sven@gimp.org>

	* app/dialogs/tips-parser.c
	* app/display/gimpdisplayshell-autoscroll.c
	* app/menus/plug-in-menus.c
	* app/plug-in/gimpenvirontable.c
	* app/plug-in/gimpinterpreterdb.c
	* app/plug-in/gimpplugindebug.c
	* app/plug-in/gimppluginshm.c
	* app/text/gimptextundo.c: allocate structs using GSlice

	* app/widgets/gimpselectiondata.c 
(gimp_selection_data_set_color):
	stack allocate tempory data.


svn path=/trunk/; revision=22588
2007-05-23 08:57:53 +00:00
Sven Neumann
17f8ab01e6 app/widgets/gimpclipboard.c app/widgets/gimpcontainerview.c allocate
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c
	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpdialogfactory.c: allocate structs using 
GSlice.


svn path=/trunk/; revision=22582
2007-05-22 18:08:42 +00:00
Sven Neumann
16054d8293 use GSlice to allocate struct.
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactionview.c: use GSlice to allocate struct.

svn path=/trunk/; revision=22576
2007-05-22 16:55:08 +00:00
Sven Neumann
b3d3f4f291 app/widgets/gimpcontrollers.c app/widgets/gimpdevices.c
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollers.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpeditor.c: allocate structs using GSlice.

svn path=/trunk/; revision=22575
2007-05-22 16:18:32 +00:00
Sven Neumann
9b5679547c app/widgets/gimpmenufactory.c allocate structs using GSlice.
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmenufactory.c
	* app/widgets/gimpactionfactory.c: allocate structs using GSlice.

svn path=/trunk/; revision=22574
2007-05-22 16:01:18 +00:00
Sven Neumann
56b52c047b use GSlice and plugged a memleak.
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_aspect_ratio_new):
	use GSlice and plugged a memleak.

svn path=/trunk/; revision=22573
2007-05-22 15:24:49 +00:00
Sven Neumann
af350d89e6 app/widgets/gimphelp.c app/widgets/gimpuimanager.c
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpview-popup.c
	* app/widgets/gtkwrapbox.c: use GSlice to allocate structs.

svn path=/trunk/; revision=22572
2007-05-22 15:14:41 +00:00
Sven Neumann
b8fe16c193 app/widgets/gtkvwrapbox.c use GSlice to allocate structs.
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gtkvwrapbox.c
	* app/widgets/gtkhwrapbox.c: use GSlice to allocate structs.

svn path=/trunk/; revision=22570
2007-05-22 14:57:21 +00:00
Michael Natterer
ada79e533a app/actions/data-commands.c app/base/boundary.c app/base/gimphistogram.c
2007-05-22  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c
	* app/base/boundary.c
	* app/base/gimphistogram.c
	* app/base/gimplut.c
	* app/base/temp-buf.c
	* app/core/gimpcontainer.c
	* app/core/gimpgradient.c
	* app/core/gimpparamspecs.c
	* app/core/gimpundo.c
	* app/plug-in/gimpplugin-cleanup.c
	* app/plug-in/gimppluginmanager-data.c
	* app/plug-in/gimppluginmanager-help-domain.c
	* app/plug-in/gimppluginmanager-locale-domain.c
	* app/plug-in/gimppluginmanager-menu-branch.c
	* app/plug-in/gimppluginprocframe.c
	* app/vectors/gimpanchor.c
	* app/widgets/gimpsessioninfo.c: use GSlice instead of g_new/g_free
	for structs of fixed size.


svn path=/trunk/; revision=22558
2007-05-22 10:43:48 +00:00
Sven Neumann
957db416e8 process updates.
2007-05-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprogressbox.c (gimp_progress_box_progress_start)
	(gimp_progress_box_progress_set_text): process updates.

svn path=/trunk/; revision=22557
2007-05-22 10:07:36 +00:00
Sven Neumann
9b369d8f6b documentation.
2007-05-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimp.c (gimp_message): documentation.

	* app/actions/documents-commands.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass parent widgets to gimp_message().

svn path=/trunk/; revision=22552
2007-05-21 16:32:52 +00:00
Michael Natterer
5462aa56a8 app/widgets/gimpcontainercombobox.c app/widgets/gimpcontainerentry.c
2007-05-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainerentry.c
	* app/widgets/gimpcontainertreeview.c: manage GtkTreeIters with
	gtk_tree_iter_copy/gtk_tree_iter_free instead of g_new/g_free.


svn path=/trunk/; revision=22541
2007-05-20 11:47:27 +00:00
Sven Neumann
50ce4e92f6 unset show-border.
2007-05-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_init): unset 
show-border.

	* app/widgets/gimpdockable.c (gimp_dockable_expose_event): don't
	paint the extension; reduces visual clutter.


svn path=/trunk/; revision=22526
2007-05-17 14:09:50 +00:00
Sven Neumann
af3a03ce95 removed period from tooltip.
2007-05-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockseparator.c: removed period from tooltip.


svn path=/trunk/; revision=22524
2007-05-17 13:23:42 +00:00
Sven Neumann
ba10d7be7b app/dialogs/preferences-dialog.c removed frames to reduce visual clutter.
2007-05-17  Sven Neumann  <sven@gimp.org>

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimptoolbox.c: removed frames to reduce visual 
clutter.

	* app/widgets/gimptoolbox-indicator-area.c: draw with borders.

svn path=/trunk/; revision=22523
2007-05-17 13:07:52 +00:00
Michael Natterer
8de797e0fa app/widgets/gimpthumbbox.c libgimp/gimpprogressbar.c use Gtk functions to
2007-05-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c
	* libgimp/gimpprogressbar.c
	* plug-ins/script-fu/script-fu-interface.c: use Gtk functions to
	manually iterate the main loop because they release the Gdk lock
	correctly around calling the GLib main loop functions.


svn path=/trunk/; revision=22516
2007-05-16 20:19:31 +00:00
Sven Neumann
484506176a apply sensitivity state to the Cancel button as well.
2007-05-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	apply sensitivity state to the Cancel button as well.
	(gimp_file_dialog_progress_start): make the Cancel button sensitive
	if the progress is cancelable.

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_progress_start): if
	embedded in a GimpFileDialog, make its Cancel button sensitive if
	the progress is cancelable

svn path=/trunk/; revision=22506
2007-05-16 08:21:35 +00:00
Sven Neumann
c3d4b181fd improved last night's hack
svn path=/trunk/; revision=22504
2007-05-16 06:39:15 +00:00
Sven Neumann
fbe369c85d combined the two progress bars (when loading multiple thumbnails) into a
2007-05-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.[ch]: combined the two progress bars
	(when loading multiple thumbnails) into a single one using a
	GimpSubProgress.


svn path=/trunk/; revision=22503
2007-05-15 22:58:37 +00:00
Sven Neumann
8d0e00d43f add a shortcut to the user's Pictures folder.
2007-05-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): add a
	shortcut to the user's Pictures folder.

	* libgimpbase/xdg-user-dir.c: cosmetic changes.


svn path=/trunk/; revision=22478
2007-05-13 17:18:35 +00:00
Sven Neumann
cc2a076df5 app/file/Makefile.am app/file/file-procedure.[ch] split functions dealing
2007-05-11  Sven Neumann  <sven@gimp.org>

        * app/file/Makefile.am
        * app/file/file-procedure.[ch]
        * app/file/file-utils.[ch]: split functions dealing with file
        procedures into their own file and renamed them.

        * app/file/file-open.c
        * app/dialogs/file-save-dialog.c
        * app/actions/file-commands.c
        * app/widgets/gimpthumbbox.c
        * app/widgets/gimpdnd-xds.c
        * app/widgets/gimpimagepropview.c
        * tools/pdbgen/pdb/fileops.pdb: changed accordingly

        * app/pdb/fileops_cmds.c: regenerated.


svn path=/trunk/; revision=22474
2007-05-11 18:50:35 +00:00
Sven Neumann
ed3ec54e93 use GtkWindow::transient-for just for the fun of using another GTK+ 2.10
2007-05-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptexteditor.c: use GtkWindow::transient-for just
	for the fun of using another GTK+ 2.10 feature.

svn path=/trunk/; revision=22454
2007-05-08 16:32:30 +00:00
Sven Neumann
cb9fb9f190 hide the Index label if the color index is -1 (happens with
2007-05-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): hide the
	Index label if the color index is -1 (happens with sample_average).

svn path=/trunk/; revision=22387
2007-05-03 09:26:06 +00:00
Sven Neumann
efb221acc7 app/widgets/gimpclipboard.c app/widgets/gimpdnd-xds.c use
2007-04-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c
	* app/widgets/gimpdnd-xds.c
	* plug-ins/helpbrowser/dialog.c: use 
gdk_atom_intern_static_string().


svn path=/trunk/; revision=22360
2007-04-28 10:11:37 +00:00
Sven Neumann
31ca80fd17 app/widgets/dbus-service.xml use "uri" instead of "filename" in the D-Bus
2007-04-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/dbus-service.xml
	* app/widgets/gimpdbusservice.[ch]: use "uri" instead of 
"filename"
	in the D-Bus methods.


svn path=/trunk/; revision=22298
2007-04-21 18:09:16 +00:00
Sven Neumann
49b8176aa5 Allow other applications to open images in GIMP as if they were new images
2007-04-17  Sven Neumann  <sven@gimp.org>

	Allow other applications to open images in GIMP as if they were
	new images (without associating a filename). Fixes bug #423118.

	* app/file/file-open.[ch]: added parameter 'as_new' to
	file_open_image() and its variants.

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptoolbox-dnd.c: changed accordingly.

	* app/app.[ch]
	* app/main.c: added new command-line option '--as-new'.

	* app/widgets/gimpdbusservice.[ch]
	* app/widgets/dbus-service.xml: added new method "OpenAsNew" to the
	D-Bus interface.

	* docs/gimp.1.in: document the new command-line option.


svn path=/trunk/; revision=22264
2007-04-17 15:54:01 +00:00
Michael Natterer
dfd1309b19 app/widgets/Makefile.am app/widgets/widgets-types.h remove
2007-04-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: remove GimpCellRenererAccel.

	* app/widgets/gimpactionview.c: use GtkCellRendererAccel instead.
	If an action has no label, use its name as label. Always show the
	"Name" column because there are too many actions with confusingly
	similar names.


svn path=/trunk/; revision=22256
2007-04-16 13:43:31 +00:00
Sven Neumann
c68c91c94d app/tools/gimplevelstool.c app/tools/gimpcurvestool.c app/xcf/xcf-save.c
2007-04-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c
	* app/tools/gimpcurvestool.c
	* app/xcf/xcf-save.c
	* app/xcf/xcf-load.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcolorframe.c: get rid of compiler warnings about
	dereferencing type-punned pointers.


svn path=/trunk/; revision=22238
2007-04-12 14:48:04 +00:00
Michael Natterer
6e422b5211 Statusbar messages shouldn't depend on the emission of unrelated signals:
2007-03-31  Michael Natterer  <mitch@gimp.org>

	Statusbar messages shouldn't depend on the emission of unrelated
	signals:

	* app/widgets/gimpuimanager.c (gimp_ui_manager_connect_proxy):
	connect to the menu items' "select" and "deselect" signals here...

	(gimp_ui_manager_item_realize): ...instead of here.


svn path=/trunk/; revision=22206
2007-03-31 12:25:03 +00:00
Sven Neumann
fe0b95b6bc app/widgets/gimpdbusservice.[ch] added a boolean return value to the D-Bus
2007-03-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdbusservice.[ch]
	* app/widgets/dbus-service.xml: added a boolean return value to
	the D-Bus Open method.


svn path=/trunk/; revision=22182
2007-03-27 20:12:44 +00:00
Sven Neumann
518b13d17b changed file_open_from_command_line() to deal with a single filename only.
2007-03-27  Sven Neumann  <sven@gimp.org>

	* app/file/file-open.[ch]: changed file_open_from_command_line()
	to deal with a single filename only.

	* app/widgets/gimpdbusservice.[ch]
	* app/widgets/dbus-service.xml: changed the D-Bus Open method to
	take only a single filename.

	* app/app.c
	* app/main.c: changed accordingly.


svn path=/trunk/; revision=22181
2007-03-27 19:40:31 +00:00
Sven Neumann
aa3eff52bd oops, fixed the onject path
svn path=/trunk/; revision=22172
2007-03-26 21:23:34 +00:00
Sven Neumann
b2c2d9902a app/widgets/dbus-service.xml be more specific in the D-Bus service and
2007-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/dbus-service.xml
	* app/widgets/gimpdbusservice.h: be more specific in the D-Bus
	service and interface name.


svn path=/trunk/; revision=22171
2007-03-26 21:19:30 +00:00
Michael Natterer
1c233b6fb6 disallow passing a NULL image.
2007-03-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcursorview.[ch] (gimp_color_frame_update_cursor):
	disallow passing a NULL image.

	(gimp_color_frame_clear_cursor): new function that clears the
	cursor view.

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): if
	color_frame->sample_valid is FALSE, don't do any color
	transformations and don't construct any string because none
	of them is going to be used (all labels will show "n/a").

	* app/display/gimpstatusbar.[ch]: renamed set_cursor() API
	to update_cursor().

	* app/display/gimpdisplayshell-cursor.c
	(gimp_display_shell_update_cursor): move variables to local
	scopes. Follow GimpStatusbar API change. Cleanup.

	(gimp_display_shell_clear_cursor): ditto. Follow GimpColorFrame
	API change.


svn path=/trunk/; revision=22153
2007-03-20 19:03:34 +00:00
Michael Natterer
24a8095025 Make the height of the previews in data editors configurable. Fixes bug
2007-03-17  Michael Natterer  <mitch@gimp.org>

	Make the height of the previews in data editors configurable.
	Fixes bug #337757.

	* app/widgets/gimpdataeditor.[ch]: add member "view" which needs
	to be set by subclasses. Add style property "minimal-height" which
	defaults to 96. Add style_set() implementation which sets
	editor->view's height to the configured value.

	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: use data_editor->view for
	storing the view widget and removed own view members. Remove
	separate #defines for the view's default width and height, it's
	width follows the dialog anyway.

	* themes/Default/gtkrc: document the default value of 96.

	* themes/Small/gtkrc: set it to 64.


svn path=/trunk/; revision=22137
2007-03-17 18:20:19 +00:00
Michael Natterer
e8edf3f408 added new ugly function gimp_dialog_factory_hide_dialog() which does
2007-03-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added new ugly function
	gimp_dialog_factory_hide_dialog() which does gtk_widget_hide() and
	sets the stored visibility state to GIMP_DIALOG_VISIBILITY_INVISIBLE
	in order to avoid re-showing dialogs that were already insivible due
	to TAB-toggling when we gtk_widget_hided them.

	* app/tools/gimptransformtool.c
	* app/tools/gimpimagemaptool.c: use the new function instead of
	gtk_widget_hide() to hide tool dialogs. Fixes bug #414006.


svn path=/trunk/; revision=22111
2007-03-13 22:55:07 +00:00
Sven Neumann
8fd67e0e95 cache the result of gimp_plug_in_procedure_get_label() and made the return
2007-03-10  Sven Neumann  <sven@gimp.org>

	* app/plug-in/gimppluginprocedure.[ch]: cache the result of
	gimp_plug_in_procedure_get_label() and made the return value 
const.


	* app/actions/plug-in-actions.c
	* app/plug-in/gimpplugin-cleanup.c
	* app/plug-in/gimppluginmanager.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimpimagepropview.c: changed accordingly.

	* app/file/file-open.c
	* app/file/file-save.c: include the plug-in name (or actually 
the
	label) in the error messages.


svn path=/trunk/; revision=22095
2007-03-10 21:22:22 +00:00
Michael Natterer
83d3a750d4 include "libgimpmath/gimpmathtypes.h" instead of "libgimpmath/gimpmath.h".
2007-03-09  Michael Natterer  <mitch@gimp.org>

	* app/core/core-types.h: include "libgimpmath/gimpmathtypes.h"
	instead of "libgimpmath/gimpmath.h".

	* app/core/gimpbrush.h
	* app/paint/gimppaintcore.h
	* app/paint/gimpperspectiveclone.h
	* app/text/gimptext.h
	* app/tools/gimptransformtool.h: include gimpvector.h and
	gimpmatrix.h explicitely where they are needed in public structs.

	* app/*/*.c
	* tools/pdbgen/pdb/paths.pdb: include "libgimpmath/gimpmath.h"
	where needed.

	* app/pdb/paths_cmds.c: regenerated.


svn path=/trunk/; revision=22084
2007-03-09 13:00:01 +00:00
Sven Neumann
7044701112 added missing cast.
2007-03-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpstrokeeditor.c: added missing cast.


svn path=/trunk/; revision=22048
2007-03-05 20:28:31 +00:00
Tor Lillqvist
0adf7e22da Guard against event being NULL.
2007-02-20  Tor Lillqvist  <tml@novell.com>

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_sel_changed): Guard against event being
	NULL.


svn path=/trunk/; revision=21963
2007-02-20 19:50:32 +00:00
Michael Natterer
36a955a5ef add "locale_domain" and "help_domain" members and APIs to get/set them.
2007-02-18  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/gimppluginprocedure.[ch]: add "locale_domain" and
	"help_domain" members and APIs to get/set them. Removed locale and
	help domain parameters from all other functions.

	* app/plug-in/gimpplugin.c (gimp_plug_in_add_temp_proc)
	* app/plug-in/plug-in-def.c (plug_in_def_add_procedure)
	(plug_in_def_set_locale_domain_name)
	(plug_in_def_set_help_domain_name): make sure all plug-in procedures
	have locale and help domains.

	* app/plug-in/gimppluginmanager.[ch]: removed function
	gimp_plug_in_manager_get_label().

	* app/plug-in/gimppluginmanager.c
	* app/plug-in/gimpplugin-cleanup.c
	* app/actions/plug-in-actions.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimpimagepropview.c: changed (simplified) accordingly.


svn path=/trunk/; revision=21937
2007-02-18 14:25:34 +00:00
Sven Neumann
1504a7f5bd skip Windows ICO as writable format. It's not well suited as a general
2007-02-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppixbuf.c (gimp_pixbuf_targets_add): skip 
Windows
	ICO as writable format. It's not well suited as a general image
	exchange format and the GdkPixbuf save routine seems to be 
buggy.


svn path=/trunk/; revision=21936
2007-02-18 08:57:16 +00:00
Michael Natterer
d212161c00 app/core/gimp-utils.[ch] app/core/gimp.c app/widgets/gimpcontrollerinfo.c
2007-02-17  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-utils.[ch]
	* app/core/gimp.c
	* app/widgets/gimpcontrollerinfo.c
	* libgimpwidgets/gimpcontroller.c: removed various boolean_handled
	signal accumulators and use g_signal_accumulator_true_handled().


svn path=/trunk/; revision=21933
2007-02-17 11:45:59 +00:00
Sven Neumann
0d5bf0ffda don't use button as parent widget, it might be NULL.
2007-02-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerlist.c 
(gimp_controller_list_edit_clicked):
	don't use button as parent widget, it might be NULL.


svn path=/trunk/; revision=21907
2007-02-13 08:08:57 +00:00
Sven Neumann
0a203e30c4 libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgetstypes.h
2007-02-12  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpstringcombobox.[ch]: added GimpStringComboBox.

	* libgimpwidgets/gimppropwidgets.[ch]: added a prop widget
	constructor that uses the new widget.

	* libgimpwidgets/gimpwidgets.def: updated.

	* app/widgets/gimpcontrollereditor.c: use a GimpStringComboBox if
	the module specifies a tree model with string values.

	* modules/gimpinputdevicestore.c: minor cleanup.

	* modules/controller_linux_input.c: keep a pointer to the input
	device store and unref it in the finalizer.


svn path=/trunk/; revision=21900
2007-02-12 15:29:45 +00:00
Sven Neumann
4f6e2969c6 use a GimpDialog instead of a GimpViewableDialog.
2007-02-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerlist.c (gimp_controller_list_edit_clicked):
	use a GimpDialog instead of a GimpViewableDialog.


svn path=/trunk/; revision=21899
2007-02-12 13:12:47 +00:00
Sven Neumann
32514d2d82 app/widgets/gimppropwidgets.c most property widgets rely on a writable
2007-02-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c
	* libgimpwidgets/gimppropwidgets.c: most property widgets rely on
	a writable property. Check for that or make the widget non-editable
	if the G_PARAM_WRITABLE flag is unset.


svn path=/trunk/; revision=21898
2007-02-12 11:01:08 +00:00
Sven Neumann
0f3392aac5 fine-tuning
svn path=/trunk/; revision=21897
2007-02-12 10:39:50 +00:00
Sven Neumann
6ea68a7d48 minor refactoring.
2007-02-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollereditor.c: minor refactoring.

	* libgimpwidgets/gimppropwidgets.c (gimp_prop_label_new): allow
	this function to be used with properties that are transformable 
to
	string values, not only with string properties.


svn path=/trunk/; revision=21896
2007-02-12 08:44:25 +00:00
Sven Neumann
b76ad2b84e app/tools/gimprectangleoptions.c moved code around.
2007-02-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimprectangleoptions.c
	* app/widgets/gimppropwidgets.[ch]: moved code around.


svn path=/trunk/; revision=21876
2007-02-08 22:49:50 +00:00
Sven Neumann
fbc67ff207 reduced default spacing.
2007-02-08  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpenumwidgets.c
	(gimp_enum_stock_box_new_with_range): reduced default spacing.

	* app/tools/gimpcurvestool.c (gimp_curves_tool_dialog): don't
	increase the box's spacing.

	* app/tools/gimprectangleoptions.c: added portrait/landscape
	buttons.

	* app/widgets/gimppropwidgets.c (gimp_prop_aspect_ratio_new):
	reduced default width of entry.  Swap width and height when the
	aspect changes and fixed-aspect is chosen.

svn path=/trunk/; revision=21873
2007-02-08 16:36:23 +00:00
Sven Neumann
938b316dae app/tools/gimprectangleoptions.c cleaned out some cruft. Still work in
2007-02-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimprectangleoptions.c
	* app/widgets/gimppropwidgets.[ch]: cleaned out some cruft. Still
	work in progress.

svn path=/trunk/; revision=21872
2007-02-08 15:35:49 +00:00
Sven Neumann
525b8bd6b5 app/widgets/widgets-enums.c moved enum GimpAspectType to libgimpwidgets.
2007-02-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-enums.c
	* libgimpwidgets/gimpwidgetsenums.[ch]: moved enum GimpAspectType
	to libgimpwidgets.

	* libgimpwidgets/gimpratioentry.[ch]: added property "aspect" with
	getters and setters.

	* libgimpwidgets/gimpwidgets.def: updated.


svn path=/trunk/; revision=21867
2007-02-08 10:56:17 +00:00
Michael Natterer
fc761f6ed5 remove enum GimpColorPickMode...
2007-02-07  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools-enums.[ch]: remove enum GimpColorPickMode...

	* app/widgets/widgets-enums.[ch]: ...and add it here.

	* app/widgets/gimpgradienteditor.c: merge separate functions for
	picking FG and BG colors and update the new color area from the
	merged function.


svn path=/trunk/; revision=21863
2007-02-07 17:53:16 +00:00
Sven Neumann
ab406a1b07 app/dialogs/preferences-dialog.c slightly increased the height of color
2007-02-07  Sven Neumann  <sven@gimp.org>

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimpgrideditor.c: slightly increased the height of
	color buttons.

svn path=/trunk/; revision=21862
2007-02-07 17:24:09 +00:00
Michael Natterer
d6ee118027 applied patch from Joao S. O. Bueno Calligaris which adds a preview for
2007-02-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.[ch]: applied patch from Joao
	S. O. Bueno Calligaris which adds a preview for the color the
	cursor is currently hovering and reduces excess precision when
	displaying color components and gradient positions (bug #400907).


svn path=/trunk/; revision=21858
2007-02-07 13:50:08 +00:00
Sven Neumann
ea4ed72e88 app/actions/view-actions.c app/actions/view-commands.[ch]
2007-02-07  Sven Neumann  <sven@gimp.org>

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-scale.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: applied patch from Robert Helgesson 
that
	adds "Revert Zoom" functionality (bug #338168).


svn path=/trunk/; revision=21855
2007-02-07 08:13:44 +00:00
Sven Neumann
06f2e093bc changed function signature according to changes in internal undo API.
2007-02-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_toggle_clicked):
	changed function signature according to changes in internal undo API.


svn path=/trunk/; revision=21836
2007-02-02 10:57:16 +00:00
Sven Neumann
18a07d427b ellipsize progress label.
2007-02-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprogressbox.c: ellipsize progress label.

	* app/widgets/gimpprogressdialog.c: set a fixed width for progress
	dialogs.

	* libgimp/gimpprogressbar.c: ellipsize progress label.


svn path=/trunk/; revision=21831
2007-02-01 12:06:21 +00:00
Sven Neumann
fb6db20b65 app/config/gimpdisplayconfig.c changed the default monitor resolution to
2007-02-01  Sven Neumann  <sven@gimp.org>

	* app/config/gimpdisplayconfig.c
	* app/widgets/gimpwidgets-utils.c (gimp_get_screen_resolution):
	changed the default monitor resolution to 96 dpi and also use that
	as a fallback value.


svn path=/trunk/; revision=21830
2007-02-01 10:44:01 +00:00
Michael Natterer
11b1d24ac7 app/core/Makefile.am new files implementing new(), ref() and unref() and
2007-01-30  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/gimpsamplepoint.[ch]: new files implementing new(),
	ref() and unref() and the new GIMP_TYPE_SAMPLE_TYPE boxed type.

	* app/core/gimpimage-sample-points.[ch]: removed ref() and unref()
	functions here.

	* app/core/gimpimage.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-undo-push.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-draw.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpsamplepointeditor.c
	* app/xcf/xcf-save.c: changed accordingly.

	* app/core/gimpimage-rotate.c (gimp_image_rotate_sample_points):
	added missing call to gimp_image_undo_push_sample_point().


svn path=/trunk/; revision=21812
2007-01-30 10:34:59 +00:00
Sven Neumann
4c5cfb61d3 added Activate method.
2007-01-23  Sven Neumann  <sven@gimp.org>

        * app/widgets/dbus-service.xml: added Activate method.

        * app/widgets/gimpdbusservice.[ch]: raise the toolbox from the
        Activate method. Do nothing when no URIs are passed

        * app/main.c: try the Activate method on the org.gimp.GIMP 
service
        when being called without any filenames on the command-lines.


svn path=/trunk/; revision=21761
2007-01-22 23:25:37 +00:00
Sven Neumann
6414b2ea5d added utility function that handles opening files passed on the
2007-01-22  Sven Neumann  <sven@gimp.org>

	* app/file/file-open.[ch]: added utility function that handles
	opening files passed on the command-line.

	* app/app_procs.c
	* app/widgets/gimpdbusservice.c: use the new function instead of
	duplicating the code.


svn path=/trunk/; revision=21759
2007-01-22 21:39:57 +00:00
Sven Neumann
0e55a7f5f7 don't add the open-as-image button to all data factory views.
2007-01-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdatafactoryview.c: don't add the open-as-image
	button to all data factory views.

	* app/widgets/gimppatternfactoryview.c: but do it here for the
	Pattern dialog.


svn path=/trunk/; revision=21755
2007-01-22 16:55:39 +00:00
Michael Natterer
a4863593ec Close the display after "Save as" when invoked via the "Close Without
2007-01-20  Michael Natterer  <mitch@gimp.org>

	Close the display after "Save as" when invoked via the "Close
	Without Saving" dialog. Fixes bug #383700.

	* app/actions/actions-types.h: added enum GimpSaveMode { SAVE,
	SAVE_AS, SAVE_A_COPY, SAVE_AND_CLOSE }.

	* app/actions/file-actions.c: changed the 4 save actions into
	GimpEnumActions with above enum as values.

	* app/actions/file-commands.[ch]: merged the save callbacks into
	one and pass a "close_after_saving" boolean to
	file_save_dialog_show().

	* app/widgets/gimpfiledialog.[ch]: added "gboolean
	close_after_saving" parameter to gimp_file_dialog_set_image() and
	to the GimpFileDialog struct.

	* app/dialogs/file-save-dialog.c: if the file was saved
	successfully and close_after_saving is TRUE, close the display if
	the image has not become dirty again in the meantime.


svn path=/trunk/; revision=21743
2007-01-20 19:38:09 +00:00
Sven Neumann
bfd1dd5f07 INSTALL check for D-Bus GLib bindings.
2007-01-19  Sven Neumann  <sven@gimp.org>

	* INSTALL
	* configure.in: check for D-Bus GLib bindings.

	* app/Makefile.am
	* app/main.c: check if an interactive GIMP instance proposes
	itself on the D-Bus and delegate to it. Allow this behaviour to be
	overridden by using the --new-instance command-line option.

	* app/widgets/Makefile.am
	* app/widgets/gimpdbusservice.[ch]
	* app/widgets/dbus-service.xml: added an object that offers a
	D-Bus service.

	* app/gui/Makefile.am
	* app/gui/gui.c: connect to the D-Bus and export the GimpDBusService.


svn path=/trunk/; revision=21737
2007-01-19 14:50:13 +00:00
Sven Neumann
7570bf60ee use GTK_RESPONSE_ACCEPT to make it work properly with
2007-01-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprofilechooserdialog.c: use GTK_RESPONSE_ACCEPT
	to make it work properly with GtkFileChooserButton.


svn path=/trunk/; revision=21723
2007-01-16 10:21:00 +00:00
Sven Neumann
7f7d4366a0 include *.icm files in the filter. Add a shortcut to the systemwide color
2007-01-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprofilechooserdialog.c: include *.icm files in
	the filter. Add a shortcut to the systemwide color profile 
folder.


svn path=/trunk/; revision=21722
2007-01-16 08:02:30 +00:00
Hans Breuer
f8d14112c4 updated #include "file/file-utils.h" for file_utils_uri_display_name
2007-01-13  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc app/gimpcore.def : updated
	* app/display/gimpdisplay-handlers.c : #include "file/file-utils.h"
	for file_utils_uri_display_name
	* plug-ins/imagemap/imap_statusbar.c : g_snprintf instead of snprintf


svn path=/trunk/; revision=21705
2007-01-13 22:41:21 +00:00
Sven Neumann
fa8e72ba1d app/widgets/gimpfiledialog.c save some string copies by changing
2007-01-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpthumbbox.[ch]: save some string copies by
	changing gimp_thumb_box_set_uri() to gimp_thumb_box_take_uri().


svn path=/trunk/; revision=21701
2007-01-13 16:56:30 +00:00
Michael Natterer
09f47a0aec register GIMP_TYPE_DASH_PATTERN as boxed type. Added "new" to function
2007-01-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdashpattern.[ch]: register GIMP_TYPE_DASH_PATTERN
	as boxed type. Added "new" to function names which create dash
	patterns. Changed and renamed GValue functions to functions which
	convert the dash pattern between GArray and GValueArray.

	* app/core/gimpstrokeoptions.c
	* app/widgets/gimpcellrendererdashes.c
	* app/widgets/gimpstrokeeditor.c: changed accordingly.

	* app/widgets/gimpdasheditor.c: ditto. Get rid of the recently
	added manual memory management. The list store manages boxed types
	all by itself.


svn path=/trunk/; revision=21698
2007-01-12 20:27:40 +00:00
Sven Neumann
e2287771fc fixed memory management of dash patterns (bug #395043).
2007-01-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpstrokeeditor.c: fixed memory management of dash
	patterns (bug #395043).


svn path=/trunk/; revision=21690
2007-01-12 12:14:06 +00:00
Tor Lillqvist
33e8de759b Add workaround for a problem that occurs on Win32 when one has opened an
2007-01-04  Tor Lillqvist  <tml@novell.com>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): Add
	workaround for a problem that occurs on Win32 when one has opened
	an image from the root of a drive letter and then does Save As.


svn path=/trunk/; revision=21639
2007-01-04 01:08:09 +00:00
Michael Natterer
9fd79d8bcd compile before you commit :P
2006-12-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c
	(gimp_prop_ratio_entry_notify): compile before you commit :P


svn path=/trunk/; revision=21615
2006-12-30 17:31:21 +00:00
Simon Budig
7a3eb8dcd3 New files implementing a widget for entering ratios. Will be improved over
2006-12-30  Simon Budig  <simon@gimp.org>

	* libgimpwidgets/gimpratioentry.[ch]: New files implementing a widget
	for entering ratios. Will be improved over time...

	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/Makefile.am: changed accordingly.

	* app/widgets/gimppropwidgets.c: use it for the crop/rectangle
	select tools.

svn path=/trunk/; revision=21613
2006-12-30 15:25:11 +00:00
Sven Neumann
930d6149da removed all .cvsignore files from SVN
svn path=/trunk/; revision=21612
2006-12-30 14:31:03 +00:00
Seth Burgess
ae1e568413 app/widgets/gimpdasheditor.h fixed improper _GET_CLASS macros
12-28-06 Seth Burgess  <sjburges@gimp.org>

        * app/widgets/gimpdasheditor.h
        * app/widgets/gimphistogramview.h: fixed improper _GET_CLASS macros
2006-12-28 15:44:51 +00:00
Michael Natterer
59269cf704 don't do stuff on NULL mask view renderers. Fixes bug #389307.
2006-12-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_set_context): don't do stuff on NULL mask
	view renderers. Fixes bug #389307.
2006-12-25 14:51:53 +00:00
Sven Neumann
541c8af049 app/core/gimp-documents.c app/core/gimp-parasites.c
2006-12-22  Sven Neumann  <sven@gimp.org>

	* app/core/gimp-documents.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimp-units.c
	* app/widgets/gimpcontrollers.c: changed the header that is
	written to config files that are rewritten on exit.

	* app/tools/gimpiscissorstool.c: comment.
2006-12-22 10:09:09 +00:00
Sven Neumann
fd2b9ce3e9 app/plug-in/plug-in-icc-profile.[ch] removed run-mode argument from
2006-12-18  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-icc-profile.[ch]
	* plug-ins/common/lcms.c: removed run-mode argument from
	plug-in-icc-profile-info. Added new procedure to obtain
information
	about a color profile on disk.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprofilechooserdialog.[ch]: added a first draft
	of a file-chooser dialog for selecting a color profile.

	* app/dialogs/preferences-dialog.c: use it.
2006-12-18 08:15:56 +00:00
Sven Neumann
50fabff948 added new function gimp_ui_manager_activate_action() as a shortcut for
2006-12-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpuimanager.[ch]: added new function
	gimp_ui_manager_activate_action() as a shortcut for looking up the
	action and activating it.

	* app/actions/dialogs-actions.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: use the new function.

	* app/actions/file-commands.c
	* app/dialogs/file-save-dialog.c: minor code cleanup.
2006-12-15 12:03:47 +00:00
Michael Natterer
98ae7326d7 Applied slightly modified patch from David Gowers which abstracts away and
2006-12-14  Michael Natterer  <mitch@gimp.org>

	Applied slightly modified patch from David Gowers which abstracts
	away and unifies seraching a color in a palette (bug #132146):

	* app/core/gimppalette.[ch]: added gimp_palette_find_entry().

	* app/widgets/gimpcolorselectorpalette.c
	* app/widgets/gimppaletteeditor.c: use it for selecting matching
	colors from the active palette.
2006-12-14 12:02:05 +00:00
Sven Neumann
25dc6fe45d check ui_manager before accessing it. Fixes warnings on destruction.
2006-12-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_get_tab_widget): check
	ui_manager before accessing it. Fixes warnings on destruction.
2006-12-12 13:01:53 +00:00
Sven Neumann
d0e118dc9c slightly increased size of the quick-mask and zoom-mode buttons. Also
2006-12-12  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_new):
	slightly increased size of the quick-mask and zoom-mode buttons.
	Also changed the style to not displace the icon when the buttons
	are pressed.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-appearance.c: changed "origin_button"
	to "origin". Don't draw it as a button but use an event box just
	like we do for the navigation icon in the lower right corner.

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): use the viewable description
	for the drawable's name. We don't want to see "Qmask" in the
	statusbar.

	* app/widgets/gimpwidgets-utils.c (gimp_button_menu_position): fix
	for the case where button is not really a GtkButton but has it's
	own window.

	* app/widgets/gimphelp-ids.h: changed help ID, removed unused one.

	* libgimpwidgets/gimpstock.c
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-quick-mask-off-12.png
	* themes/Default/images/stock-quick-mask-off-16.png
	* themes/Default/images/stock-quick-mask-on-12.png
	* themes/Default/images/stock-quick-mask-on-16.png: cropped empty
	space from the quick-mask icon.
2006-12-12 11:20:59 +00:00
Sven Neumann
4fb72eb8cf added API to delete saved tool-options.
2006-12-11  Sven Neumann  <sven@gimp.org>

	* app/core/gimptooloptions.[ch]: added API to delete saved
	tool-options.

	* app/tools/gimp-tools.c: don't deal with saving presets, just
	load them on startup. Create the tool-options directory when
	saving tool-options.

	* app/core/gimptoolpresets.[ch]: added new signal that is
emitted
	whenever the presets changes. Create the tool-options directory
	when saving a preset.

	* app/widgets/gimptooloptionseditor.[ch]: listen to the
"changed"
	signal of GimpToolPresets and queue an idle save.
2006-12-11 15:16:13 +00:00
Sven Neumann
df8bf728a6 app/core/Makefile.am app/core/core-types.h added GimpToolPresets, derived
2006-12-10  Sven Neumann  <sven@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimptoolpresets.[ch]: added GimpToolPresets, derived
	from GimpList.

	* app/core/gimptoolinfo.[ch]: use the new type, renamed
	member "options_presets" to "presets".

	* app/actions/tool-options-actions.c
	* app/actions/tool-options-commands.c
	* app/core/gimptooloptions.[ch]
	* app/menus/tool-options-menu.c
	* app/widgets/gimptooloptionseditor.c: changed accordingly.

	* app/tools/gimp-tools.c: let the GimpToolPresets object deal
with
	loading and saving the presets from ${gimpdir}/tool-options.

	* app/core/gimpcontainer-filter.c
	* app/core/gimpdocumentlist.c
	* app/core/gimplist.c
	* app/text/gimpfontlist.c: use canonical property names.
2006-12-10 19:13:58 +00:00
Michael Natterer
6be00cbaf9 app/widgets/gimpcolorselectorpalette.[ch]
2006-12-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorselectorpalette.[ch]
	* app/widgets/gimpcontrollerinfo.[ch]
	* app/widgets/gimpcontrollerkeyboard.[ch]
	* app/widgets/gimpcontrollerwheel.[ch]: forgot LIBGIMP -> GIMP
2006-12-10 16:38:48 +00:00
Michael Natterer
afd0b332d9 app/widgets/gimpcolorselectorpalette.[ch]
2006-12-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorselectorpalette.[ch]
	* app/widgets/gimpcontrollerinfo.[ch]
	* app/widgets/gimpcontrollerkeyboard.[ch]
	* app/widgets/gimpcontrollerwheel.[ch]: license is GPL, not LGPL.
2006-12-09 21:51:48 +00:00
Sven Neumann
41237259c9 In all files, changed the standard copyright notice to say "GIMP - The GNU
2006-12-09  Sven Neumann  <sven@gimp.org>

        * In all files, changed the standard copyright notice to say
        "GIMP - The GNU Image Manipulation Program".
2006-12-09 21:33:38 +00:00
Sven Neumann
010d9ff7cf removed obsolete parameter from gtk-doc comment.
2006-11-30  Sven Neumann  <sven@gimp.org>

        * app/widgets/gimppropwidgets.c (gimp_prop_color_button_new):
        removed obsolete parameter from gtk-doc comment.
2006-11-30 15:30:25 +00:00
Sven Neumann
d77ac40cbf typo.
2006-11-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_color_button_new): typo.
2006-11-27 12:08:57 +00:00
Michael Natterer
146e063f0a app/core/gimpbrushclipboard.c app/core/gimppatternclipboard.c
2006-11-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpbrushclipboard.c
	* app/core/gimppatternclipboard.c
	* app/core/gimptooloptions.c
	* app/core/gimpundo.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpimageparasiteview.c
	* app/widgets/gimpimagepropview.c: no need to cast the return
	value of g_value_get_object(), it's a gpointer.
2006-11-25 14:57:26 +00:00
Simon Budig
223a578b35 libgimpwidgets/gimpresolutionentry.c fix typo in a function name.
2006-11-25  Simon Budig  <simon@gimp.org>

	* libgimpwidgets/gimpresolutionentry.c
	* libgimpwidgets/gimpwidgets.def: fix typo in a function name.

	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimppaletteeditor.c
	* app/actions/gradient-editor-actions.c
	* app/actions/palette-editor-actions.c: handle all enum values
	and use sane ones.

	* app/widgets/gimpcontrollerinfo.c: fix a warning.
2006-11-25 00:13:08 +00:00
Simon Budig
0308d410b4 Fixing include/declaration issues in the application:
2006-11-23  Simon Budig  <simon@gimp.org>

	Fixing include/declaration issues in the application:

	* app/composite/gimp-composite-sse2.c: disable unused debugging code

	* app/paint-funcs/paint-funcs.[ch]
	* app/paint-funcs/scale-funcs.[ch]: fix include files, add some
	prototypes, make some other functions static.

	* app/core/gimpbuffer.c
	* app/core/gimpdrawable-preview.c: changed accordingly.

	* app/tools/gimpeditselectiontool.[ch]: untangle .c and .h file.

	* app/widgets/gimpfiledialog.c: add missing #include.
2006-11-24 14:08:40 +00:00
Michael Natterer
35a5a46a4a plug-ins/help/gimphelpitem.[ch] added some EEKy members to the structs
2006-11-23  Michael Natterer  <mitch@gimp.org>

	* plug-ins/help/gimphelpitem.[ch]
	* plug-ins/help/gimphelplocale.[ch]: added some EEKy members to
	the structs where the browser can store its state.

	* plug-ins/helpbrowser/Makefile.am
	* plug-ins/helpbrowser/helpbrowser.c: link against libgimphelp.a
	and implement all the help ID mapping ourselves.

	* plug-ins/helpbrowser/dialog.[ch]: added a tree view with the
	help IDs of the current help domain. Double click to jump to an
	item. Very early-stage code and very unusable, please try anyway.

	* app/widgets/gimphelp.c: if the help browser is available, call
	it directly, not via the help plug-in.
2006-11-23 21:04:41 +00:00
Sven Neumann
aa09e29272 don't raise and focus the error console for not so severe error messages.
2006-11-22  Sven Neumann  <sven@gimp.org>

	* app/gui/gui-message.c (gui_message_error_console): don't raise
	and focus the error console for not so severe error messages. Fixes
	bug #322210 and bug #373254.

	* app/widgets/gimperrorconsole.c (gimp_error_console_init): reduced
	font sizes in error console.
2006-11-22 16:33:31 +00:00
Michael Natterer
02de3076c9 Got rid of the word "editor" were it was good for nothing but exposing an
2006-11-17  Michael Natterer  <mitch@gimp.org>

	Got rid of the word "editor" were it was good for nothing but
	exposing an implementation detail in public API and installed
	files.  Fixes bug #345251:

	* app/actions/colormap-editor-actions.[ch]
	* app/actions/colormap-editor-commands.[ch]
	* app/actions/sample-point-editor-actions.[ch]
	* app/actions/sample-point-editor-commands.[ch]
	* menus/colormap-editor-menu.xml
	* menus/sample-point-editor-menu.xml
	* menus/selection-editor-menu.xml
	* menus/undo-editor-menu.xml: removed.

	* app/actions/colormap-actions.[ch]
	* app/actions/colormap-commands.[ch]
	* app/actions/sample-points-actions.[ch]
	* app/actions/sample-points-commands.[ch]
	* menus/colormap-menu.xml
	* menus/sample-points-menu.xml
	* menus/selection-menu.xml
	* menus/undo-menu.xml: added.

	* app/actions/Makefile.am
	* menus/Makefile.am
	* app/actions/actions.c
	* app/menus/menus.c
	* app/menus/plug-in-menus.c
	* app/plug-in/gimppluginprocedure.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpsamplepointeditor.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpundoeditor.c
	* plug-ins/common/colormap-remap.c: changed accordingly.
2006-11-17 22:07:07 +00:00
Sven Neumann
13004433f5 cursors/Makefile.am cursors/cursor-move.png cursors/gimp-tool-cursors.xcf
2006-11-15  Sven Neumann  <sven@gimp.org>

	* cursors/Makefile.am
	* cursors/cursor-move.png
	* cursors/gimp-tool-cursors.xcf
	* cursors/xbm/cursor-move-mask.xbm
	* cursors/xbm/cursor-move.xbm: added new cursor.

	* app/widgets/gimpcursor.c
	* app/widgets/widgets-enums.h: added as GIMP_CURSOR_MOVE.

	* app/tools/gimprectangletool.c: use instead of a cursor
modifier.
2006-11-15 22:43:24 +00:00
Sven Neumann
da2253fce0 don't use gimp_dialog_set_sensitive(); just make the entry not editable
2006-11-14  Sven Neumann  <sven@gimp.org>

	* app/dialogs/file-open-location-dialog.c: don't use
	gimp_dialog_set_sensitive(); just make the entry not editable and
	the dialog's OK button insensitive.

	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpwidgets-utils.[ch]: moved gimp_dialog_set_sensitive()
	implementation into gimp_file_dialog_set_sensitive().
2006-11-14 13:46:43 +00:00
Michael Natterer
85cecec576 app/base/base.c app/core/gimp-user-install.c
2006-11-12  Michael Natterer  <mitch@gimp.org>

	* app/base/base.c
	* app/core/gimp-user-install.c
	* app/core/gimpbrushgenerated-load.c
	* app/core/gimpcontainer.c
	* app/core/gimpgradient-load.c
	* app/core/gimppalette-load.c
	* app/core/gimpparamspecs-desc.c
	* app/dialogs/tips-parser.c
	* app/menus/plug-in-menus.c
	* app/plug-in/gimppluginmanager.c
	* app/plug-in/gimppluginprocedure.c
	* app/text/gimptext-parasite.c
	* app/tools/gimpforegroundselecttool.c
	* app/widgets/gimpselectiondata.c
	* app/xcf/xcf.c: use g_str_has_prefix() instead of strncmp().
2006-11-12 20:30:50 +00:00
Michael Natterer
eae43600da *** empty log message *** 2006-11-05 18:53:13 +00:00
Michael Natterer
0e4f794f46 app/widgets/gimpcoloreditor.c temporarily attach the context to the
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcolordialog.c: temporarily attach the context to
	the GimpColorConfig object while calling the color selector's
	set_config().

	* app/widgets/gimpcolorselectorpalette.c: moved widget creation
	and signal connecting to GimpColorSelector::set_config() and
	use the context attached to the passed GimpColorConfig object.
2006-11-03 21:29:42 +00:00
Michael Natterer
e896521924 added gimp_image_add_layers() which takes a list of layers and vierport
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added gimp_image_add_layers() which
	takes a list of layers and vierport coordinates to center the
	layers in.

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: use it instead of having the
	same code three times.
2006-11-03 19:59:30 +00:00
Michael Natterer
ef52e7a9fd select a matching color in the palette if possible.
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorselectorpalette.c
	(gimp_color_selector_palette_set_color): select a matching color
	in the palette if possible.
2006-11-03 17:39:05 +00:00
Michael Natterer
cd0c301a3f app/widgets/Makefile.am new widget featuring a proof-of-concept palette
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcolorselectorpalette.[ch]: new widget featuring
	a proof-of-concept palette color selector. It always shows the
	current palette and doesn't bother to have any features yet. If I
	don't get around finishing this I will disable it for the 2.4
	release, but it's better kept in CVS than on my disk...
	Addresses bug #132146.

	* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): attach
	the passed context to the dialog so the palette selector can find
	it (puke).

	* app/gui/gui.c (gui_restore_callback): register the new object
	with the GType system.
2006-11-03 17:28:52 +00:00
Michael Natterer
725a4e414f added value GIMP_UNDO_GROUP_LAYER_ADD.
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch] (enum GimpUndoType): added value
	GIMP_UNDO_GROUP_LAYER_ADD.

	* app/file/file-open.[ch]: changed file_open_layer() to
	file_open_layers(), added parameter "gboolean merge_visible",
	return a GList of layers.

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: pass merge_visible = FALSE and
	add all returned layers to the image. Fixes bug #358082.
	(contains lots of duplicated code, will factor that out later).

	* tools/pdbgen/pdb/fileops.pdb (load_layer): pass merge_visible = TRUE
	(load_layers): new wrapper which returns all the image's layers.

	* app/pdb/fileops_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpfileops_pdb.[ch]: regenerated.

	* libgimp/gimp.def: changed accordingly.
2006-11-03 17:12:27 +00:00
Sven Neumann
568bbb9558 made non-abstract.
2006-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimageparasiteview.[ch]: made non-abstract.

	* app/dialogs/image-properties-dialog.c: show a "Comment" tab if
	the image contains a "gimp-comment" parasite.
2006-11-03 14:22:46 +00:00
Sven Neumann
4f4dea5645 app/widgets/Makefile.am app/widgets/widgets-types.h new abstract base
2006-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimageparasiteview.[ch]: new abstract base class.

	* app/widgets/gimpimageprofileview.[ch]: derive from
	GimpImageParasiteView.
2006-11-03 13:52:17 +00:00
Michael Natterer
8e22e7c764 fix rendering for n_columns == 1 (bug #369368).
2006-11-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_render): fix rendering for
	n_columns == 1 (bug #369368).
2006-11-02 12:18:20 +00:00
Michael Natterer
93caf1f8b1 fix cell_width calculation again so we don't cut off cells. Don't write
2006-11-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_render): fix cell_width calculation
	again so we don't cut off cells. Don't write beyond the buffer's
	size, fixes random crashes.
2006-11-01 19:13:59 +00:00
Michael Natterer
5d48aa2f62 make sure we calculate the right number of columns and don't render more
2006-11-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_render): make sure we calculate the
	right number of columns and don't render more cells than columns
	in one row.
2006-11-01 03:15:51 +00:00
Sven Neumann
e76910fba4 app/widgets/gimpdataeditor.c set the editable state, not the sensitivity
2006-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdataeditor.c
	* app/widgets/gimppaletteeditor.c: set the editable state, not
the
	sensitivity of the entries according to the data's editable
state.
2006-11-01 02:20:42 +00:00
Sven Neumann
03923a12ba eliminate compiler warning.
2006-10-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c (gimp_session_info_save):
	eliminate compiler warning.
2006-10-30 12:01:16 +00:00
Michael Natterer
c18faa20fe app/actions/brush-editor-actions.c app/base/tile-manager-crop.c
2006-10-30  Michael Natterer  <mitch@gimp.org>

	* app/actions/brush-editor-actions.c
	* app/base/tile-manager-crop.c
	* app/config/gimpconfig-file.c
	* app/core/gimp-gradients.c
	* app/core/gimpdrawable-histogram.c
	* app/core/gimpimage-colorhash.c
	* app/core/gimpimage-undo-push.c
	* app/dialogs/convert-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/gui-vtable.c
	* app/paint/gimpheal.c
	* app/paint/gimppaintcore-undo.c
	* app/plug-in/plug-in-enums.h
	* app/vectors/gimpstroke-new.c
	* app/vectors/gimpvectors-warp.c
	* app/widgets/gimpviewablebox.c
	* app/widgets/gimpviewrenderer-frame.c
	* app/widgets/gimpviewrenderer-utils.c
	* app/xcf/xcf-save.c
	* libgimpwidgets/gimpcontroller.c: all .c files should include
	their headers and all private functions should be static.
	(-Wmissing-declarations -Wmissing-prototypes rocks!)
2006-10-30 10:13:06 +00:00
Hans Breuer
3551bbcca0 updated
2006-10-27  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc app/gimpcore.def : updated
2006-10-27 16:04:53 +00:00
Sven Neumann
63da8bb8ca libgimpconfig/gimpcolorconfig-enums.[ch] libgimpconfig/gimpcolorconfig.c
2006-10-27  Sven Neumann  <sven@gimp.org>

	* libgimpconfig/gimpcolorconfig-enums.[ch]
	* libgimpconfig/gimpcolorconfig.c
	* libgimpconfig/gimpconfig.def: removed unused enum
	GimpColorFileOpenBehaviour.

	* app/core/core-enums.[ch]: added enum GimpColorProfilePolicy.

	* app/config/gimpcoreconfig.[ch]
	* app/config/gimprc-blurbs.h: added property
"color-profile-policy".

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-icc-profile.[ch]: new files that wrap
usage
	of the lcms plug-in.

	* app/file/file-open.c: implement the user-configured policy for
	embedded color profiles.

	* app/widgets/gimpimageprofileview.c: use the wrapper to call
the
	plug-in-icc-profile-info procedure.

	* app/widgets/gimptoolbox-dnd.c: pass TRUE for "attach_comment"
	parameter to gimp_create_image().

	* app/core/gimptemplate.c
	* app/file/Makefile.am: cosmetic changes.

	* app/Makefile.am: some resorting to make the beast link again.
2006-10-27 13:52:40 +00:00
Sven Neumann
d08399f645 update the profile information from an idle handler.
2006-10-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimageprofileview.[ch]: update the profile
	information from an idle handler.

	* plug-ins/common/lcms.c: bug fixes and robustness.
2006-10-26 14:11:14 +00:00
Simon Budig
ab4d8b037c extended gimp_vectors_import() and friends with a parameter for returning
2006-10-25  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpvectors-import.[ch]: extended gimp_vectors_import()
        and friends with a parameter for returning the newly generated vectors.

        * app/actions/edit-commands.c
        * app/actions/vectors-commands.c
        * app/display/gimpdisplayshell-dnd.c
        * app/widgets/gimpvectorstreeview.c: Changed accordingly.

        * app/vectors/vectors-enums.h: moved the GimpVectorsStrokeType to...
        * libgimpbase/gimpbaseenums.h: ... this file.

        * app/vectors/Makefile.am: Changed accordingly
        * app/vectors/vectors-enums.c: removed accordingly.

        * tools/pdbgen/pdb/vectors.pdb: new functions
        gimp_vectors_new_from_file() and gimp_vectors_new_from_string().

        * tools/pdbgen/pdb/paths.pdb: deprecated the previous functions.

        * app/pdb/internal_procs.c
        * app/pdb/paths_cmds.c
        * app/pdb/vectors_cmds.c
        * app/vectors/vectors-enums.c
        * libgimp/gimpenums.h
        * tools/pdbgen/enums.pl
        * libgimp/gimppaths_pdb.[ch]
        * libgimp/gimpvectors_pdb.[ch]
        * libgimpbase/gimpbaseenums.c
        * devel-docs/libgimp/tmpl/gimpfontselectbutton.sgml
        * devel-docs/libgimp/tmpl/gimptools.sgml: regenerated.
2006-10-25 15:14:03 +00:00
Sven Neumann
13ba2a52db added signals "parasite-attached" and "parasite-detached".
2006-10-25  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: added signals "parasite-attached" and
	"parasite-detached".

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimageprofileview.[ch]: draft of a new widget
that
	displays color profile information.

	* app/widgets/gimpimagepropview.c: minor cleanup and bug fix.

	* app/dialogs/image-properties-dialog.c: added Color Profile
	information.

	* plug-ins/common/lcms.c: bug fixes.
2006-10-25 07:31:04 +00:00
Michael Natterer
e634d4d718 Added "Edit -> Fade" which allows to modify the paint mode and opacity of
2006-10-21  Michael Natterer  <mitch@gimp.org>

	Added "Edit -> Fade" which allows to modify the paint mode and
	opacity of the last drawable operation (fill, plugins etc.).
	Started from a patch by Bill Skaggs. Fixes bug #170707.

	* app/base/base-enums.[ch] (enum GimpLayerModeEffects): register
	the values REPLACE_MODE, ERASE_MODE and ANTI_ERASE_MODE with
	the type system.

	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpwidgets-constructors.[ch]: added "gboolean
	with_replace_modes" to the paint mode menu constructors.

	* app/tools/gimppaintoptions-gui.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimplayertreeview.c: pass with_replace_modes = FALSE.

	* app/core/gimpdrawableundo.[ch]: added members which keep tiles,
	paint mode and opacity of the pasted pixels.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_get_fadeable):
	returns a GimpUndo suitable for a fade operation, or NULL.

	* app/core/gimp-edit.[ch] (gimp_edit_fade): implements the actual
	fade by undoing the last operation and then re-applying the pixels
	with different paint mode and opacity.

	* app/core/gimpdrawable-combine.c: store the pasted pixels in
	the GimpDrawableUndo.

	* app/actions/edit-actions.c
	* app/actions/edit-commands.[ch]: action and callback for fade.

	* app/dialogs/Makefile.am
	* app/dialogs/fade-dialog.[ch]: the fade dialog.

	* app/widgets/gimphelp-ids.h: the fade help ID.

	* menus/image-menu.xml.in: added a menu entry in "Edit".
2006-10-21 18:46:49 +00:00
Michael Natterer
287c98466d added gimp_prop_expanding_frame_new() which creates a frame with a toggle
2006-10-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added
	gimp_prop_expanding_frame_new() which creates a frame with a
	toggle button in the title.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimprectangleoptions.c
	* app/tools/gimprectangleselectoptions.c
	* app/tools/gimpselectionoptions.c: use it instead of duplicating
	this code all over the place.
2006-10-18 19:54:18 +00:00
Sven Neumann
64e893e62f there's no need to make GTypeInfo and GInterfaceInfo structs static.
2006-10-18  Sven Neumann  <sven@gimp.org>

        * [lots of files]: there's no need to make GTypeInfo and
        GInterfaceInfo structs static.
2006-10-18 13:17:50 +00:00
Michael Natterer
fd37247a55 use enum GimpChannelOps instead of SelectOps (which is a tool state).
2006-10-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectioneditor.c: use enum GimpChannelOps
	instead of SelectOps (which is a tool state).
2006-10-17 19:18:34 +00:00
Michael Natterer
ee8039a062 #include "core/gimp.h" for gimp_message().
2006-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimp.h" for
	gimp_message().
2006-10-16 13:46:28 +00:00
Tor Lillqvist
eac61e1e12 libgimp/gimpui.c (gimp_window_set_transient_for) These functions are used
2006-10-16  Tor Lillqvist  <tml@novell.com>

	* libgimp/gimpui.c (gimp_window_set_transient_for)
	* app/widgets/gimpwidgets-utils.c (gimp_window_set_transient_for):
	These functions are used for cross-process transient-for, which
	causes hangs on Win32. Bypass on Win32 for now. (#359538)
2006-10-16 11:55:50 +00:00
Michael Natterer
33720907ef close the popup when a drag starts.
2006-10-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpview-popup.c: close the popup when a drag starts.
2006-10-15 17:35:38 +00:00
Michael Natterer
1ed8dd4f53 app/actions/data-commands.c app/actions/documents-commands.c
2006-10-09  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/drawable-commands.c
	* app/actions/gradients-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimp-contexts.c
	* app/core/gimp-documents.c
	* app/core/gimp-edit.c
	* app/core/gimp-modules.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimp-units.c
	* app/core/gimpchannel.c
	* app/core/gimpdatafactory.[ch]
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimagefile.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimppdbprogress.c
	* app/core/gimpselection.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/session.c
	* app/gui/themes.c
	* app/pdb/gimpprocedure.c
	* app/plug-in/gimpplugin-message.c
	* app/plug-in/gimpplugin.c
	* app/plug-in/gimppluginmanager-file.c
	* app/plug-in/gimppluginmanager.c
	* app/text/gimptextlayer-xcf.c
	* app/text/gimptextlayer.c
	* app/widgets/gimpcontrollers.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpvectorstreeview.c
	* tools/pdbgen/pdb/brush.pdb
	* tools/pdbgen/pdb/gradient.pdb
	* tools/pdbgen/pdb/palette.pdb: convert lots of g_message() to
	gimp_message(). Make sure we never pass unknown strings (like
	error->message) to printf-like functions directly; run them
	thorugh "%s" instead. Don't translate some messages which should
	never happen.

	* app/pdb/brush_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/palette_cmds.c: regenerated.
2006-10-09 18:49:15 +00:00
Michael Natterer
f5afb754a5 Added message severities and make sure all messages are routed through a
2006-10-09  Michael Natterer  <mitch@gimp.org>

	Added message severities and make sure all messages are routed
	through a central function, so redirecting to the error console or
	stderr work again:

	* app/core/core-enums.[ch]: added enum GimpMessageSeverity { INFO,
	WARNING, ERROR }.

	* app/core/gimp.[ch] (gimp_message)
	(gimp_message_valist): added severity parameter. Changed
	"GimpProgress *progress" parameter to "GObject *handler", where
	"handler" can be either a GimpProgress, a GtkWidget or NULL.

	* app/core/gimp-gui.[ch] (gimp_show_message): ditto. Honor
	--console-messages again. Always dispatch to the GUI message
	handler first if it exists.

	* app/gui/gui-message.[ch]: pass severity parameters around.

	(gui_message_error_dialog): if "handler" is a progress, dispatch
	the message to it first. If it is a widget (and *not* a progress),
	use a GtkMessageDialog on top of that widget's toplevel. Fall
	back to the usual GimpErrorDialog otherwise.

	* app/core/gimpprogress.[ch] (gimp_progress_message): added
	severity parameter. Also added boolean return value to the virtual
	function so it can decide to fail if it can't handle the message.

	* app/display/gimpdisplay.c: implement GimpProgress::message() and
	redirect the message to GimpDisplayShell.

	* app/display/gimpdisplayshell-progress.c: implement
	GimpProgress::message() and redirect the message to GimpStatusbar
	if it is not an error and if the status bar is visible.

	* app/display/gimpstatusbar.[ch]: implement GimpProgress::message(),
	but fail on messages that contain a newline. Show the right icons
	for the message severities (work in progress).

	* app/display/gimpdisplayshell.[ch]: removed
	gimp_display_shell_message() and its _valist() variant.

	* app/widgets/gimperrorconsole.[ch]: show the right icons for the
	message severities.

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_progress_message):
	return TRUE to swallow all messages.

	* app/widgets/gimpwidgets-utils.[ch]: removed
	gimp_show_message_dialog(). Added gimp_get_message_stock_id().

	* app/errors.c
	* app/actions/edit-commands.c
	* app/actions/error-console-commands.c
	* app/actions/file-commands.c
	* app/actions/select-commands.c
	* app/actions/text-editor-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimagefile.c
	* app/dialogs/convert-dialog.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/pdb/gimppdb.c
	* app/plug-in/gimpplugin.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimptool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpactionview.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimppdbdialog.c
	* app/widgets/gimpvectorstreeview.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/brush.pdb
	* tools/pdbgen/pdb/gradient.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/message.pdb
	* tools/pdbgen/pdb/palette.pdb: added severity parameter to
	gimp_message() calls. Convert all calls to
	gimp_show_message_dialog() and gimp_display_shell_message() to
	gimp_message(). Also converted some more g_message() calls.

	* app/pdb/brush_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/message_cmds.c
	* app/pdb/palette_cmds.c: regenerated.
2006-10-09 08:17:22 +00:00
Michael Natterer
42dd70e14a changed Gimp parameter to GimpContext and use it instead of getting the
2006-10-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.[ch] (gimp_toolbox_new): changed Gimp
	parameter to GimpContext and use it instead of getting the user
	context from the Gimp.

	(toolbox_tool_button_toggled): set the tool on the dock's
	context instead of the user context.

	* app/dialogs/dialogs-constructors.c (dialogs_toolbox_get): pass
	the context to gimp_toolbox_new() instead of context->gimp.
2006-10-02 17:41:04 +00:00
Michael Natterer
c567149f8e libgimpwidgets/gimpcolordisplay.[ch] added "const gchar *stock_id" members
2006-10-01  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcolordisplay.[ch]
	* libgimpwidgets/gimpcontroller.[ch]: added "const gchar *stock_id"
	members to the class structs.

	* libgimpwidgets/gimpstock.[ch]
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-controller-16.png
	* themes/Default/images/stock-controller-24.png
	* themes/Default/images/stock-controller-keyboard-16.png
	* themes/Default/images/stock-controller-keyboard-24.png
	* themes/Default/images/stock-controller-linux-input-16.png
	* themes/Default/images/stock-controller-linux-input-24.png
	* themes/Default/images/stock-controller-midi-16.png
	* themes/Default/images/stock-controller-midi-24.png
	* themes/Default/images/stock-controller-wheel-16.png
	* themes/Default/images/stock-controller-wheel-24.png
	* themes/Default/images/stock-display-filter-colorblind-16.png
	* themes/Default/images/stock-display-filter-colorblind-24.png
	* themes/Default/images/stock-display-filter-contrast-16.png
	* themes/Default/images/stock-display-filter-contrast-24.png
	* themes/Default/images/stock-display-filter-gamma-16.png
	* themes/Default/images/stock-display-filter-gamma-24.png
	* themes/Default/images/stock-display-filter-lcms-16.png
	* themes/Default/images/stock-display-filter-lcms-24.png
	* themes/Default/images/stock-display-filter-proof-16.png
	* themes/Default/images/stock-display-filter-proof-24.png: added
	icons for the various display filters and controllers. Made them
	as ugly as sin to trigger some replacement pain in the relevant
	people ;)

	* modules/cdisplay_colorblind.c
	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c
	* modules/cdisplay_lcms.c
	* modules/cdisplay_proof.c
	* modules/controller_linux_input.c
	* modules/controller_midi.c
	* app/widgets/gimpcontrollerkeyboard.c
	* app/widgets/gimpcontrollerwheel.c: set icons.

	* app/widgets/gimpcolordisplayeditor.c
	* app/widgets/gimpcontrollerinfo.c
	* app/widgets/gimpcontrollerlist.c: show them in the display filter
	and controller GUIs.
2006-10-01 17:31:42 +00:00
Michael Natterer
5259a1f998 fix dialog layout (bug #309740).
2006-10-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpstrokeeditor.c (gimp_stroke_editor_constructor):
	fix dialog layout (bug #309740).
2006-10-01 11:00:27 +00:00
Sven Neumann
ba9efb3433 modules/Makefile.am new CMYK color-selector that uses littleCMS for the
2006-09-26  Sven Neumann  <sven@gimp.org>

	* modules/Makefile.am
	* modules/colorsel_cmyk_lcms.c: new CMYK color-selector that
uses
	littleCMS for the RGB <-> CMYK conversion. This is built instead
	of the standard CMYK color-selector if lcms is available.

	* libgimpwidgets/gimpcolornotebook.c
	* libgimpwidgets/gimpcolorselection.[ch]
	* libgimpwidgets/gimpcolorselector.[ch]
	* libgimpwidgets/gimpwidgets.def: added API to set the color
	management configuration on color selectors.

	* libgimpwidgets/gimpwidgetstypes.h: include
	libgimpconfig/gimpconfigtypes.h.

	* app/dialogs/grid-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/widgets/gimpcolordialog.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgrideditor.[ch]
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimptoolbox-color-area.c: set the color management
	configuration on (hopefully) all color selectors.

	* modules/cdisplay_lcms.c: use a GimpHintBox widget.
2006-09-26 08:55:41 +00:00
Michael Natterer
8e04fb1b82 Some more proper typing instead of using pointers:
2006-09-24  Michael Natterer  <mitch@gimp.org>

	Some more proper typing instead of using pointers:

	* libgimpconfig/gimpconfig-params.h: added macro
	GIMP_CONFIG_INSTALL_PROP_BOXED().

	* app/core/gimpcontainer.c: made "children-type" a GParamSpecGType.

	* app/widgets/gimpcontrollerinfo.c: made "mapping" a
	GParamSpecBoxed and use g_hash_table_unref() instead of destroy().

	* app/widgets/gimppdbdialog.c: made "select-type" a GParamSpecGType.

	* app/dialogs/module-dialog.c
	* app/widgets/gimpcolordisplayeditor.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c: use proper object types, boxed
	types and G_TYPE_GTYPE instead of G_TYPE_POINTER for various list
	stores and signal signatues.
2006-09-24 12:20:22 +00:00
William Skaggs
bc355f4f45 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimppropwidgets.c
	* app/tools/gimprectangleoptions.c: add functionality
	for aspect ratio control.
2006-09-23 19:40:40 +00:00
William Skaggs
7b8d12e0b6 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimppropwidgets.[ch]
	* app/tools/gimprectangleoptions.c
	* app/tools/gimprectangletool.c: more work on option
	layout and handling.
2006-09-22 18:27:21 +00:00
Sven Neumann
a69c1ff174 app/gui/gui-message.c moved utility function to gimpwidgets-utils.
2006-09-22  Sven Neumann  <sven@gimp.org>

	* app/gui/gui-message.c
	* app/widgets/gimpwidgets-utils.[ch]: moved utility function to
	gimpwidgets-utils.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: added a progress parameter to
	gimp_pdb_dialog_new() and make the dialog transient to the progress
	window.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb: pass progress to
	gimp_pdb_dialog_new().

	* app/pdb/brush_select_cmds.c
	* app/pdb/font_select_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/palette_select_cmds.c
	* app/pdb/pattern_select_cmds.c: regenerated.

	* libgimp/gimpselectbutton.c: cosmetics.
2006-09-22 09:24:41 +00:00
William Skaggs
24546bc818 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimppropwidgets.c (gimp_prop_aspect_ratio_new):
	some small bug-fixes.

	* app/tools/gimprectangleoptions.[ch]: major revision.  Got
	rid of lots of unneeded getter/setter-clutter, simplified
	set of options and appearance of gui.  Still work in progress.

	* app/tools/gimprectangleselectoptions.c
	* app/tools/gimprectangletool.c: corresponding changes.
2006-09-21 20:16:25 +00:00
Sven Neumann
715d452e2e draw slider positions more accurately, fixed incorrect use of
2006-09-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrambox.c: draw slider positions more
	accurately, fixed incorrect use of GtkAdjustments.
2006-09-20 10:19:49 +00:00
William Skaggs
4ff0ca1c38 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimppropwidgets.[ch]: add prop widget specially
	for controlling aspect ratio.

	* app/tools/gimprectangleoptions.ch]: use "aspect-numerator"
	and "aspect-denominator" properties instead of "aspect",
	and use new prop widget in gui to set and display them.

	* app/tools/gimprectangletool.c: calculate aspect from
	numerator and denominator.
2006-09-14 17:11:24 +00:00
Sven Neumann
730e5ab597 app/widgets/gimpcontrollereditor.[ch] pass a GimpContext to
2006-09-14  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollereditor.[ch]
	* app/widgets/gimpcontrollerlist.c: pass a GimpContext to
	gimp_viewable_dialog_new().
2006-09-14 08:44:17 +00:00
Sven Neumann
14d80ba157 app/actions/image-actions.c app/dialogs/preferences-dialog.c
2006-09-14  Sven Neumann  <sven@gimp.org>

	* app/actions/image-actions.c
	* app/dialogs/preferences-dialog.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcontrollereditor.c:
	* plug-ins/common/autocrop.c
	* plug-ins/common/max_rgb.c: resolved conflicting mnemonics, added
	some new ones (bug #355761).
2006-09-14 08:24:05 +00:00
Michael Natterer
70cf90b0c8 Don't popup the completion when there is only a single match because we
2006-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerentry.c: Don't popup the completion
	when there is only a single match because we already use inline
	completion.
2006-09-13 22:51:52 +00:00
Michael Natterer
936ee063e1 implement GimpContainerView::set_context() and set the renderers'
2006-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerentry.c: implement
	GimpContainerView::set_context() and set the renderers'
	contexts. Fixes more preview rendering warnings.
	Connect to GtkEntryCompletion::match-selected in addition to
	GtkEntry::changed to select the active item. Makes the whole
	thing work a lot better.
2006-09-13 22:40:24 +00:00
Sven Neumann
a03e14af1a app/composite/gimp-composite-generic.c app/core/gimpimage-convert.c
2006-09-12  Sven Neumann  <sven@gimp.org>

	* app/composite/gimp-composite-generic.c
	* app/core/gimpimage-convert.c
	* app/actions/view-actions.c
	* app/dialogs/grid-dialog.c
	* app/dialogs/offset-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpnavigationeditor.c
	* app/tools/gimpiscissorstool.c
	* app/widgets/gimptoolbox-image-area.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/apply_lens.c
	* plug-ins/common/cubism.c
	* plug-ins/common/curve_bend.c
	* plug-ins/common/exchange.c
	* plug-ins/common/fp.c
	* plug-ins/common/gif.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/laplace.c
	* plug-ins/common/mapcolor.c
	* plug-ins/common/nlfilt.c
	* plug-ins/common/nova.c
	* plug-ins/common/psp.c
	* plug-ins/common/randomize.c
	* plug-ins/common/sparkle.c
	* plug-ins/common/tga.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/common/unsharp.c
	* plug-ins/common/vpropagate.c
	* plug-ins/gfig/gfig-dialog.c
	* plug-ins/gflare/gflare.c
	* plug-ins/ifscompose/ifscompose.c: removed unused macros.
2006-09-12 11:46:10 +00:00
Sven Neumann
541d75a00b removed unused variables.
2006-09-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer-frame.c: removed unused variables.
2006-09-12 10:46:07 +00:00
Sven Neumann
d19c796234 applied a modified patch from David Gowers that changes the search
2006-09-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppaletteeditor.c (gimp_palette_editor_get_index):
	applied a modified patch from David Gowers that changes the search
	behaviour to favour colors in the neighborhood of the selected color
	(bug #355520).
2006-09-12 10:37:45 +00:00
Sven Neumann
bc59e06fc5 removed unused includes.
2006-09-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerpopup.c: removed unused includes.
2006-09-12 07:18:30 +00:00
Sven Neumann
7053e3daac app/tools/gimpclonetool.c app/tools/gimpconvolvetool.c
2006-09-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpperspectiveclonetool.c
	* app/tools/gimpregionselecttool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimpvectortool.c: removed trailing dot from
statusbar
	messages.

	* app/widgets/gimpwidgets-utils.c (gimp_suggest_modifiers):
don't
	use "try" if the modifier action has been specified.
2006-09-12 06:37:54 +00:00
Sven Neumann
ceb1fc5394 string changes.
2006-09-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagepropview.c: string changes.
2006-09-11 21:27:11 +00:00
Sven Neumann
290435c59c added a convenience function to retrieve the translated procedure label.
2006-09-11  Sven Neumann  <sven@gimp.org>

	* app/plug-in/gimppluginmanager.[ch]: added a convenience function
	to retrieve the translated procedure label.

	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpimagepropview.c: use it.
2006-09-11 15:51:39 +00:00
Sven Neumann
b57c52b3b3 corrected comment.
2006-09-11  Sven Neumann  <sven@gimp.org>

	* app/plug-in/gimppluginmanager-locale-domain.h: corrected comment.

	* app/widgets/gimpimagepropview.[ch]: added file related info to
	the Image Properties dialog as requested in bug #86276.
2006-09-11 15:27:21 +00:00
Sven Neumann
b22ab6693e use "Solid color" as description for GIMP_STROKE_STYLE_SOLID.
2006-09-11  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.[ch]: use "Solid color" as description for
	GIMP_STROKE_STYLE_SOLID.

	* app/widgets/gimpstrokeeditor.c: moved "style" control further up
	to make it less ambiguous (bug #309740).

	* app/dialogs/stroke-dialog.c (stroke_dialog_new): pass the context
	to gimp_container_combo_box_new().
2006-09-11 14:17:43 +00:00
Sven Neumann
2426755ba9 added function gimp_get_tool_info().
2006-09-08  Sven Neumann  <sven@gimp.org>

	* app/core/gimp.[ch]: added function gimp_get_tool_info().

	* app/actions/tools-commands.c
	* app/actions/vectors-commands.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptoolbox.c: use the new function instead of poking
	into gimp->tool_info_list.

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.[ch]: moved code that deals with
	the space key into separate functions. Added space_shaded_tool
	to GimpDisplayShell instead of using a static variable for it.

	* app/tools/tool_manager.c: removed unused include.
2006-09-08 13:42:00 +00:00
Sven Neumann
13a2beb532 mark "Space" and "Backslash" for translation (using the same translation
2006-09-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.c: mark "Space" and "Backslash"
	for translation (using the same translation context as in GTK+).
2006-09-08 12:46:53 +00:00
Michael Natterer
1b1497657a Merged the "soc-2006-perspective-clone" branch. That branch is now
2006-09-07  Michael Natterer  <mitch@gimp.org>

	Merged the "soc-2006-perspective-clone" branch. That branch is
	now officially closed and all further fixes and changes have to
	be applied to HEAD.

	Did some minor adjustments, mostly small indentation and spacing
	fixes. Derive the tool from GimpBrushTool and renamed the enum
	added to paint-enums.h and it values, added stock icon and menu
	entry.

	Thanks a lot to Pedro Alonso Ferrer!

	* app/paint/paint-enums.[ch]: new enum GimpPerspectiveCloneMode.

	* app/paint/Makefile.am
	* app/paint/gimpperspectiveclone.[ch]
	* app/paint/gimpperspectivecloneoptions.[ch]: the perspective
	clone core and its options.

	* app/paint/gimp-paint.c: register it.

	* app/tools/Makefile.am
	* app/tools/gimpperspectiveclonetool.[ch]: the perspective clone tool.

	* app/tools/gimp-tools.c: register it.

	* app/tools/gimppaintoptions-gui.c: show the widgets that are used
	by perspective clone.

	* app/widgets/gimphelp-ids.h: the help ID.

	* themes/Default/images/Makefile.am
	* themes/Default/images/tools/stock-tool-perspective-clone-16.png
	* themes/Default/images/tools/stock-tool-perspective-clone-22.png
	* libgimpwidgets/gimpstock.[ch]: its stock ID and icons.

	* menus/image-menu.xml.in: added it to the menu.
2006-09-07 17:10:22 +00:00
Michael Natterer
a76e59de65 don't #include "core/gimptoolinfo.h"
2006-09-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpmenudock.c: don't #include "core/gimptoolinfo.h"
2006-09-05 16:11:47 +00:00
Sven Neumann
4bb2851f56 disabled debug spew.
2006-09-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.c: disabled debug spew.

	* plug-ins/common/raw.c: fixed saving of INDEXEDA drawables. Added
	code to load such files. Fixes bug #354034.
2006-09-05 09:26:28 +00:00
Michael Natterer
db52679583 Merged the "soc-2006-healing-brush" branch. That branch is now officially
2006-09-02  Michael Natterer  <mitch@gimp.org>

	Merged the "soc-2006-healing-brush" branch. That branch is now
	officially closed and all further fixes and changes have to be
	applied to HEAD.

	Did some minor adjustments, mostly small indentation and spacing
	fixes. Derive the tool from the newly introduced GimpBrushTool
	which did not exist when the branch was created.

	Thanks a lot to Kevin Sookocheff for this nice contribution!

	* app/paint/paint-enums.[ch]: new enum GimpHealAlignMode.

	* app/paint/Makefile.am
	* app/paint/makefile.msc
	* app/paint/gimpheal.[ch]
	* app/paint/gimphealoptions.[ch]: the heal core and its options.

	* app/paint/gimp-paint.c: register the heal core.

	* app/tools/Makefile.am
	* app/tools/makefile.msc
	* app/tools/gimphealtool.[ch]: the heal tool.

	* app/tools/gimp-tools.c: register the heal tool.

	* app/tools/gimppaintoptions-gui.c: show the widgets that are used
	by heal.

	* app/widgets/gimphelp-ids.h: the heal help ID.

	* tools/pdbgen/stddefs.pdb
	* tools/pdbgen/pdb/paint_tools.pdb: the heal PDB wrappers.

	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c
	* cursors/Makefile.am
	* cursors/makefile.msc
	* cursors/tool-heal.png
	* cursors/xbm/tool-heal.xbm
	* cursors/xbm/tool-heal-mask.xbm: a new cursor for the heal tool.

	* libgimpwidgets/gimpstock.[ch]
	* themes/Default/images/Makefile.am
	* themes/Default/images/makefile.msc
	* themes/Default/images/tools/stock-tool-heal-16.png
	* themes/Default/images/tools/stock-tool-heal-22.png: new stock
	icons for the heal tool.

	* app/pdb/internal_procs.c
	* app/pdb/paint_tools_cmds.c
	* libgimp/gimppainttools_pdb.[ch]: regenerated.
2006-09-02 18:54:35 +00:00
Michael Natterer
d999499640 This commit *should* fix the remaining missing contexts for preview
2006-09-01  Michael Natterer  <mitch@gimp.org>

	This commit *should* fix the remaining missing contexts for
	preview creation. Eek at me if it doesn't.

	* app/core/gimpundo.c: pass a struct containing a context to
	gimp_undo_create_preview_idle().

	* app/widgets/gimpundoeditor.[ch]: implement
	GimpDocked::set_context(), remember the context and use it for the
	undo treeview.

	* app/widgets/gimpviewrenderergradient.c: disable debugging output.
2006-09-01 21:18:03 +00:00
Michael Natterer
7e7e7480a6 added a context property and use it when creating GimpViews.
2006-09-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpaction.[ch]: added a context property and use
	it when creating GimpViews.

	* app/actions/file-actions.c: set the context on the "Open Recent"
	actions.
2006-09-01 17:12:29 +00:00
Michael Natterer
cc8553fd1e implement set_context() and set the view renderers' contexts.
2006-09-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.c: implement set_context() and
	set the view renderers' contexts.

	(gimp_container_combo_box_insert_item): unselect after inserting
	the first item, GimpContainerView doesn't select items by itself.

	* app/dialogs/image-new-dialog.c: create a local context for the
	combo box, connect to the context's "template-changed" signal
	instead of the combo boxed's "select-item", fix some stuff and
	don't leak the local GimpTemplate.
2006-09-01 16:55:37 +00:00
Michael Natterer
a6dbb78dfa added GimpContext parameters and create the GimpView with that context.
2006-09-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewabledialog.[ch]: added GimpContext
	parameters and create the GimpView with that context.

	* app/widgets/gimpcolordialog.[ch]
	* app/dialogs/convert-dialog.[ch]
	* app/dialogs/desaturate-dialog.[ch]
	* app/dialogs/grid-dialog.[ch]
	* app/dialogs/image-properties-dialog.[ch]
	* app/dialogs/layer-add-mask-dialog.[ch]
	* app/dialogs/offset-dialog.[ch]
	* app/dialogs/print-size-dialog.[ch]
	* app/dialogs/resize-dialog.[ch]
	* app/dialogs/scale-dialog.[ch]
	* app/dialogs/stroke-dialog.[ch]
	* app/dialogs/template-options-dialog.[ch]
	* app/dialogs/vectors-options-dialog.[ch]: added GimpContext
	parameters here too and pass them to gimp_viewable_dialog_new().

	* app/actions/colormap-editor-commands.c
	* app/actions/drawable-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palette-editor-commands.c
	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/dialogs/channel-options-dialog.c
	* app/dialogs/dialogs-constructors.c
	* app/dialogs/image-merge-layers-dialog.c
	* app/dialogs/image-scale-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/display/gimpdisplayshell-filter-dialog.c
	* app/display/gimpdisplayshell-scale.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpcontrollereditor.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimptoolbox-color-area.c: pass contexts to above
	dialog constructors.
2006-09-01 11:26:54 +00:00
Sven Neumann
eeb0b1477f fixed includes for gimp_rectangle_intersect().
2006-09-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererdrawable.c: fixed includes for
	gimp_rectangle_intersect().
2006-09-01 09:04:03 +00:00
Michael Natterer
5e0576af9d ref the context.
2006-09-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrenderer.c
	(gimp_view_renderer_real_set_context): ref the context.
2006-09-01 08:59:24 +00:00
Michael Natterer
875342af5d support setting a context even if the viewed container's children_type is
2006-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerview.c
	(gimp_container_view_real_set_container)
	(gimp_container_view_real_set_context)
	(gimp_container_view_item_selected)
	(gimp_container_view_thaw): support setting a context even if
	the viewed container's children_type is *not* a property of
	GimpContext. This removes a major restriction of container
	views and allows to get rid of some hacks:

	* app/widgets/gimpitemtreeview.[ch]: removed GimpContext member
	and implement GimpContainerView::set_context() instead of
	GimpDocked::set_context().

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimplayertreeview.c: use GimpContainerView's context
	instead of GimpItemTreeView's and implement GimpContainerView's
	set_context() instead of GimpDocked's.

	* app/actions/actions.c (action_data_get_gimp)
	(action_data_get_context): don't special-case GimpItemTreeView any
	more, it's just like a normal GimpContainerView now.

	* app/widgets/gimpcontrollerlist.c
	(gimp_controller_list_constructor): set a context on the
	GimpContainerView so its renderers have a context to use.
2006-08-31 21:40:16 +00:00
Michael Natterer
0699627ad8 remember the context passed to gimp_thumb_box_new() and use it instead of
2006-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.[ch]: remember the context passed to
	gimp_thumb_box_new() and use it instead of the user context when
	creating thumbnails.
2006-08-31 19:02:22 +00:00
Michael Natterer
fcdb536372 removed GimpContext member I added before deciding it needs to be added to
2006-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.[ch] (struct GimpGradientEditor):
	removed GimpContext member I added before deciding it needs to be
	added to GimpDataEditor.

	Use GimpDataEditor's context instead of the bogus one. Also use
	the data editor's context instead of the user context wherever it
	was used.

	* app/widgets/gimppaletteeditor.c: use GimpDataEditor's context
	instead of the user context here too.
2006-08-31 18:54:20 +00:00
Michael Natterer
663b44c988 new funtion which returns TRUE if any of the gradient's segments refer to
2006-08-31  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpgradient.[ch] (gimp_gradient_has_fg_bg_segments):
	new funtion which returns TRUE if any of the gradient's segments
	refer to FG of BG.

	(gimp_gradient_segment_get_left_color_type)
	(gimp_gradient_segment_set_left_color_type)
	(gimp_gradient_segment_get_right_color_type)
	(gimp_gradient_segment_set_right_color_type): new accessors for
	the new GimpGradientColor stuff.

	(gimp_gradient_segment_split_midpoint)
	(gimp_gradient_segment_range_flip)
	(gimp_gradient_segment_range_replicate): split, flip and replicate
	the segments' color_types too.

	* app/widgets/gimpviewrenderer.[ch]: added virtual functions
	::set_context() and ::invalidate() and call them.

	* app/widgets/gimpviewrenderergradient.[ch]: implement the virtual
	functions. Connect to the context's "foreground-changed" and
	"background-changed" signals if the gradient contains FG or BG
	colors and invalidate the renderer whenever they change.

	* app/core/gimp-gradients.c: removed signal connections which
	invalidated the gradients on FG/BG changes of the user context.
2006-08-31 18:47:13 +00:00
Michael Natterer
b53aa45a76 Changed GimpViewable preview rendering to have a context to get
2006-08-29  Michael Natterer  <mitch@gimp.org>

	Changed GimpViewable preview rendering to have a context to get
	FG/BG/whatever from. Use the context to enable dynamic FG/BG
	colors in gradients. Fixes bug #127676 and bug #352214. Addresses
	bug #128367 (doesn't fix it because there's no loading/saving and
	no GUI yet).

	* app/core/core-enums.[ch]: added enum GimpGradientColor to enable
	specifying gradient colors in terms of foreground and background.

	* app/core/gimpgradient.[ch]: added color_type members to the
	GimpGradientSegment struct and honor them in
	gimp_gradient_get_color_at(). Added GimpContext parameters to all
	functions which finally call get_color_at().

	* app/core/gimp-gradients.c: use the new method to implement the
	builtin gradients.

	* app/core/gimpviewable.[ch]: added GimpContext parameters to all
	get_preview() and get_pixbuf() functions.

	* app/core/gimpbrush.c
	* app/core/gimpbuffer.c
	* app/core/gimpdrawable-preview.[ch]
	* app/core/gimpgradient.c
	* app/core/gimpimage-preview.[ch]
	* app/core/gimpimagefile.c
	* app/core/gimppalette.c
	* app/core/gimppattern.c
	* app/core/gimpundo.[ch]
	* app/text/gimpfont.c
	* app/vectors/gimpvectors-preview.[ch]: changed ::get_preview()
	and ::get_pixbuf() implementations accordingly.

	* app/core/gimpdrawable-blend.c
	* app/core/gimppalette-import.[ch]
	* app/dialogs/dialogs-constructors.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/resize-dialog.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpnavigationeditor.c
	* app/paint/gimppaintoptions.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/actions/gradient-editor-commands.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpcellrendererviewable.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpclipboard.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpcontainerentry.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpdataeditor.[ch]
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpthumbbox.[ch]
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpundoeditor.c
	* app/widgets/gimpvectorstreeview.c
	* app/widgets/gimpview-popup.[ch]
	* app/widgets/gimpview.[ch]
	* app/widgets/gimpviewablebutton.c
	* app/widgets/gimpviewabledialog.c
	* app/widgets/gimpviewrenderer.[ch]
	* app/widgets/gimpviewrenderer-frame.c
	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererbuffer.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimage.c
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/gradient.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/image.pdb: added tons of GimpContext members
	and parameters, implement GimpDocked::set_context() in many
	widgets. Pass these locally remembered contexts to GimpViewable
	functions. Did some minor cleanups on the way. There are still
	some minor FIXMEs around where the code uses a NULL context (which
	is allowed by the APIs)

	* app/pdb/drawable_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/gradients_cmds.c
	* app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
Sven Neumann
e6350b15dd app/core/gimpimage-duplicate.c (gimp_image_duplicate) a somewhat hackish
2006-08-29  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-duplicate.c (gimp_image_duplicate)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): a
	somewhat hackish implementation of what's suggested in bug #353246.
	Let the save dialog default to the folder of the duplicated image.
2006-08-29 09:55:34 +00:00
Michael Natterer
9ad621c200 made set_container() a virtual function of the GimpContainerView
2006-08-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerview.[ch]: made set_container() a
	virtual function of the GimpContainerView interface.
2006-08-28 19:40:20 +00:00
Sven Neumann
f234f146e7 app/tools/gimptextoptions.[ch] app/tools/gimptexttool.c make the text
2006-08-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]
	* app/tools/gimptexttool.c
	* app/widgets/gimptexteditor.[ch]: make the text editor transient
	to the display shell.
2006-08-28 15:26:25 +00:00
Michael Natterer
3db2d10539 gimp_show_message_dialog() takes a GtkWidget, cast the dialog variable
2006-08-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_run_callback):
	gimp_show_message_dialog() takes a GtkWidget, cast the dialog
	variable accordingly.
2006-08-28 09:06:10 +00:00
Sven Neumann
bc3c41b648 removed "(Fastest)" from "None" and added translation context (bug
2006-08-23  Sven Neumann  <sven@gimp.org>

        * libgimpbase/gimpbaseenums.[ch]: removed "(Fastest)" from "None"
        and added translation context (bug #343576).

        * app/actions/select-actions.c (select_actions): added translation
        context for "None" and "All".

        * app/widgets/gimpactiongroup.c: strip translation context from
        all labels.

        * libgimpwidgets/gimppageselector.c: fixed singular form.
2006-08-23 14:55:39 +00:00
Hans Breuer
37e4b80204 updated
2006-08-15  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc app/gimpcore.def : updated

	* app/xcf/xcf-save.c(1464) : error C2036: 'void *' : unknown size
	pointer arithmetics on void a pointer looks like a GCC extension
	* app/tools/gimpbrightnesscontrasttool.c
	  app/tools/gimpcolorbalancetool.c
	  app/tools/gimphuesaturationtool.c
	  app/tools/gimpcolorizetool.c : #include "core/gimp.h" for gimp_message
	* app/tools/gimpiscissorstool.c : use RINT() rather than rint()
	* app/widgets/gimpcontrollerlist.c : #include "gimpwidgets-utils.h"
	for gimp_show_message_dialog
	* app/core/gimpprogress.c(229) : 'gimp_progress_message' must
	return a value
2006-08-15 15:13:08 +00:00
Sven Neumann
c2fb42003a introduced a simple message dialog to use when there's no progress but a
2006-08-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: introduced a simple message
	dialog to use when there's no progress but a parent widget.

	* app/dialogs/convert-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpactionview.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppdbdialog.c
	* app/widgets/gimpvectorstreeview.c: use the new utility function
	instead of g_message().
2006-08-11 12:56:26 +00:00
Sven Neumann
3fbf7436c9 added a GError parameter to file_utils_find_proc().
2006-08-10  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: added a GError parameter to
	file_utils_find_proc().

	* app/actions/file-commands.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* tools/pdbgen/pdb/fileops.pdb: changed accordingly.

	* app/pdb/fileops_cmds.c: regenerated.
2006-08-10 21:22:05 +00:00
Sven Neumann
fa7427487f allow to configure the ellipsize property of the text renderer.
2006-08-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainercombobox.[ch]: allow to configure the
	ellipsize property of the text renderer.

	* app/dialogs/image-new-dialog.c: don't pack the template
combo-box
	expanding, unset the ellipsize property.
2006-08-08 22:15:46 +00:00
Sven Neumann
48d054e8d4 added new function gimp_message() as a replacement for g_message(). Part
2006-08-08  Sven Neumann  <sven@gimp.org>

	* app/core/gimp.[ch]: added new function gimp_message() as a
	replacement for g_message(). Part of the fix for bug #347214.

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/layers-commands.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimagefile.c
	* app/core/gimpitem.c
	* app/core/gimplayer.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/pdb/gimppdb.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpwidgets-utils.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-private.h
	* app/xcf/xcf-save.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/brush.pdb
	* tools/pdbgen/pdb/gradient.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/palette.pdb: use gimp_message() instead of
	gimp_message() whenever we have a GimpProgress.

	* app/pdb/brush_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/palette_cmds.c: regenerated.
2006-08-08 21:06:36 +00:00
Sven Neumann
14b9553a2c added missing cast.
2006-08-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_add_string_actions): added missing cast.
2006-08-07 08:31:50 +00:00
Michael Natterer
0005f0ff5d app/pdb/Makefile.am app/pdb/gimppluginprocedure.[ch] removed these
2006-08-05  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/gimppluginprocedure.[ch]
	* app/pdb/gimptemporaryprocedure.[ch]: removed these files...

	* app/plug-in/Makefile.am
	* app/plug-in/gimppluginprocedure.[ch]
	* app/plug-in/gimptemporaryprocedure.[ch]: ...and added them here.

	* app/Makefile.am
	* app/config/Makefile.am: reordered stuff to make it link again.

	* app/pdb/gimppdb.c: removed gimp_pdb_eek() hack.

	* app/actions/plug-in-actions.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/menus/plug-in-menus.c
	* app/plug-in/gimpplugin-message.c
	* app/plug-in/gimpplugin-progress.c
	* app/plug-in/gimpplugin.c
	* app/plug-in/gimppluginmanager-call.c
	* app/plug-in/gimppluginmanager-file.c
	* app/plug-in/gimppluginmanager-query.c
	* app/plug-in/gimppluginmanager.c
	* app/plug-in/gimppluginprocframe.c
	* app/plug-in/plug-in-def.c
	* app/plug-in/plug-in-rc.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/plug_in.pdb: changed includes accordingly.

	* app/pdb/plug_in_cmds.c: regenerated.
2006-08-05 21:21:01 +00:00
Michael Natterer
9dabd23e2d Applied (modified and enhanced) patch from Chris Moller which allows tools
2006-08-05  Michael Natterer  <mitch@gimp.org>

	Applied (modified and enhanced) patch from Chris Moller which allows
	tools to distinguish similar colors not only by composite, but also
	by R, G, B, H, S and V. Fixes bug #348291.

	* app/core/core-enums.[ch]: added new enum GimpSelectCriterion
	which can be one of { COMPOSITE, R, G, B, H, S, V }.

	* app/core/gimpimage-contiguous-region.[ch]: added
	select_criterion params and create the region based on difference
	by the selected criterion.

	* app/core/gimpchannel-select.[ch]
	* app/core/gimpdrawable-bucket-fill.[ch]: take criterion params and
	pass them through to the contiguous region functions.

	* app/tools/gimpbucketfilloptions.[ch]
	* app/tools/gimpselectionoptions.[ch]: added criterion properties
	and GUI to select it.

	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpfuzzyselecttool.c: pass the selected criterion to
	the resp. core functions.

	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/display/gimpdisplayshell-dnd.c
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/selection_tools.pdb: changed accordingly
	(simply pass GIMP_SELECT_CRITERION_COMPOSITE in most cases).

	* app/pdb/edit_cmds.c
	* app/pdb/selection_tools_cmds.c: regenerated.
2006-08-05 13:02:47 +00:00
Michael Natterer
3de105e9c5 some doc fixes.
2006-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c: some doc fixes.
2006-08-04 09:41:09 +00:00
Raphael Quinet
a54a6b162c app/widgets/gimpwidgets-utils.h New utility function to build status bar
2006-08-02  Raphael Quinet  <raphael@gimp.org>

	* app/widgets/gimpwidgets-utils.h
	* app/widgets/gimpwidgets-utils.c (gimp_suggest_modifiers):
	New utility function to build status bar messages while allowing
	dynamic names for the modifiers.

	* app/tools/gimppainttool.h
	* app/tools/gimppainttool.c: Added new members to the class in
	order to allow paint tools to set different status messages for
	the normal case or when drawing a line.

	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpsmudgetool.c: Use the new functions to set
	appropriate messages in the status bar.  Still work in progress,
	partial fix for bug #124040.

	* app/tools/gimpvectortool.c: Use gimp_suggest_modifiers().
2006-08-01 23:42:12 +00:00
Michael Natterer
c09e7f5914 removed code that was special-casing RTL since
2006-07-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): removed code that was
	special-casing RTL since gtk_tree_view_get_path_at_pos() takes
	this correctly into account now. Fixes bug #348347.

	* app/widgets/gimpdockable.c (gimp_dockable_size_allocate): fix
	menu button positioning for RTL.
2006-07-26 09:47:05 +00:00
Michael Natterer
8ae28a136c use file_utils_uri_display_basename() instead of g_path_get_basename() to
2006-07-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): use
	file_utils_uri_display_basename() instead of g_path_get_basename()
	to get an uri's basename. Fixes bug #347544.
2006-07-18 08:44:14 +00:00
Sven Neumann
bb77afc127 fixed potential crash based on a patch from David Gowers (bug #347593).
2006-07-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppaletteeditor.c (gimp_palette_editor_get_index,
	 gimp_palette_editor_set_index, gimp_palette_editor_max_index):
	fixed potential crash based on a patch from David Gowers (bug #347593).
2006-07-18 07:45:54 +00:00
Sven Neumann
68f562226c app/widgets/gimpcoloreditor.c in the tooltip for the hex entry, mention
2006-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcoloreditor.c
	* libgimpwidgets/gimpcolorselection.c: in the tooltip for the hex
	entry, mention that it also accepts CSS color names.

	* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal):
	use an invisible event box for the tooltip.
2006-07-07 11:19:52 +00:00
Michael Natterer
6feb7bb82c depend on glib >= 2.10.2, gtk+ >= 2.8.18 and pango >= 1.12.3. Define
2006-07-05  Michael Natterer  <mitch@gimp.org>

	* configure.in: depend on glib >= 2.10.2, gtk+ >= 2.8.18
	and pango >= 1.12.3. Define FOO_DISABLE_DEPRECATED also for
	glib 2.12, gtk+ 2.10 and pango 2.14

	* app/sanity.c
	* app/gui/gui.c: adjusted sanity checks accordingly.

	* app/dialogs/stroke-dialog.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpuimanager.c
	* libgimpwidgets/gimphelpui.c
	* libgimpwidgets/gimpmemsizeentry.c
	* plug-ins/helpbrowser/gimpthrobber.c: replace gtk_object_sink()
	by combinations of g_object_ref_sink() and g_object_unref().
2006-07-05 13:40:47 +00:00
Sven Neumann
7dfeb72203 ellipsize the filename label.
2006-07-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.c: ellipsize the filename label.
2006-07-05 08:10:22 +00:00
Simon Budig
a306b34f5e unref the old StrokeOptions when new ones get set as a property. Spotted
2006-06-30  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpstrokeeditor.c: unref the old StrokeOptions
	when new ones get set as a property. Spotted by Henk Boom.
2006-06-30 00:03:33 +00:00
Sven Neumann
dd5962fa67 Applied patch from Zbigniew Chyla (bug 345982):
2006-06-27  Sven Neumann  <sven@gimp.org>

	Applied patch from Zbigniew Chyla (bug 345982):

	* app/widgets/gimpactiongroup.c
(gimp_action_group_add_string_actions)
	strip translation context from translated entries[i].label.

	* app/tools/gimpmagnifytool.c: added translation context.
2006-06-27 20:11:31 +00:00
Sven Neumann
7b1327dd86 I18n improvements based on a patch from Zbigniew Chyla:
2006-06-27  Sven Neumann  <sven@gimp.org>

	I18n improvements based on a patch from Zbigniew Chyla:

	* app/main.c:
	* modules/controller_midi.c
	* plug-ins/script-fu/scripts/guides-new.scm: marked strings for
	translation.

	* app/widgets/gimpdock.c
	* libgimpwidgets/gimppageselector.c
	* plug-ins/common/plugin-browser.c: use ngettext() for plural
forms.
2006-06-27 07:49:14 +00:00
Michael Natterer
03c929240d don't try to set "." as current_folder_uri.
2006-06-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): don't
	try to set "." as current_folder_uri.
2006-06-20 18:35:00 +00:00
Sven Neumann
7e82d1623d app/actions/error-console-commands.c app/display/gimpdisplayshell-draw.c
2006-06-19  Sven Neumann  <sven@gimp.org>

	* app/actions/error-console-commands.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-scale.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpcellrendereraccel.c
	* app/widgets/gimpviewabledialog.c
	* app/widgets/gimpviewrenderer.c: changed casts in calls to
	g_object_add_weak_pointer() to silence compiler warnings.
2006-06-19 17:50:40 +00:00
Michael Natterer
6f90261568 put the event box' event window above its children because now that it is
2006-06-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_get_tab_widget): put
	the event box' event window above its children because now that it
	is input-only, it won't receive events that are not in its
	childrens' event mask if the event window is below.
	Fixes bug #345137.
2006-06-17 09:36:18 +00:00
Michael Natterer
c24c1fe064 always call gtk_file_chooser_set_current_folder_uri() and
2006-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image):
	always call gtk_file_chooser_set_current_folder_uri() and
	gtk_file_chooser_set_current_name() instead of
	gtk_file_chooser_set_uri(), since the latter only works if the
	file exists and its return value is bogus. Fixes bug #343284.
2006-06-17 09:32:30 +00:00
Sven Neumann
cba830e75b fixed casts to silence compiler warnings.
2006-06-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpview.c: fixed casts to silence compiler
warnings.
2006-06-17 08:51:47 +00:00
Michael Natterer
88dedcc424 Allow plug-ins to register in <Layers>, <Channels>, <Vectors> and
2006-06-16  Michael Natterer  <mitch@gimp.org>

	Allow plug-ins to register in <Layers>, <Channels>, <Vectors> and
	<ColormapEditor>:

	* app/pdb/gimppluginprocedure.c
	(gimp_plug_in_procedure_add_menu_path): added the argument type
	checks for the new locations. Factored out duplicated code.

	* app/menus/menus.c (menus_init): add the "plug-in" action
	group to the resp. UI managers.

	* app/menus/plug-in-menus.c (plug_in_menus_menu_path_added):
	support them here too.

	* app/widgets/gimpimageeditor.[ch]
	* app/widgets/gimpitemtreeview.[ch]: added get_image() functions.

	* app/actions/plug-in-commands.c: added new utility functions
	which collect plug-in arguments from GimpImageEditor and
	GimpItemTreeView widgets.

	* menus/channels-menu.xml
	* menus/colormap-editor-menu.xml
	* menus/layers-menu.xml
	* menus/vectors-menu.xml: added separators.

	* menus/image-menu.xml.in: added a "Colormap" placeholder in
	Colors/Map

	* plug-ins/common/colormap-remap.c (query): register a menu
	entry in <ColormapEditor> and moved the existing one to the
	"Colormap" placeholder. Also register an icon to make this
	menu item clearly distinct from the others in that menu.

	Unrelated:

	* plug-ins/common/colormap-remap.c (run): cleaned up quite a
	bit. Fixed last-vals code and simplified map handling.

	(remap_swap): removed, folded into run().

	(remap_dialog): use the passed map to initialize the dialog so it
	starts with the last-vals. Tweaked layout to have 16 columns
	and simplified cell renderer creation.
2006-06-16 17:02:14 +00:00
Michael Natterer
1a635e06a0 set the event box' window invisible so we get the right background with
2006-06-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_get_tab_widget): set
	the event box' window invisible so we get the right background
	with all themes.
2006-06-15 10:44:24 +00:00
William Skaggs
701b7b31d7 Bill Skaggs <weskaggs@primate.ucdavis.edu>
Finally implemented the suggestion in bug #144854, of
	"strong" undo/redo commands that continue undoing so long
	as they only encounter visibility changes.

	* app/actions/edit-actions.c
	* app/actions/edit-commands.c
	* app/actions/edit-commands.h: added "strong undo"
	and "strong redo" commands/actions.

	* app/core/gimpimage-undo.[ch]: added functions
	gimp_image_strong_undo() and gimp_image_strong_redo().

	* app/core/gimpundo.[ch]: added utility function
	gimp_undo_is_weak().

	* app/widgets/gimphelp-ids.h:added id's.

	* menus/image-menu.xml.in: added to edit menu,
	bound to C-S-z and C-S-y.

	This will no doubt need tweaking, but I will consider it
	to fix bug #144854.
2006-06-13 02:03:44 +00:00
William Skaggs
36ee184375 Bill Skaggs <weskaggs@primate.ucdavis.edu>
Here is the big change-over, finally.

	* app/tools/gimprectselecttool.[ch]: removed.

	* app/tools/Makefile.am
	* app/tools/gimp-tools.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpellipseselecttool.h
	* app/tools/gimpnewrectselectoptions.c
	* app/tools/gimpnewrectselectoptions.h
	* app/tools/gimpnewrectselecttool.c
	* app/tools/gimpnewrectselecttool.h
	* app/tools/gimpselectionoptions.c
	* app/widgets/gimptoolbox.c
	* menus/image-menu.xml.in: get rid of the "new" in everything
	referring to the new rect select tool, except filenames.  This
	will wait for yosh to perform cvs-magic-foo.

	* app/tools/gimprectangleoptions.[ch]
	* app/tools/gimprectangletool.[ch]: fix a couple of minor
	problems that popped up during testing.
2006-06-10 18:24:58 +00:00
Michael Natterer
10c8c709d3 simply use gimp_button_new() instead of g_object_new(). Don't set the
2006-06-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): simply
	use gimp_button_new() instead of g_object_new(). Don't set the
	"use-stock" property and reordered some code. Keeps GtkButton from
	thinking that is has constructed the button's child itself and
	thus makes the function more rubust against changes in GtkButton.
2006-06-10 17:48:33 +00:00
Sven Neumann
75815e3a23 app/actions/error-console-commands.[ch] app/widgets/gimphelp-ids.h added
2006-06-07  Sven Neumann  <sven@gimp.org>

	* app/actions/error-console-actions.c:
	* app/actions/error-console-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/error-console-menu.xml: added "select-all" action as
	suggested in bug #328838.
2006-06-07 13:47:55 +00:00
Michael Natterer
c2928c8721 changed mnemonic from "_Preview" to "Pr_eview" because the GTK+ HEAD file
2006-06-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): changed
	mnemonic from "_Preview" to "Pr_eview" because the GTK+ HEAD
	file chooser has a "_Places" mnemonic now.

	* app/widgets/gimpcomponenteditor.c: minor cleanup.
2006-06-04 11:49:30 +00:00
Michael Natterer
962282fe5f use gimp_rgba_distance() instead of gimp_rgb_distance(), so alpha changes
2006-06-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_set_color): use
	gimp_rgba_distance() instead of gimp_rgb_distance(), so alpha
	changes update the color frame too.
2006-06-04 11:39:22 +00:00
Michael Natterer
d1a76d93f7 cursors/Makefile.am cursors/cursor-corner-bottom-left.png
2006-06-02  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/cursor-corner-bottom-left.png
	* cursors/cursor-corner-bottom-right.png
	* cursors/cursor-corner-top-left.png
	* cursors/cursor-corner-top-right.png
	* cursors/cursor-side-bottom.png
	* cursors/cursor-side-left.png
	* cursors/cursor-side-right.png
	* cursors/cursor-side-top.png
	* cursors/xbm/cursor-corner-bottom-left-mask.xbm
	* cursors/xbm/cursor-corner-bottom-left.xbm
	* cursors/xbm/cursor-corner-bottom-right-mask.xbm
	* cursors/xbm/cursor-corner-bottom-right.xbm
	* cursors/xbm/cursor-corner-top-left-mask.xbm
	* cursors/xbm/cursor-corner-top-left.xbm
	* cursors/xbm/cursor-corner-top-right-mask.xbm
	* cursors/xbm/cursor-corner-top-right.xbm
	* cursors/xbm/cursor-side-bottom-mask.xbm
	* cursors/xbm/cursor-side-bottom.xbm
	* cursors/xbm/cursor-side-left-mask.xbm
	* cursors/xbm/cursor-side-left.xbm
	* cursors/xbm/cursor-side-right-mask.xbm
	* cursors/xbm/cursor-side-right.xbm
	* cursors/xbm/cursor-side-top-mask.xbm
	* cursors/xbm/cursor-side-top.xbm: new cursors for edge and corner
	resizing. They perfectly align with the small crosshair and can be
	used together with tool cursors and cursor modifiers.

	* cursors/gimp-tool-cursors.xcf: add them here too.

	* app/widgets/widgets-enums.h: add them to the GimpCursorType enum.

	* app/widgets/gimpcursor.c: add them here too.

	* app/display/gimpdisplayshell-cursor.c: treat them like the small
	crosshair (don't replace them by the small crosshair but use them
	as-is). Also allow the bad modifier with the large crosshair.

	* app/tools/gimprectangletool.c
	(gimp_rectangle_tool_cursor_update): use the new cursors. Don't
	call gimp_tool_set_cursor() here.

	(gimp_rectangle_tool_response): reset "function" to RECT_CREATING
	when resetting the tool.

	* app/tools/gimpselectiontool.[ch] (struct GimpSelectionTool):
	added boolean member "allow_move" which defalts to TRUE.

	(gimp_selection_tool_oper_update): don't move masks, floating
	selections or anything when "allow_move" is FALSE. Changed
	behavior of click inside a selection to simply create a new
	selection, need to press alt+shift now to drag-float the
	selection. Please test this, it's apretty fundamental change!

	(gimp_selection_tool_cursor_update): use the tool's configured
	cursor instead of always GIMP_CURSOR_MOUSE, so this function can
	be called after gimp_rectangle_tool_cursor_update() to add the
	plus, minus etc. modifiers.

	* app/tools/gimpnewrectselecttool.c: implement
	GimpTool::cursor_update() and call
	gimp_rectangle_tool_cursor_update() from there. Chain up to get
	the plus, minus etc. modifiers added.

	Re-enble selection moving:

	(gimp_new_rect_select_tool_oper_update): set GimpSelectionTool's
	"allow_move" to FALSE unless the rectangle tool is in an idle
	state.

	(gimp_new_rect_select_tool_button_press): allow a selection moving
	to be started if the rectangle tool is idle. Fall back to starting
	a rect select if gimp_selection_tool_start_edit() returned FALSE.
2006-06-02 15:23:47 +00:00
Michael Natterer
3f7b118225 cursors/Makefile.am cursors/modifier-bad.png
2006-06-01  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/modifier-bad.png
	* cursors/xbm/modifier-bad-mask.xbm
	* cursors/xbm/modifier-bad.xbm: new "bad" cursor
	modifier. Replaces the "bad" cursor.

	* cursors/gimp-tool-cursors.xcf: added it here too.

	* app/widgets/widgets-enums.h: added GIMP_CURSOR_MODIFIER_BAD.

	* app/widgets/gimpcursor.c: add the bad modifier. Leave the bad
	cursor there for now.

	* app/display/gimpdisplayshell-callbacks.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolortool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: use the modifier instead of the
	cursor. Fixes hotspot jumping when switching between normal and
	bad cursors. The changed cursor_update() functions even make more
	sense IMHO. Fixes bug #158407.
2006-06-01 20:30:52 +00:00
Michael Natterer
8903c67fb0 app/widgets/gimpdataeditor.c (gimp_data_editor_name_activate) strip the
2006-05-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.c (gimp_data_editor_name_activate)
	* app/widgets/gimpdatafactoryview.c
	(gimp_data_factory_view_tree_name_edited): strip the newly
	entered name from whitespace and reject empty names.
2006-05-30 11:56:42 +00:00
Sven Neumann
80bddf14a9 code cleanup; only call gtk_window_present() if called with present ==
2006-05-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factory_dialog_new_internal): code cleanup; only call
	gtk_window_present() if called with present == TRUE.
2006-05-29 16:41:18 +00:00
Michael Natterer
ae0cfe3dc0 make sure text widgets get all key events first. Fixes bug #301006.
2006-05-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdock.c (gimp_dock_key_press_event): make sure
	text widgets get all key events first. Fixes bug #301006.
2006-05-29 12:33:18 +00:00
Michael Natterer
17475c5fec Applied patch from David Gowers which adds actions to select palette and
2006-05-28  Michael Natterer  <mitch@gimp.org>

	Applied patch from David Gowers which adds actions to select
	palette and colormap colors with actions. Modified the patch quite
	a bit. Fixes bug #130123.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: add functions get_index()
	which gets the currently selected color's index (optionally the
	index of a passed color), set_index() which sets the selected
	color by index, and max_index() which returns the maximum possible
	color index.

	* app/dialogs/dialogs-constructors.c: changed accordingly.

	* app/actions/context-actions.c
	* app/actions/context-commands.[ch]: actions and callbacks which
	use the new functions.
2006-05-28 19:45:52 +00:00
Karine Delvare
1ce44a4555 app/core/gimpcontext.c app/tools/gimp-tools.c
2006-05-23  Karine Delvare  <edhel@gimp.org>

	* app/core/gimpcontext.c
	* app/tools/gimp-tools.c
	* app/tools/gimpnewrectselecttool.c
	* app/tools/gimprectselecttool.c
	* app/widgets/gimptoolbox.c
	* menus/image-menu.xml.in: replace old rect select by new in the
	toolbox.
2006-05-23 18:14:51 +00:00
Michael Natterer
a5de974a8f One of the following changes fixes a crash on exit when there is a cut
2006-05-21  Michael Natterer  <mitch@gimp.org>

	One of the following changes fixes a crash on exit when there is a
	cut buffer and a clipboard manager is runnig. I don't care which,
	since they are all the right thing to do:

	* app/widgets/gimpdialogfactory.c (gimp_dialog_factory_finalize):
	don't remove the factory from the hash table of all factories here...

	(gimp_dialog_factory_dispose): ...but here. Use the right key for
	the toolbox factory.

	(gimp_dialog_factories_set_busy)
	(gimp_dialog_factories_unset_busy): check the return value of
	g_type_class_ref() before using it.

	Unrelated:

	(gimp_dialog_factory_dispose): free the list of open dialogs here,
	not in dispose(). Don't leak all the factory's session infos.
2006-05-21 15:32:20 +00:00
Sven Neumann
414e661696 connect to the chain-button and update the "keep-aspect" property when it
2006-05-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.c: connect to the chain-button and
	update the "keep-aspect" property when it is toggled.
2006-05-19 10:45:25 +00:00
Michael Natterer
d7cd890c9c app/core/Makefile.am app/core/core-types.h new GimpPattern subclass that
2006-05-16  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppatternclipboard.[ch]: new GimpPattern subclass
	that auto-updates its contents from gimp->global_buffer.

	* app/core/gimp.c (gimp_real_initialize): add a clipboard pattern
	to the pattern factory.

	* app/widgets/gimpaction.c (gimp_action_set_proxy): replace the
	GimpView by a new one if the viewable type changes, instead of
	running into a warning (didn't happen before because this is only
	used for imagefiles and patterns, which didn't have subclasses).
2006-05-16 19:55:01 +00:00
Sven Neumann
6ebcf700d1 removed erroneous semicolon after G_DEFINE_TYPE macros.
2006-05-15  Sven Neumann  <sven@gimp.org>

	* app/*/*.c:
	* lib*/*.c: removed erroneous semicolon after G_DEFINE_TYPE macros.
2006-05-15 09:46:31 +00:00
Michael Natterer
875af9c5cd Added some new text layer actions and menu items (bug #316299).
2006-05-13  Michael Natterer  <mitch@gimp.org>

	Added some new text layer actions and menu items (bug #316299).

	* app/actions/layers-actions.c: added actions for "Text to Path",
	"Text along Path" and "Text to Selection" (use the alpha to
	selection callback for text to selection)

	* app/actions/layers-commands.[ch]: added
	layers_text_to_vectors_cmd_callback() and
	layers_text_along_vectors_cmd_callback().

	* app/widgets/gimphelp-ids.h: help IDs for the new actions.

	* menus/image-menu.xml.in
	* menus/layers-menu.xml: added them to the layers menus in the
	image window and the layers dialog.
2006-05-13 19:48:18 +00:00
Michael Natterer
5e24dcf258 save 20 bytes per instance by using single bits instead of 6 gbooleans.
2006-05-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpview.h: save 20 bytes per instance by using
	single bits instead of 6 gbooleans.

	* app/widgets/gimpview.c: some code cleanup.

	* app/widgets/gimpviewrendererbrush.c: don't #include "gimpbrush.h".

	* app/widgets/gimpviewrendererbuffer.c: #include "gimpviewable.h"
	instead of "gimpbuffer.h".

	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimagefile.c
	* app/widgets/gimpviewrendererimagefile.h: micro cosmetics.
2006-05-12 15:52:00 +00:00
Michael Natterer
401b865e22 save 20 bytes per instance by using single bits instead of 6 gbooleans.
2006-05-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpview.h: save 20 bytes per instance by using
	single bits instead of 6 gbooleans.

	* app/widgets/gimpview.c: some code cleanup.

	* app/widgets/gimpviewrendererbrush.c: don't #include "gimpbrush.h".

	* app/widgets/gimpviewrendererbuffer.c: don't #include "gimpbuffer.h".

	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimagefile.c
	* app/widgets/gimpviewrendererimagefile.h: micro cosmetics.
2006-05-12 15:39:31 +00:00
Michael Natterer
8cabdbe55c app/widgets/gimpviewrendererbrush.c use gimp_viewable_get_size() and get
2006-05-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererbuffer.c: use
	gimp_viewable_get_size() and get rid of useless
	local "brush" and "buffer" variables.
2006-05-10 20:23:28 +00:00
Michael Natterer
bca167a50e code cleanup, no logic changed.
2006-05-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c: code cleanup, no logic changed.

	* app/widgets/gimptoolbox-color-area.c: make the very first click
	on the color area work as expected.
2006-05-10 11:23:11 +00:00
Michael Natterer
95cc2ecb1e set the alternative button order here...
2006-05-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): set the
	alternative button order here...

	* app/dialogs/file-open-dialog.c (file_open_dialog_new)
	* app/dialogs/file-save-dialog.c (file_save_dialog_new): ...instead
	of here.
2006-05-08 15:43:21 +00:00
Michael Natterer
bc06f94e47 hide the button bar, which is useless for the brush editor. Fixes user
2006-05-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbrusheditor.c: hide the button bar, which is
	useless for the brush editor. Fixes user confusion (bug #306704).
2006-05-06 22:04:56 +00:00
Michael Natterer
5a586ba672 changed parameter "gint display_ID" to "GimpObject *display".
2006-05-05  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/gimppluginmanager-call.[ch]
	(gimp_plug_in_manager_call_run): changed parameter "gint display_ID"
	to "GimpObject *display".

	* app/pdb/gimpprocedure.[ch]
	* app/pdb/gimppluginprocedure.c
	* app/pdb/gimptemporaryprocedure.c: changed
	GimpProcedure::execute_async() the same way.

	* app/plug-in/gimppluginmanager.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/widgets/gimphelp.c: changed accordingly.
2006-05-05 08:29:33 +00:00
Michael Natterer
808b65cd31 added signals "plug-in-opened" and "plug-in-closed". Added functions
2006-05-05  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/gimppluginmanager.[ch]: added signals
	"plug-in-opened" and "plug-in-closed". Added functions
	gimp_plug_in_manager_add_open_plug_in() and _remove_open_plugin()
	which maintain the list of open plug-ins and emit the signals.

	* app/plug-in/gimpplugin.c (gimp_plug_in_open)
	(gimp_plug_in_close): don't touch manager->open_plug_ins and don't
	ref/unref the plug-in. Call above new functions instead. Don't
	call gimp_pdb_dialogs_check().

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: removed gimp_pdb_dialogs_check().

	* app/widgets/gimppdbdialog.[ch]: removed
	gimp_pdb_dialogs_check_callback() and connect to the
	plug-in-manager's "plug-in-closed" signal instead.
2006-05-04 22:51:21 +00:00
Michael Natterer
b739fd5a32 port to using gimp_selection_data_get_object(), it was simply forgotten.
2006-05-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.c
	(gimp_selection_data_get_tool_info): port to using
	gimp_selection_data_get_object(), it was simply forgotten.
	Fixes tool dropping (bug #336402).
2006-05-03 19:03:44 +00:00
Sven Neumann
dfe7e8bb17 turned a #warning into an explanation because the bug it referred to is
2006-05-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainercombobox.c
	(gimp_container_combo_box_remove_item): turned a #warning into an
	explanation because the bug it referred to is marked as WONTFIX.
2006-05-02 09:02:18 +00:00
Michael Natterer
74a27a001a NULL-terminate string arrays here too, so they can be freed with
2006-04-29  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/gimppluginmanager-locale-domain.c
	(gimp_plug_in_manager_get_locale_domains): NULL-terminate string
	arrays here too, so they can be freed with g_strfreev() (even
	though they currently aren't).

	* app/widgets/gimphelp.c: set the plug-in arguments
	correctly. Fixes warnings and makes help work again.
2006-04-29 17:55:42 +00:00
Michael Natterer
f1c3e79a4b app/plug-in/Makefile.am app/plug-in/plug-in-types.h new object which keeps
2006-04-29  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-types.h
	* app/plug-in/gimppluginmanager.[ch]: new object which keeps all
	plug-in related stuff that was kept in the Gimp instance. Has
	"menu-branch-added" and "last-plug-in-changed" signals.

	* app/plug-in/plug-ins.[ch]: removed, all its functions are in
	GimpPlugInManager now.

	* app/core/gimpmarshal.list: new marshaller for the new object.

	* app/core/gimp.[ch]: removed all plug-in related stuff and keep a
	GimpPlugInManager around.

	* app/plug-in/plug-in-data.[ch]
	* app/plug-in/plug-in-file.[ch]
	* app/plug-in/plug-in-help-domain.[ch]
	* app/plug-in/plug-in-locale-domain.[ch]
	* app/plug-in/plug-in-menu-branch.[ch]
	* app/plug-in/plug-ins-query.[ch]: removed...

	* app/plug-in/gimppluginmanager-data.[ch]
	* app/plug-in/gimppluginmanager-file.[ch]
	* app/plug-in/gimppluginmanager-help-domain.[ch]
	* app/plug-in/gimppluginmanager-locale-domain.[ch]
	* app/plug-in/gimppluginmanager-menu-branch.[ch]
	* app/plug-in/gimppluginmanager-query.[ch]: ...and added as
	methods of GimpPlugInManager.

	* app/plug-in/plug-in-debug.[ch]
	* app/plug-in/plug-in-shm.[ch]: removed...

	* app/plug-in/gimpplugindebug.[ch]
	* app/plug-in/gimppluginshm.[ch]: ...and added as properly
	namespeced structs with constructors and destructors.

	* app/core/Makefile.am
	* app/core/gimpenvirontable.[ch]
	* app/core/gimpinterpreterdb.[ch]: removed...

	* app/plug-in/gimpenvirontable.[ch]
	* app/plug-in/gimpinterpreterdb.[ch]: ...and added here unchanged.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: remove gimp_menus_create_branch() and all
	related stuff.

	* app/actions/plug-in-actions.[ch]: connect to the
	plug-in-manager's "menu-path-added" signal and create menu branch
	actions accordingly.

	* app/plug-in/plug-in-context.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/app_procs.c
	* app/actions/file-commands.c
	* app/actions/plug-in-commands.c
	* app/core/gimpimage.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/gui/gui.c
	* app/menus/plug-in-menus.c
	* app/pdb/gimppluginprocedure.c
	* app/pdb/gimptemporaryprocedure.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpthumbbox.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/context.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/message.pdb
	* tools/pdbgen/pdb/plug_in.pdb
	* tools/pdbgen/pdb/procedural_db.pdb
	* tools/pdbgen/pdb/progress.pdb
	* tools/pdbgen/pdb/undo.pdb: follow above refactoring.

	* app/pdb/context_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/fileops_cmds.c
	* app/pdb/help_cmds.c
	* app/pdb/message_cmds.c
	* app/pdb/plug_in_cmds.c
	* app/pdb/procedural_db_cmds.c
	* app/pdb/progress_cmds.c
	* app/pdb/undo_cmds.c: regenerated.
2006-04-28 22:26:51 +00:00
Sven Neumann
e779cf0b0f added "has_alpha" to GimpParamSpecRGB. Made the GimpParamSpecRGB struct
2006-04-27  Sven Neumann  <sven@gimp.org>

	* libgimpcolor/gimprgb.[ch]: added "has_alpha" to GimpParamSpecRGB.
	Made the GimpParamSpecRGB struct public. When validating a color,
	only look at the alpha channel if has_alpha is set.

	* libgimpconfig/gimpconfig-params.h: added "has_alpha" to
	GIMP_CONFIG_INSTALL_PROP_RGB macro definition.

	* libgimpconfig/gimpconfig-serialize.c: serialize color values as
	"(rgb r g b)" if the param-spec indicates that the alpha channel
	is meaningless.

	* app/config/gimpconfig-dump.c: take "has_alpha" into account when
	documenting color properties.

	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* libgimpwidgets/gimpcolorarea.c
	* libgimpwidgets/gimpcolorbutton.c: specify whether color properties
	have an alpha channel.

	* tools/pdbgen/app.pl: handle "has_alpha" for color paramaters.

	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/context.pdb
	* tools/pdbgen/pdb/grid.pdb
	* tools/pdbgen/pdb/image.pdb: set the "has_alpha" flag where
	appropriate.

	* app/pdb/gimp-pdb-compat.c (gimp_pdb_compat_param_spec): set
	"has_alpha" to TRUE for GIMP_PDB_COLOR.

	* app/pdb/channel_cmds.c
	* app/pdb/context_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/grid_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/palette_cmds.c
	* app/pdb/palettes_cmds.c
	* app/pdb/selection_tools_cmds.c: regenerated.

	* app/config/gimpdisplayconfig.c (gimp_display_config_class_init):
	removed unused code.
2006-04-27 15:19:59 +00:00
Michael Natterer
53eb43fe91 use a GParamSpecObject instead of GParamSpecPointer for the "procedure"
2006-04-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppluginaction.[ch]: use a GParamSpecObject instead
	of GParamSpecPointer for the "procedure" property. Keep a reference
	on the action's procedure. Did a global s/proc/procedure/.
2006-04-27 12:48:12 +00:00
Michael Natterer
f65bd53e58 app/pdb/Makefile.am app/pdb/pdb-types.h new object GimpPDB which keeps all
2006-04-26  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/pdb-types.h
	* app/pdb/gimppdb.[ch]: new object GimpPDB which keeps all
	procedures and functions to register and run them. Renamed all
	functions and did some cleanups.

	* app/pdb/gimp-pdb.[ch]
	* app/core/gimp.[ch]: removed the same stuff here.

	* app/pdb/gimp-pdb-query.[ch]: removed these files...

	* app/pdb/gimppdb-query.[ch]: ...added here as members of GimpPDB.

	* app/pdb/gimp-pdb-compat.h: fix include guard.

	* app/batch.c
	* app/actions/vectors-commands.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimphelp.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed includes and function
	calls accordingly.

	* tools/pdbgen/app.pl: pass around GimpPDB instead of Gimp
	pointers to register the internal procedures with. Changed some
	newlines in the generated code.

	* app/pdb/*_cmds.c
	* app/pdb/internal_procs.[ch]: regenerated.

	* app/core/gimppdbprogress.[ch]
	* app/widgets/gimppdbdialog.[ch]: added "pdb" CONSTRUCT_ONLY
	properties.

	* app/plug-in/plug-in-progress.c
	* app/gui/gui-vtable.c: pass gimp->pdb when creating them.

	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: use the new local pdb pointers
	instead of some foo->bar->gimp->pdb overkill.
2006-04-26 09:13:47 +00:00
Sven Neumann
9508618a50 added "viewable" as a property.
2006-04-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: added "viewable" as a property.
2006-04-23 02:28:15 +00:00
Sven Neumann
7755ec12dd app/dialogs/module-dialog.c use GimpDialog instead of a GimpViewableDialog
2006-04-23  Sven Neumann  <sven@gimp.org>

	* app/dialogs/module-dialog.c
	* app/dialogs/palette-import-dialog.c: use GimpDialog instead of a
	GimpViewableDialog with a NULL viewable.

	* app/widgets/gimpviewabledialog.c: deprecate use of
	GimpViewableDialog with a NULL viewable.

	* app/dialogs/resolution-calibrate-dialog.c: whitespace.
2006-04-23 02:15:16 +00:00
Sven Neumann
090974f235 app/base/curves.c minor code cleanup, removed trailing whitespace.
2006-04-21  Sven Neumann  <sven@gimp.org>

	* app/base/curves.c
	* app/widgets/gimpsessioninfo.c: minor code cleanup, removed
	trailing whitespace.
2006-04-21 07:02:42 +00:00
Tor Lillqvist
94d8a4131b New helper function. Same functionality as
2006-04-20  Tor Lillqvist  <tml@novell.com>

	* app/widgets/gimpsessioninfo.c (get_appropriate_monitor): New
	helper function. Same functionality as
	gdk_screen_get_monitor_at_window(), except that it takes a window
	geometry as parameter and not the window itself.
	(gimp_session_info_set_geometry): Make sure the window is
	completely inside a monitor. (#339099, #324254)
2006-04-20 18:41:38 +00:00
Michael Natterer
3fac0dd74f fix parameter name in API docs.
2006-04-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.c (gimp_clipboard_set_buffer): fix
	parameter name in API docs.
2006-04-15 16:49:59 +00:00
Sven Neumann
049872b361 app/*.[ch] converted tabs to spaces.
2006-04-12  Sven Neumann  <sven@gimp.org>

	* app/*.[ch]
	* app/*/*.[ch]: converted tabs to spaces.
2006-04-12 12:49:29 +00:00
Sven Neumann
12920b5a17 take const arrays of action entries.
2006-04-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.[ch]: take const arrays of action
	entries.

	* app/actions/*-actions.c: declare action arrays as const.
2006-04-10 08:06:18 +00:00
Michael Natterer
1f8c1ae34e app/plug-in/Makefile.am app/plug-in/plug-ins-help.[ch] remove these files
2006-04-09  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-ins-help.[ch]
	* app/plug-in/plug-ins-locale.[ch]: remove these files again...

	* app/plug-in/plug-in-help-domain.[ch]
	* app/plug-in/plug-in-locale-domain.[ch]: ... and add them here
	with changed namespace.

	* app/plug-in/plug-in-menu-branch.[ch]: new files keeping menu
	branches registered by plug-ins.

	* app/plug-in/plug-ins.[ch]: removed the menu branch stuff here.

	* app/actions/plug-in-actions.c
	* app/menus/plug-in-menus.c
	* app/plug-in/plug-in.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly.

	* app/pdb/help_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-09 21:04:37 +00:00
Michael Natterer
5cf5b8ca1c app/plug-in/Makefile.am app/plug-in/plug-ins-help.[ch] new files managing
2006-04-09  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-ins-help.[ch]
	* app/plug-in/plug-ins-locale.[ch]: new files managing plug-in
	help domains and locale domains.

	* app/plug-in/plug-ins.[ch]: removed the functions here. Minor
	unrelated cleanups.

	* app/plug-in/plug-in.c
	* app/actions/plug-in-actions.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed includes accordingly.

	* app/pdb/help_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-09 16:25:47 +00:00
Michael Natterer
618202c37e app/plug-in/Makefile.am app/plug-in/plug-ins-help.[ch] new files managing
2006-04-09  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-ins-help.[ch]
	* app/plug-in/plug-ins-locale.[ch]: new files managing plug-in
	help domains and locale domains.

	* app/plug-in/plug-ins.[ch]: removed the functions here. Minor
	unrelated cleanups.

	* app/plug-in/plug-in.c
	* app/actions/plug-in-actions.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed includes accordingly.

	* app/pdb/help_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-09 16:07:05 +00:00
Michael Natterer
b2f2b7148d made plug_in_run_temp() public and changed its parameters to match the
2006-04-07  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/plug-in-run.[ch]: made plug_in_run_temp() public and
	changed its parameters to match the ones of plug_in_run().

	* app/pdb/gimpprocedure.[ch]: added GimpProcedure::execute_async()
	which takes an additional display_ID parameter and returns nothing.

	* app/pdb/gimppluginprocedure.c
	* app/pdb/gimptemporaryprocedure.c: implement it, using
	plug_in_run() and plug_in_run_temp().

	* app/core/gimp-utils.[ch]: added gimp_value_array_truncate()
	which takes a GValueArray and the number of values to truncate the
	array to.

	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/pdb/gimp-pdb.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimphelp.c: use gimp_procedure_execute_async()
	instead of plug_in_run() and don't #include "plug-in-run.h".
	Truncate GValueArray passed to plug-ins again, and don't just pass
	some default values to the noninteractive args.

	Unrelated:

	* tools/pdbgen/pdb/plug_in.pdb: don't call
	gimp_menus_create_branch() here.

	* app/plug-in/plug-ins.c (plug_ins_menu_branch_add): call it here
	instead.

	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-07 18:23:20 +00:00
Sven Neumann
5fc9bd4096 app/actions/tool-options-commands.c app/core/gimp.c
2006-04-07  Sven Neumann  <sven@gimp.org>

	* app/actions/tool-options-commands.c
	* app/core/gimp.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpbuffer.c
	* app/core/gimpcontext.c
	* app/core/gimpdatafactory.c
	* app/core/gimpgradient-load.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpitem.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimplist.c
	* app/core/gimppalette.c
	* app/dialogs/template-options-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.c
	* app/paint/gimp-paint.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimptoolbox-dnd.c: use gimp_object_set_static_name()
	and gimp_object_take_name() where appropriate.
2006-04-07 10:51:22 +00:00
Sven Neumann
37da566934 app/core/gimpcontext.c app/core/gimpimage.c app/paint-funcs/paint-funcs.c
2006-04-06  Sven Neumann  <sven@gimp.org>

	* app/core/gimpcontext.c
	* app/core/gimpimage.c
	* app/paint-funcs/paint-funcs.c
	* app/widgets/gimpcontrollerkeyboard.c
	* app/widgets/gimpcontrollerwheel.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdockseparator.c
	* libgimp/gimpbrushselect.c
	* libgimp/gimpfontselect.c
	* libgimp/gimpgradientselect.c
	* libgimp/gimppaletteselect.c
	* libgimp/gimppatternselect.c
	* libgimpwidgets/gimpchainbutton.c
	* libgimpwidgets/gimpcolorscales.c
	* libgimpwidgets/gimpcolorselect.c
	* libgimpwidgets/gimppickbutton.c
	* libgimpwidgets/gimpstock.c: sprinkled some const qualifiers.
2006-04-06 12:43:58 +00:00
Michael Natterer
7e258dfa27 app/plug-in/Makefile.am app/plug-in/plug-in-types.h removed...
2006-04-06  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-types.h
	* app/plug-in/plug-in-proc-def.[ch]: removed...

	* app/pdb/Makefile.am
	* app/pdb/pdb-types.h
	* app/pdb/gimppluginprocedure.[ch]: ...and added here. Virtualized
	get_progname().

	* app/pdb/gimptemporaryprocedure.[ch]: new class derived from
	GimpPlugInProcedure.

	* app/pdb/gimpprocedure.[ch] (struct GimpProcedure): remove union
	exec_method and all the structs it needed. Procedure execution is
	properly virtualized now. Removed gimp_procedure_initialize() and
	grow the args and values arrays dynamically in
	gimp_procedure_add_argument()/return_value(). Added marshal_func
	parameter to gimp_procedure_new().

	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/core/gimp-gui.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/plug-in/plug-in-def.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins-query.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb
	* tools/pdbgen/app.pl: changed accordingly.

	* app/pdb/*_cmds.c: regenerated.

	* app/pdb/gimp-pdb.c: added uglyness to make the app link again.
2006-04-06 10:01:30 +00:00
Sven Neumann
8f57c23d89 app/dialogs/preferences-dialog.c app/widgets/gimpimagepropview.c
2006-04-05   Sven Neumann  <sven@gimp.org>

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimpimagepropview.c
	* app/widgets/gimpsizebox.c
	* app/widgets/gimptemplateeditor.c: replaced "dpi" with "ppi"
	(bug #326718).
2006-04-05 16:45:27 +00:00
Michael Natterer
086d0b6371 app/plug-in/plug-in-types.h renamed to GimpPlugInProcedure and made a
2006-04-05  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/plug-in-types.h
	* app/plug-in/plug-in-proc-def.[ch]: renamed to GimpPlugInProcedure
	and made a GObject derived from GimpProcedure (instead of having
	a pointer to a GimpProcedure). Added image_types and file_magic
	utility functions taken from plug-ins.[ch]. Still lives in the
	same crappy files because I am undecided where to put it...

	* app/pdb/gimpprocedure.c (gimp_procedure_real_execute): removed
	switch() statement and always call the internal marshaller because
	GimpProcedure::execute() is properly overridden by
	GimpPlugInProcedure now.

	* app/plug-in/plug-ins.[ch]: removed the mime_type and file_magic
	utilities added to GimpPlugInProcedure.

	* app/actions/file-commands.c
	* app/actions/plug-in-actions.[ch]
	* app/actions/plug-in-commands.[ch]
	* app/core/gimp-gui.[ch]
	* app/core/gimp.[ch]
	* app/core/gimpimage.[ch]
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/print-size-dialog.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.[ch]
	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins-query.c
	* app/widgets/gimpactiongroup.[ch]
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpfileprocview.[ch]
	* app/widgets/gimppluginaction.[ch]
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed addordingly.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-05 08:38:33 +00:00
Michael Natterer
a184c9090b app/pdb/Makefile.am app/pdb/procedural_db.[ch] removed...
2006-04-04  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/procedural_db.[ch]
	* app/pdb/procedural-db-query.[ch]: removed...

	* app/pdb/gimp-pdb.[ch]
	* app/pdb/gimp-pdb-query.[ch]: ...and added namespacefied.

	* app/batch.c
	* app/actions/vectors-commands.c
	* app/core/gimp.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-params.c
	* app/plug-in/plug-in-proc-def.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-ins-query.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c
	* app/widgets/gimppdbdialog.c
	* app/xcf/xcf.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed accordingly.

	* app/pdb/*_cmds.c: regenerated.
2006-04-04 17:47:22 +00:00
Michael Natterer
2abc723efe use the correct API to unset the tree view's drop indicator. Apparently
2006-04-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c
	(gimp_container_tree_view_drag_leave)
	(gimp_container_tree_view_drag_motion): use the correct API to
	unset the tree view's drop indicator. Apparently using the wrong
	API has stopped working due to changes in GtkTreeView...
2006-04-04 15:29:18 +00:00
Michael Natterer
17aada110c app/pdb/pdb-types.h removed struct GimpArgument, struct GimpArgumentSpec,
2006-04-04  Michael Natterer  <mitch@gimp.org>

	* app/pdb/pdb-types.h
	* app/pdb/gimpargument.[ch]: removed struct GimpArgument, struct
	GimpArgumentSpec, gimp_argument_init() and
	gimp_arguments_destroy().

	* app/pdb/gimpprocedure.h (struct GimpProcedure): use arrays of
	GParamSpec* for kepping proc inargs/outargs.

	* app/pdb/gimpprocedure.[ch]
	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-params.[ch]
	* app/plug-in/plug-in-proc-frame.[ch]
	* app/plug-in/plug-in-run.[ch]: use GValueArrays for procedure
	arguments and return values. Removed all n_args and n_return_vals
	parameters because GValueArrays know their length.

	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/pdb/procedural-db-query.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c
	* app/widgets/gimppdbdialog.[ch]
	* app/xcf/xcf.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed accordingly. Also
	removed #include "gimpargument.h" from most files.

	* app/pdb/*_cmds.c: regenerated.
2006-04-04 10:30:58 +00:00
Michael Natterer
070a3625ad added a shitload of new GTypes and corresponding GParamSpecs to use them
2006-04-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpparamspecs.[ch]: added a shitload of new GTypes and
	corresponding GParamSpecs to use them as PDB arguments.
	Each GimpPDBArgType has one or more corresponding GTypes in the
	core now.

	* app/pdb/gimpargument.[ch] (struct GimpArgument)
	(struct GimpArgumentSpec): removed "value" member because the
	GValue's/GParamSpec's GType carries just as much information now.

	(gimp_argument_type_to_pdb_arg_type): new function which maps
	GTypes to GimpPDBArgType.

	(gimp_pdb_arg_type_to_string): formerly known as
	procedural_db_type_name().

	* app/pdb/gimpprocedure.[ch]
	* app/pdb/procedural_db.[ch]: completely switch to GValue. Use the
	new GParamSpecs for procedure arguments. GimpPDBArgType is only
	used for adding compat args/values of plug-in procedures.

	(procedural_db_run_proc): the va_list expects a sequence of
	(GType, value, GType, value, ..., G_TYPE_NONE) now.

	* app/plug-in/plug-in-params.[ch]: changed accordingly.

	(plug_in_param_defs_check): removed this function.

	* app/plug-in/plug-in-message.c (plug_in_handle_proc_install): use
	plug_in_proc_args_check() instead and initialize the GimpProcedure
	before doing so.

	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb.pl: use the new param spec types and their
	utility functions. Changed argument/value registration
	accordingly.

	* app/pdb/procedural-db-query.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed accordingly.

	* app/pdb/*_cmds.c: regenerated.
2006-04-03 20:54:55 +00:00
Michael Natterer
d05d512d9c added struct GimpArray which can keep static or allocated data. Added
2006-04-01  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpparamspecs.[ch]: added struct GimpArray which can
	keep static or allocated data. Added boxed types GIMP_TYPE_ARRAY
	and GIMP_TYPE_STRING_ARRAY. Added GParamSpecs for PDB int32,
	int16, int8, float and string arrays. Added functions to get, dup,
	set and set_static the various arrays from/to GValues.

	* app/pdb/gimpprocedure.c
	* app/pdb/procedural_db.c
	* app/plug-in/plug-in-params.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb.pl: use the new param pspecs and gimp_value
	functions to keep arrays in GimpArguments.

	* app/pdb/gimpargument.[ch] (gimp_arguments_destroy): removed
	parameter "gboolean full_destroy". It's not needed any longer
	because the GValues fully memory-manage all their data now.

	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/dialogs/print-size-dialog.c
	* app/dialogs/resize-dialog.c
	* app/display/gimpdisplayshell-handlers.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppdbdialog.c
	* tools/pdbgen/pdb/fileops.pdb: changed accordingly.

	* app/pdb/brush_cmds.c
	* app/pdb/brushes_cmds.c
	* app/pdb/buffer_cmds.c
	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/fileops_cmds.c
	* app/pdb/fonts_cmds.c
	* app/pdb/gimpargument.c
	* app/pdb/gimpargument.h
	* app/pdb/gimpprocedure.c
	* app/pdb/gradient_cmds.c
	* app/pdb/gradients_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/paint_tools_cmds.c
	* app/pdb/palettes_cmds.c
	* app/pdb/parasite_cmds.c
	* app/pdb/paths_cmds.c
	* app/pdb/pattern_cmds.c
	* app/pdb/patterns_cmds.c
	* app/pdb/plug_in_cmds.c
	* app/pdb/procedural_db.c
	* app/pdb/procedural_db_cmds.c
	* app/pdb/selection_tools_cmds.c
	* app/pdb/vectors_cmds.c: regenerated.

	... and ported everything to perl btw...
2006-04-01 01:33:28 +00:00
Michael Natterer
03c28ec7fc app/pdb/pdb-types.h renamed struct Argument to GimpArgument and struct
2006-03-31  Michael Natterer  <mitch@gimp.org>

	* app/pdb/pdb-types.h
	* app/pdb/gimpargument.h: renamed struct Argument to GimpArgument
	and struct ProcArg to GimpArgumentSpec.

	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/pdb/gimpargument.c
	* app/pdb/gimpprocedure.[ch]
	* app/pdb/procedural-db-query.c
	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-params.[ch]
	* app/plug-in/plug-in-proc-frame.h
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-ins.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c
	* app/widgets/gimppdbdialog.[ch]
	* app/xcf/xcf.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed accordingly.

	* app/pdb/*_cmds.c: regenerated.
2006-03-31 20:16:22 +00:00
Michael Natterer
fe90ae768b app/pdb/pdb-types.h renamed struct ProcRecord to GimpProcedure. Added
2006-03-31  Michael Natterer  <mitch@gimp.org>

	* app/pdb/pdb-types.h
	* app/pdb/gimpprocedure.h: renamed struct ProcRecord to
	GimpProcedure. Added GIMP_IS_PROCEDURE() which checks for != NULL.

	* app/pdb/gimpprocedure.c
	* app/pdb/procedural-db-query.c
	* app/pdb/procedural_db.[ch]
	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/file/file-open.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-proc-def.h
	* app/plug-in/plug-in-proc-frame.[ch]
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins-query.c
	* app/plug-in/plug-ins.[ch]
	* app/widgets/gimphelp.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/app.pl: changed accordingly. Renamed 'proc_rec' and
	similarily named variables and parameters to 'procedure'.

	* tools/pdbgen/pdb/procedural_db.pdb: changed 'procedure'
	parameters to 'procedure_name'.

	* app/pdb/*_cmds.c
	* libgimp/gimpproceduraldb_pdb.[ch]: regenerated.
2006-03-31 17:42:13 +00:00
Michael Natterer
87e7cb1fe6 always set dockable->blurb to NULL, also if its memory is shared with
2006-03-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_destroy): always set
	dockable->blurb to NULL, also if its memory is shared with
	dockable->name.
2006-03-31 10:08:02 +00:00
Michael Natterer
1dac27836d app/pdb/Makefile.am new files containing the functions operating on *one*
2006-03-31  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/gimpprocedure.[ch]: new files containing the functions
	operating on *one* procedure. Factored out of procedural_db.[ch]
	and renamed to gimp_procedure_foo().

	* app/pdb/procedural_db.[ch]: removed them here.

	* app/pdb/procedural-db-query.c
	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-proc-def.[ch]
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppdbdialog.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/app.pl: changed #includes and function calls
	accordingly. No logic changed.

	* app/pdb/*_cmds.c: regenerated.
2006-03-31 09:15:08 +00:00
Michael Natterer
4b24ca376f don't memset(0) the array of return values if the procedure didn't
2006-03-30  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.c (procedural_db_execute_proc): don't
	memset(0) the array of return values if the procedure didn't
	succeed. GValues don't like to be treated like that and I don't
	understand what the memsetting is good for. It just looks like a
	very bad hack.

	* app/file/file-open.c: additionally, don't access return_vals[>0]
	unless the procedure returned successfully.

	* app/core/gimppdbprogress.c
	* app/widgets/gimppdbdialog.c: procedural_db_run_proc() always
	returns non-NULL, no need to check for it.
2006-03-30 13:00:17 +00:00
Michael Natterer
afd88f0bf4 replace the value union by a GValue.
2006-03-30  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.[ch] (struct Argument): replace the value
	union by a GValue.

	(procedural_db_argument_init)
	(procedural_db_compat_arg_init): new functions to initialize
	an Argument. They call g_value_init() on the Argument's value.

	(procedural_db_arguments)
	(procedural_db_return_values): initialize the returned Argument
	arrays so their GValues are ready to use. Allow to get the
	(unsuccessful) return values of a NULL ProcRecord.

	(procedural_db_destroy_args): g_value_unset() the values. Added a
	"gboolean full_destroy" parameter. Its only effect is to destroy
	PDB arrays, everything else is nicely memory managed by GValue.

	(procedural_db_execute)
	(procedural_db_run_proc): do GValue stuff. Added n_args and
	n_return_vals parameters to execute().

	(procedural_db_execute_proc): private function to execute a
	procedure. Validates the passed in arguments using the registered
	GParamSpecs before passing them to the resp. exec method.

	* app/plug-in/plug-in-params.[ch] (plug_in_params_to_args): needs
	an array of ProcArgs now in order to initialize the Arguments'
	GValues correctly. Passing NULL ProcArgs uses
	procedural_db_compat_arg_init(), so procedures (plug-ins)
	returning more values than expected work.

	(plug_in_args_to_params): do GValue stuff here too.

	(plug_in_args_destroy): removed this function,
	procedural_db_destroy_args() does the same now.

	* app/plug-in/plug-in-message.c (plug_in_handle_proc_run):
	simplified quite a bit because everything returns n_return_values
	now. Call plug_in_params_to_args() only of the procedure was found.

	(plug_in_handle_proc_return_priv): pass ProcRecs to
	plug_in_params_to_args().

	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-run.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimppdbdialog.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb: changed accordingly: don't
	g_new/g_free Argument arrays, always use procedural_db_foo()
	functions. Use GValue functions to get/set Arguments.

	* tools/pdbgen/pdb.pl: added get_value_func and set_value_func to
	all PDB types. Removed id_func, id_ret_func and check_func. Added
	flags which indicated that a type is an ID. Removed unused utility
	functions.

	* tools/pdbgen/lib.pl: use the flag instead of looking at
	functions and value types.

	* tools/pdbgen/app.pl: use the get_value_func and set_value_func
	to marshal inargs and outargs. Removed all checks performed on
	inargs because that's done by GParamSpec validation now. Added the
	missing bits to register excluded values with GimpParamSpecEnum.

	* app/pdb/*_cmds.c: regenerated.
2006-03-29 23:56:07 +00:00
Sven Neumann
fd0a61d5e1 allow dropping of dockables from the same dockbook to the empty space next
2006-03-28  Sven  Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_drop_dockable):
allow
	dropping of dockables from the same dockbook to the empty space
	next to the notebook tabs. This moves the dockable to the end.
2006-03-28 19:19:55 +00:00
Sven Neumann
5439aa4995 did a global gdisp -> display substitution.
2006-03-28  Sven Neumann  <sven@gimp.org>

	* app/*: did a global gdisp -> display substitution.
2006-03-28 17:55:52 +00:00
Sven Neumann
905fdfcbed did a global gimage -> image substitution.
2006-03-28  Sven Neumann  <sven@gimp.org>

	* app/*: did a global gimage -> image substitution.
2006-03-28 17:08:36 +00:00
Michael Natterer
169faefb18 renamed procedural_db_return_args() to procedural_db_return_values() and
2006-03-27  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.[ch]: renamed procedural_db_return_args()
	to procedural_db_return_values() and added
	procedural_db_arguments(), which returns a newly allocated,
	initialized array of the procedure's arguments.

	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/plug-in/plug-in-run.c
	* app/widgets/gimphelp.c
	* app/xcf/xcf.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/fileops.pdb: changed accordingly, some cleanup.

	* app/pdb/*_cmds.c: regenerated.
2006-03-27 21:09:32 +00:00
Sven Neumann
1018e6f3a3 enabled tooltips on all menu items for easier review of the action blurbs.
2006-03-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): enabled
	tooltips on all menu items for easier review of the action blurbs.
	This should be made configurable.
2006-03-15 00:05:55 +00:00
Sven Neumann
872d9506e5 factored out some code to a utility function.
2006-03-10  Sven Neumann  <ven@gimp.org>

	* app/widgets/gimpaction.c: factored out some code to a utility
	function.

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h
	* app/dialogs/preferences-dialog.c
	* app/gui/gui.c
	* app/plug-in/plug-in-run.c
	* libgimp/gimp.c
	* libgimpbase/gimpprotocol.[ch]: renamed tool_tips to tooltips in
	variables and in the gimprc.

	* app/config/gimpbaseconfig.[ch]: removed stingy_memory_use from
	the GimpBaseConfig struct.
2006-03-10 16:40:09 +00:00
Michael Natterer
a8cf1cfa9d connect to the menu items' "select" and "deselect" signals instead of
2006-03-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c: connect to the menu items' "select"
	and "deselect" signals instead of "enter-notify-event" and
	"leave-notify-event", so tooltips work with keynav.
2006-03-10 10:05:38 +00:00
Michael Natterer
6a01bb2306 added "show-tooltip" and "hide-tooltip" signals. Connect to each menu
2006-03-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: added "show-tooltip" and
	"hide-tooltip" signals. Connect to each menu item's
	enter-notify-event and leave-notify-event. On enter, emit
	show-tooltip, on leave emit hide-tooltip.

	* app/display/gimpdisplayshell.c: connect to the menubar ui
	manager's show-tooltip and hide-tooltip signals and show the tip
	in the display's status bar.
2006-03-09 15:26:33 +00:00
Sven Neumann
f849858810 set tooltips dynamically.
2006-03-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolordisplayeditor.c: set tooltips dynamically.
2006-03-04 00:53:47 +00:00
Sven Neumann
303fd1993a app/widgets/gimpcontrollereditor.c set tooltips dynamically.
2006-03-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollereditor.c
	* app/widgets/gimpcontrollerlist.c: set tooltips dynamically.
2006-03-04 00:41:15 +00:00
Sven Neumann
e09c3f2da6 app/dialogs/vectors-import-dialog.c (vectors_import_dialog_new) fixed
2006-03-03  Sven Neumann  <sven@gimp.org>

	* app/dialogs/vectors-import-dialog.c (vectors_import_dialog_new)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	fixed capitalization of filter names.
2006-03-03 22:46:01 +00:00
Sven Neumann
017278c111 app/dialogs/file-open-dialog.c app/display/gimpdisplayshell-dnd.c
2006-03-03  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/fileops.pdb:
	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.[ch]
	* app/widgets/gimplayertreeview.c: pass the selected load procedure
	to file_open_layer() or NULL if none is selected. Fixes bug #333207.

	* app/pdb/fileops_cmds.c: regenerated.
2006-03-03 19:51:20 +00:00
Sven Neumann
5e7ce540c1 app/core/gimpbrush.c app/core/gimpbuffer.c app/core/gimpimagefile.c
2006-02-28  Sven Neumann  <sven@gimp.org>

	* app/core/gimpbrush.c
	* app/core/gimpbuffer.c
	* app/core/gimpimagefile.c
	* app/core/gimppattern.c
	* app/dialogs/preferences-dialog.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimprectangletool.c
	* app/tools/gimprectselecttool.c
	* app/widgets/gimpimagepropview.c
	* app/widgets/gimpsizebox.c
	* app/widgets/gimptemplateeditor.c
	* plug-ins/imagemap/imap_statusbar.c: use U+00D7 MULTIPLICATION SIGN
	instead of x when displaying sizes.
2006-02-28 12:15:51 +00:00
Sven Neumann
5c7a5a502d tweaked drawing of shadows.
2006-02-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfgbgview.c (gimp_fg_bg_view_expose): tweaked
	drawing of shadows.
2006-02-20 11:48:10 +00:00
Sven Neumann
3b8578942d do not unset focus-on-map for all tool dialogs.
2006-02-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptooldialog.c: do not unset focus-on-map for all
	tool dialogs.

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpmeasuretool.c: explicitely do it here instead.
2006-02-15 14:48:40 +00:00
Sven Neumann
1e019a57ff app/core/gimp-gui.c use GIMP_ACRONYM.
2006-02-07  Sven Neumann  <sven@gimp.org>

	* app/core/gimp-gui.c
	* app/widgets/gimptoolbox.c: use GIMP_ACRONYM.
2006-02-07 11:07:47 +00:00
Sven Neumann
74cb362440 some finetuning to the labels.
2006-01-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.c: some finetuning to the labels.
2006-01-26 17:50:36 +00:00
Michael Natterer
e1ceed5147 define GIMP_PARAM_STATIC_STRINGS which is G_PARAM_STATIC_NAME|NICK|BLURB.
2006-01-18  Michael Natterer  <mitch@gimp.org>

	* app/config/config-types.c: define GIMP_PARAM_STATIC_STRINGS
	which is G_PARAM_STATIC_NAME|NICK|BLURB. Also define
	GIMP_PARAM_READABLE, _WRITABLE and _READWRITE which include
	GIMP_PARAM_STATIC_STRINGS.

	* app/*/*.c: use them for all object properties so their
	strings are not copied.
2006-01-18 20:29:40 +00:00
Raphael Quinet
7d8998a99c automatically removed trailing whitespace from 3460 lines.
2006-01-17  Raphael Quinet  <raphael@gimp.org>

	* (about 130 *.[ch] files): automatically removed trailing
	whitespace from 3460 lines.
2006-01-17 12:43:50 +00:00
Michael Natterer
5236dc6f13 app/actions/dockable-actions.c app/actions/dockable-commands.[ch]
2006-01-17  Michael Natterer  <mitch@gimp.org>

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]
	* app/dialogs/dialogs-constructors.[ch]
	* app/dialogs/dialogs.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpbrushfactoryview.h
	* app/widgets/gimpbufferview.[ch]
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcomponenteditor.[ch]
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainerentry.[ch]
	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpcontainerpopup.[ch]
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpcontainerview.[ch]
	* app/widgets/gimpdatafactoryview.[ch]
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdialogfactory.[ch]
	* app/widgets/gimpdocumentview.[ch]
	* app/widgets/gimpfontview.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpimageview.[ch]
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppatternfactoryview.[ch]
	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpselectioneditor.[ch]
	* app/widgets/gimpsessioninfo.[ch]
	* app/widgets/gimptemplateview.[ch]
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimptoolview.[ch]
	* app/widgets/gimpundoeditor.[ch]
	* app/widgets/gimpviewablebox.c
	* app/widgets/gimpviewablebutton.[ch]
	* app/widgets/gimpviewabledialog.[ch]
	* app/widgets/gimpviewrenderer.c: change the word "preview" to
	"view" whereever we talk about GimpView or GimpViewRenderer
	objects or their sizes. Ther were renamed from "Preview" a long
	time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
Michael Natterer
5d8b25a27d variant of gimp_config_connect() which allows the connected objects to
2006-01-14  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-utils.[ch] (gimp_config_connect_full):
	variant of gimp_config_connect() which allows the connected
	objects to have different propertynames.

	* app/widgets/widgets-enums.[ch]: removed enum GimpViewType...

	* app/core/core-enums.[ch]: ...and added it here.

	* app/widgets/gimpviewablebutton.[ch] (gimp_viewable_button_new):
	added "button_preview_size" parameter so the button and popup
	preview sizes can be specified separately.

	* app/widgets/gimptemplateeditor.c: changed accordingly.

	* app/widgets/gimpviewablebox.[ch] (gimp_prop_*_box_new):
	new functions which take additional "view_type_prop" and
	"view_size_prop" parameters and sync the passed context's
	properties with the resp. properties of the viewable button.

	* app/paint/gimppaintoptions.[ch]
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.[ch]: added view-type and view-size
	properties to the options objects and use the new viewable box
	constructors so the selected view types and sizes are persistant
	across sessions. Fixes bug #315443.
2006-01-14 00:09:22 +00:00
Michael Natterer
078c3c8c3c always set the current page of dockbooks, also if it's the first one.
2006-01-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.c (gimp_session_info_restore): always
	set the current page of dockbooks, also if it's the first one.
2006-01-13 23:55:39 +00:00
Sven Neumann
004a78e276 app/actions/actions.c app/actions/cursor-info-actions.c
2006-01-12  Sven Neumann  <sven@gimp.org>

	* app/actions/actions.c
	* app/actions/cursor-info-actions.c
	* app/actions/dialogs-actions.c
	* app/config/gimprc-blurbs.h
	* app/dialogs/dialogs.c
	* app/dialogs/preferences-dialog.c
	* app/widgets/gimphelp-ids.h: use the term Pointer instead of
	Cursor when refering to the mouse pointer (bug #326700).
2006-01-12 10:31:13 +00:00
Sven Neumann
ca648066d0 set "inline-completion" and unset "popup-set-width" properties.
2005-12-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerentry.c (gimp_container_entry_init):
	set "inline-completion" and unset "popup-set-width" properties.
2005-12-30 01:56:37 +00:00
Michael Natterer
a52ad9d3c4 #define GIMP_DOCKABLE_DRAG_OFFSET publically.
2005-12-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.[ch]: #define GIMP_DOCKABLE_DRAG_OFFSET
	publically.

	* app/widgets/gimpdockbook.c (gimp_dockbook_tab_drag_end): use the
	define to reset the dockable's drag offsets.
2005-12-30 01:37:35 +00:00
Sven Neumann
46644a68bb typo.
2005-12-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.c (view_events): typo.
2005-12-30 00:00:21 +00:00
Sven Neumann
06d21f93a4 set the current notebook page to the dockable that was just added.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_dockable_added): set
	the current notebook page to the dockable that was just added.
2005-12-29 22:07:38 +00:00
Sven Neumann
047770d011 added missing cast 2005-12-29 22:05:12 +00:00
Sven Neumann
b07cbb500f fiddle with the "focus-on-map" window hint to prevent the dialogs from
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c (gimp_dialog_factories_show_foreach):
	fiddle with the "focus-on-map" window hint to prevent the dialogs
	from grabbing the focus away from the image window. Fixes bug #167762
	for window managers supporting this hint.

	* app/display/gimpdisplayshell-callbacks.c: removed redundant call
	to gdk_window_focus() that wasn't having the desired effect anyway.
2005-12-29 21:32:46 +00:00
Sven Neumann
8fec4cd8c1 split gimp_dialog_factories_toggle() into two functions. Turned the
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: split
	gimp_dialog_factories_toggle() into two functions. Turned the
	tri-state into a simple boolean state. Dialogs are now either
	shown or not, without treating the toolbox any special.

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-callbacks.c: changed accordingly.
2005-12-29 20:47:29 +00:00
Sven Neumann
aa590be77a set the source dockable insensitive during the drag operation.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c: set the source dockable insensitive
	during the drag operation.
2005-12-29 16:42:45 +00:00
Sven Neumann
278b498e41 moved some code to an internal helper function.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_expose_event): moved
	some code to an internal helper function.
2005-12-29 16:00:28 +00:00
Sven Neumann
850e7af79e only set the horizontal offset from the button press location 2005-12-29 04:45:41 +00:00
Sven Neumann
405c0e1234 invalidate stored coordinates on button release.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.[ch]: invalidate stored coordinates on
	button release.
2005-12-29 04:28:41 +00:00
Sven Neumann
9c6dbc4719 let the drag icon mimic the appearance of a notebook tab.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c: let the drag icon mimic the
	appearance of a notebook tab.
2005-12-29 04:05:50 +00:00
Sven Neumann
7ab05fddea use the width of the source widget as the minimum width of the drag icon.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockbook.c (gimp_dockbook_tab_drag_begin): use
	the width of the source widget as the minimum width of the drag
	icon.
2005-12-29 03:48:35 +00:00
Sven Neumann
2723c2e790 store coordinates of last button press event.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.[ch]: store coordinates of last button
	press event.

	* app/widgets/gimpdockbook.c (gimp_dockbook_tab_drag_begin): set
	the drag hotspot to the mouse position that started the drag.
2005-12-29 03:12:26 +00:00
Sven Neumann
59fa7c4e25 draw the standalone dockable like a notebook tab to indicate that it can
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_expose_event): draw the
	standalone dockable like a notebook tab to indicate that it can be
	dragged.
2005-12-29 02:27:32 +00:00
Sven Neumann
99d8fa90d0 allow to unset the tooltip by passing NULL.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimphelpui.c (gimp_help_set_help_data): allow to
	unset the tooltip by passing NULL.

	* app/widgets/gimpdockseparator.c: unset the tooltip while the same
	text is being shown as a label.
2005-12-29 01:33:38 +00:00
Sven Neumann
e59ece7cab code cleanup, use alloca in gimp_colormap_editor_clear().
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.c: code cleanup, use alloca in
	gimp_colormap_editor_clear().
2005-12-29 00:11:09 +00:00
Sven Neumann
8798be7157 another small code cleanup 2005-12-28 23:51:39 +00:00
Sven Neumann
6af4b9b317 make sure the title area is cleared when the timeout is cancelled.
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c: make sure the title area is cleared
	when the timeout is cancelled.
2005-12-28 23:43:53 +00:00
Michael Natterer
e397c0ef0a set the new "do-overwrite-confirmation" property on GtkFileChooser.
2005-12-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: set the new
	"do-overwrite-confirmation" property on GtkFileChooser. Removed
	gimp_file_overwrite_dialog().

	* app/dialogs/file-save-dialog.c (file_save_dialog_check_uri):
	removed broken code which tried to figure if a file exists.
	Fixes bug #309729.

	* app/widgets/gimpdnd-xds.c: added gimp_file_overwrite_dialog()
	here as private utility function.
2005-12-28 20:02:54 +00:00
Michael Natterer
a01d0f7e88 removed gimp_action_get_accel_closure().
2005-12-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: removed
	gimp_action_get_accel_closure().

	* app/widgets/gimpactionview.c (gimp_action_view_new): use
	gtk_action_get_accel_closure() instead.
2005-12-28 19:50:08 +00:00
Michael Natterer
ef9b04c535 Fixed incomplete core/ui separation of paint tools and paint methods:
2005-12-27  Michael Natterer  <mitch@gimp.org>

	Fixed incomplete core/ui separation of paint tools and paint
	methods:

	* app/core/core-enums.h
	* app/core/gimpcontext.[ch]: added a "paint-info" property and API
	so the current paint method can be selected without the need for
	an active tool.

	(gimp_context_real_set_tool): set the paint-info to
	tool_info->paint_info so the paint method follows the active tool
	just as the active image follows the active display.

	* app/core/gimp.h (struct Gimp)
	* app/core/gimppaintinfo.[ch]: added "standard_paint_info" API
	and stuff to be consistent with other context object properties.

	* app/paint/gimp-paint.c: set the paintbrush as
	standard_paint_info.

	* app/core/gimpstrokedesc.c (gimp_stroke_desc_new): removed the
	hack of falling back to the paintbrush when there is no active
	tool and use the active paint method instead. Fall back to the
	standard paint method if there is no active one.
	(nothing in the core uses the active tool any more now).

	* app/widgets/gimpdeviceinfo.h: add the paint info to the
	properties which are saved in devicerc.

	Added identifiers (names) and stock-ids to GimpPaintInfo:

	* app/core/gimppaintinfo.[ch] (gimp_paint_info_new): added
	identifier and stock-id parameters.

	* app/core/gimptoolinfo.c (gimp_tool_info_new): removed the hack
	of setting the paint-info stock-id from the tool-info stock-id.

	* app/paint/paint-types.h
	* app/paint/gimp-paint.c: changed GimpPaintRegisterCallback
	accordingly.

	* app/tools/gimp-tools.c (gimp_tools_register): changed paint
	info names accordingly.

	* app/paint/*.c (gimp_*_register): pass identifier and stock-id
	accordingly.
2005-12-27 18:57:01 +00:00
Sven Neumann
04024004bd removed icons from GimpFileProcView. It turned out that the Wilber icon is
2005-12-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfileprocview.c: removed icons from
	GimpFileProcView.  It turned out that the Wilber icon is commonly
	mistaken as an indicator for the selected file-type.
2005-12-21 13:25:08 +00:00
Michael Natterer
5a8b082a8e revert accidential commit. 2005-12-19 22:44:39 +00:00
Michael Natterer
61df53ec54 port to G_DEFINE_TYPE() and friends. Some related cleanup.
2005-12-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/*.c: port to G_DEFINE_TYPE() and friends. Some
	related cleanup.
2005-12-19 22:37:49 +00:00
Michael Natterer
534fd971c4 set the "use-stock" property on the created buttons so changes of the
2005-11-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpeditor.c (gimp_editor_add_button)
	(gimp_editor_add_action_button): set the "use-stock" property on
	the created buttons so changes of the underlying action's name
	don't affect change the button's icon to a string.
2005-11-29 23:02:20 +00:00
Michael Natterer
84fed8962d added GdkDisplay member since there is no way fo figure the display a
2005-11-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdeviceinfo.[ch]: added GdkDisplay member since
	there is no way fo figure the display a GdkDevice exists on.
	Minor cleanups.

	* app/widgets/gimpdevices.[ch]: connect to the GdkDeviceManager
	and add input devices when displays are opened. Added API to get
	the GimpContainer of devices.

	* app/widgets/gimpdevicestatus.[ch]: don't just show the devices
	of the default display. Instead get the device container from the
	new API above and update the GUI when devices are added/removed.
	Cleaned up the whole file quite a bit.
2005-11-27 17:20:40 +00:00
Michael Natterer
7bbcc69815 use gtk_accelerator_name() instead of serializing the accelerator
2005-11-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdeviceinfo.c (gimp_device_info_get_property):
	use gtk_accelerator_name() instead of serializing the accelerator
	manually.
2005-11-27 14:10:19 +00:00
Michael Natterer
0ec0514ba2 changed wheel scrolling to be HIG-compliant (control zooms). Also handle
2005-11-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.c (view_events):
	* app/widgets/gimpnavigationview.c (gimp_navigation_view_scroll):
	changed wheel scrolling to be HIG-compliant (control zooms). Also
	handle GDK_SCROLL_LEFT/RIGHT correctly and made shift switch the
	scroll axis. The widgets behave as the image window now.
2005-11-18 20:00:02 +00:00
Michael Natterer
a8f0162fe8 implement GtkWidget::unrealize() and destroy the control pixmap. fixes
2005-11-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.c: implement GtkWidget::unrealize()
	and destroy the control pixmap. fixes crash when moving the dialog
	to another display.

	* menus/dockable-menu.xml.in: added a separator before the
	"Move to Screen" submenu.
2005-11-17 20:39:23 +00:00
Sven Neumann
c5237bac92 libgimpbase/gimpenv.c (gimp_toplevel_directory) plugged memory leaks.
2005-11-16  Sven Neumann  <sven@gimp.org>

	* libgimpbase/gimpenv.c (gimp_toplevel_directory)
	* app/widgets/gimpcolormapeditor.c (gimp_colormap_editor_draw_cell):
	plugged memory leaks.
2005-11-16 18:07:44 +00:00
Michael Natterer
db0713eccd Allow to construct a group of radio actions in multiple chunks. (not used
2005-11-15  Michael Natterer  <mitch@gimp.org>

	Allow to construct a group of radio actions in multiple chunks.
	(not used yet).

	* app/widgets/gimpactiongroup.[ch]
	(gimp_action_group_add_radio_actions): added "GSList *radio_group"
	parameter and return value.

	* app/actions/dockable-actions.c
	* app/actions/gradient-editor-actions.c
	* app/actions/quick-mask-actions.c
	* app/actions/text-editor-actions.c
	* app/actions/view-actions.c
	* app/actions/window-actions.c: pass NULL as radio_group.
2005-11-15 20:24:50 +00:00
Michael Natterer
d5751a7792 implement GtkWidget::unrealize() and unrealize all GimpViewRenderers.
2005-11-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.c: implement
	GtkWidget::unrealize() and unrealize all GimpViewRenderers.
	Fixes BadMatch with the renderers' GCs on display change.
2005-11-15 19:14:00 +00:00
Michael Natterer
aa80506d6d app/core/gimp-contexts.c app/core/gimp-documents.c
2005-11-06  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-contexts.c
	* app/core/gimp-documents.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimp-units.c
	* app/core/gimpdatafactory.c
	* app/core/gimptooloptions.c
	* app/gui/color-history.[ch]
	* app/gui/gui.c
	* app/gui/session.c
	* app/plug-in/plug-ins.c
	* app/text/gimp-fonts.c
	* app/tools/gimp-tools.c
	* app/widgets/gimpcontrollers.c
	* app/widgets/gimpdevices.c: when running --verbose, print the
	name of each config file parsed or written.
2005-11-06 22:01:25 +00:00
Michael Natterer
17287bcf3f set the widget's spacing to 12 pixels.
2005-11-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollereditor.c (gimp_controller_editor_init):
	set the widget's spacing to 12 pixels.
2005-11-04 22:01:47 +00:00
Michael Natterer
f2a4df4e93 app/widgets/gimpaction.c app/widgets/gimpcoloreditor.c
2005-11-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpaction.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppluginaction.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpwidgets-utils.c
	* libgimpwidgets/gimpcellrenderercolor.c: use gtk_widget_get_settings()
	instead of gtk_settings_get_for_screen(gtk_widget_get_screen())
2005-11-02 20:18:13 +00:00
Michael Natterer
82282ea86c added g_return_if_fail (GIMP_IS_GIMP (gimp)).
2005-11-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.c (gimp_clipboard_set_text): added
	g_return_if_fail (GIMP_IS_GIMP (gimp)).
2005-11-02 19:52:47 +00:00
Sven Neumann
bdf1580d6c app/core/gimpimagefile.c app/widgets/gimpimagepropview.c
2005-11-02  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c
	* app/widgets/gimpimagepropview.c
	* app/widgets/gimpsizebox.c
	* app/widgets/gimptemplateeditor.c: use ngettext() for plural forms.
2005-11-02 16:07:07 +00:00
Sven Neumann
afde82bb8f clear the GIMP clipboard. Suppress debug output unless gimp is started
2005-11-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.[ch] (gimp_clipboard_set_text): clear
	the GIMP clipboard. Suppress debug output unless gimp is started
	with the --verbose command-line option.

	* app/actions/data-commands.c
	* app/actions/documents-commands.c: adapt to clipboard API change.
2005-11-02 12:03:37 +00:00
Michael Natterer
67ee237bd8 added a GtkSizeGroup member and put all labels into the group.
2005-11-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsizebox.[ch]: added a GtkSizeGroup member and put
	all labels into the group.

	* app/dialogs/scale-dialog.c: put the "Interpolation:" label into
	the same size box.
2005-11-02 09:27:15 +00:00
Sven Neumann
6ad8c74080 app/actions/data-commands.c app/actions/documents-commands.c moved text
2005-11-01  Sven Neumann  <sven@gimp.org>

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/widgets/gimpclipboard.[ch]: moved text clipboard handling to
	utility function to avoid code duplication.
2005-11-01 11:01:44 +00:00
Sven Neumann
f266bf8eb7 reverted the change for bug #302400; it caused bug #319962 to be opened.
2005-10-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c (gimp_message_box_init): reverted
	the change for bug #302400; it caused bug #319962 to be opened.
	Instead unset the focus chain for the message box.
2005-10-31 17:08:12 +00:00
Sven Neumann
fb28e0bec6 added new action command data_copy_location_cmd_callback().
2005-10-31  Sven Neumann  <sven@gimp.org>

	* app/actions/data-commands.[ch]: added new action command
	data_copy_location_cmd_callback().

	* app/actions/brushes-actions.c
	* app/actions/gradients-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c
	* app/widgets/gimphelp-ids.h
	* menus/brushes-menu.xml
	* menus/gradients-menu.xml
	* menus/palettes-menu.xml
	* menus/patterns-menu.xml: added Copy Location menu entries to all
	data views. Allows to retrieve the file location for data files.
2005-10-31 12:00:25 +00:00
Sven Neumann
c00173ccd0 app/core/gimpdata.[ch] applied a heavily modified version of the patch
2005-10-31  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdata.[ch]
	* app/core/gimpdatafactory.c: applied a heavily modified version
	of the patch provided by Shlomi Fish in bug #311740. Introduces a
	cache to speed up reloading of data files.

	* app/actions/data-commands.c: set gimp busy while refreshing data
	factories.

	* app/widgets/gimpwidgets-utils.c (gimp_widget_accel_changed):
	free the return value of gimp_get_accel_string().
2005-10-31 11:29:01 +00:00
Michael Natterer
2b6a5f453a add GimpViewType parameter.
2005-10-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewablebutton.[ch] (gimp_viewable_button_new):
	add GimpViewType parameter.

	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimpviewablebox.c: pass view types, using grid view
	for brushes and patterns ass suggested in bug #315443.
2005-10-31 02:12:40 +00:00
Michael Natterer
e3e53dca27 Fixed bug #316395:
2005-10-30  Michael Natterer  <mitch@gimp.org>

	Fixed bug #316395:

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* app/actions/quick-mask-actions.c (quick_mask_toggle_actions):
	added tooltips to action entries.

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): use
	gimp_widget_set_accel_help() to set the tooltip so it contains
	the accelerator.

	* app/dialogs/dialogs-constructors.c (dialogs_dockable_constructor):
	attach the dialog's identifier to the dockable widget (hack).

	* app/widgets/gimpdockbook.c (gimp_dockbook_get_tab_widget): use
	the attached identifier to find the action for this dockable in
	the dock's UI manager (HACK HACK). Use the found action to set
	a tooltip with accelerator.

	* app/widgets/gimpwidgets-utils.c (gimp_widget_set_accel_help):
	fixed bug in fallback code what should never be used.
2005-10-30 18:41:18 +00:00
Michael Natterer
dea7c48254 Fix bug #145492:
2005-10-29  Michael Natterer  <mitch@gimp.org>

	 Fix bug #145492:

	* app/actions/file-commands.c (file_save_cmd_callback)
	* app/dialogs/file-save-dialog.c (file_save_dialog_save_image):
	set the "file-quit" action insensitive while the image is being
	saved to prevent data loss.

	* app/widgets/gimptoolbox.c (gimp_toolbox_delete_event): activate
	the "file-quit" action instead of calling gimp_exit() directly so
	trying to close the toolbox while saving is impossible too.
2005-10-29 01:43:14 +00:00
Michael Natterer
27b7645137 Fixed bug #313547:
2005-10-26  Michael Natterer  <mitch@gimp.org>

	Fixed bug #313547:

	* app/widgets/gimpdataeditor.c
	(gimp_data_editor_set_aux_info)
	(gimp_data_editor_get_aux_info): store the state of edit_active
	in sessionrc.

	(gimp_data_editor_constructor): enable edit_active by default.
2005-10-25 22:05:20 +00:00
Michael Natterer
f546e1e701 Let the data editors optionally follow the active brush, palette and
2005-10-25  Michael Natterer  <mitch@gimp.org>

	Let the data editors optionally follow the active brush, palette
	and gradient. Still needs to be saved in sessionrc and probably
	be enabled by default. Addresses bug #313547.

	* app/widgets/gimpdataeditor.[ch]: added new functions
	gimp_data_editor_set,get_edit_active().

	Make it configurable from the palette and gradient editor menus:

	* app/actions/gradient-editor-actions.c
	* app/actions/palette-editor-actions.c: added actions...

	* app/actions/data-editor-commands.[ch]: ...and callbacks...
	(new file).

	* app/widgets/gimphelp-ids.h: ...help IDs...

	* menus/gradient-editor-menu.xml
	* menus/palette-editor-menu.xml: ...and menu items.

	Add menu to the brush editor and make it configurable there too:

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/brush-editor-actions.[ch]
	* app/menus/menus.c
	* menus/Makefile.am
	* menus/brush-editor-menu.xml: added all the bits needed for
	the new menu.

	* app/widgets/gimpbrusheditor.[ch]: use the menu. Added menu_factory
	paramater to the contstructor.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-10-25 21:38:00 +00:00
Michael Natterer
3af60ead59 app/display/gimpdisplayshell-close.c app/widgets/gimpactionview.c
2005-10-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimpactionview.c
	* modules/controller_midi.c: g_source_unref() GSources after
	attaching them.
2005-10-25 21:07:03 +00:00
Michael Natterer
04221fde4e create the title window as GDK_WINDOW_CHILD, not GDK_WINDOW_TEMP.
2005-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_realize): create the
	title window as GDK_WINDOW_CHILD, not GDK_WINDOW_TEMP.
2005-10-24 08:50:14 +00:00
Sven Neumann
6912227651 added run-mode parameter to file_open_layer().
2005-10-17  Sven Neumann  <sven@gimp.org>

	* app/file/file-open.[ch]: added run-mode parameter to
	file_open_layer().

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: pass GIMP_RUN_INTERACTIVE to
	file_open_layer().

	* tools/pdbgen/pdb/fileops.pdb: export file_open_layer() to the PDB
	as file-load-layer.

	* app/pdb/fileops_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpfileops_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-10-17 15:15:20 +00:00
Sven Neumann
ee64ca3c90 introduced variants of file_utils_uri_to_utf8_filename() and
2005-10-02  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: introduced variants of
	file_utils_uri_to_utf8_filename() and
	file_utils_uri_to_utf8_basename() that use g_filename_display_name()
	and g_filename_display_basename().

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-actions.c
	* app/actions/file-commands.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-title.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.c: use the new functions.

	* plug-ins/help/domain.c: use g_filename_display_name().
2005-10-01 22:43:22 +00:00
Michael Natterer
e7e2296fe5 app/actions/image-commands.c app/actions/layers-commands.c
2005-09-30  Michael Natterer  <mitch@gimp.org>

	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/view-actions.c
	* app/core/gimpdrawable-foreground-extract.c
	* app/core/gimpimagefile.c
	* app/core/gimpprogress.c
	* app/dialogs/convert-dialog.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpthumbbox.c
	* tools/pdbgen/pdb/drawable_transform.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: removed '...' from
	progress messages. Removed spaces between the text and the '...'
	in some other places.

	* app/pdb/drawable_transform_cmds.c
	* app/pdb/edit_cmds.c
	* app/pdb/transform_tools_cmds.c: regenerated.
2005-09-30 17:50:50 +00:00
Sven Neumann
14d7fb7fe4 app/dialogs/Makefile.am app/dialogs/keyboard-shortcuts-dialog.[ch]
2005-09-30  Sven Neumann  <sven@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/keyboard-shortcuts-dialog.[ch]
	* app/dialogs/preferences-dialog.c
	* app/widgets/gimphelp-ids.h: moved Keyboard Shortcuts dialog into
	it's own file.
2005-09-30 00:07:21 +00:00
Michael Natterer
14b9312a72 app/widgets/gimpprogressbox.c made progress bars HIG compliant (with
2005-09-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpprogressbox.c
	* plug-ins/script-fu/script-fu-interface.c: made progress bars HIG
	compliant (with italic label below).

	* app/widgets/gimpfiledialog.[ch]: use a GimpProgressBox intead of
	implementing the progress bar again.
2005-09-28 21:20:05 +00:00
Sven Neumann
4bb311bbd7 do not calculate the histogram if the histogram dock is invisible.
2005-09-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.[ch]: do not calculate the
	histogram if the histogram dock is invisible.
2005-09-28 00:31:46 +00:00
Sven Neumann
489aebab5e app/core/gimp-gui.h app/core/gimp-utils.h app/core/gimpimage-undo.h
2005-09-27  Sven Neumann  <sven@gimp.org>

	* app/core/gimp-gui.h
	* app/core/gimp-utils.h
	* app/core/gimpimage-undo.h
	* app/text/gimptextlayer.h
	* app/widgets/gimpeditor.h
	* app/widgets/gimpmenufactory.h
	* app/widgets/gimpmessagedialog.h
	* app/widgets/gimpsessioninfo.h
	* app/widgets/gimptooldialog.h
	* app/widgets/gimpviewabledialog.h: use G_GNUC_NULL_TERMINATED
	where appropriate.
2005-09-27 17:31:32 +00:00
Hans Breuer
0b515bec9b updated
2005-09-24  Hans Breuer  <hans@breuer.org>

	* **makefile.msc : updated

	* app/dialogs/user-install-dialog.c : only add the migrate page if
	there is something to migrate from. Avoids on version being NULL.

	* app/dialogs/file-save-dialog.c : the g_print() output was crashing
	on the assumption that ->menu_label != NULL. It is for colorhtml.py.

	* app/widgets/gimpselectiondata.c : use HAVE_UNISTD_H and move
	* process.h definition by G_OS_WIN32 below it being defined
	* app/widgets/gimpwidgets-utils.c(gimp_window_get_native) : cast
	return value to (GdkNativeWindow) it is not necessary an int.

	* libgimpwidgets/gimpwidgets.def : added gimp_zoom_type_get_type

	* plug-ins/help/gimp-help-lookup.c : dynamic lookup of help_root
	instead of hard-coding DATADIR/GIMP_HELP_PREFIX

	* plug-ins/xjt/xjt.c : there is no pid_t with msvc, typedef one.
2005-09-25 19:30:55 +00:00
Michael Natterer
71cf9ee2c6 Applied (slightly modified) patch from Sylvain Foret which adds "Close
2005-09-24  Michael Natterer  <mitch@gimp.org>

	Applied (slightly modified) patch from Sylvain Foret which adds
	"Close All" menu entries and dialog. Fixes bug #163532.

	* app/actions/file-actions.c
	* app/actions/file-commands.[ch]: added "file-close-all" action
	and callback.

	* app/dialogs/dialogs-constructors.[ch]
	* app/dialogs/dialogs.c
	* app/dialogs/quit-dialog.[ch]: added close all dialog which is a
	modified quit dialog.

	* app/widgets/gimphelp-ids.h: added help ID.

	* menus/image-menu.xml.in
	* menus/toolbox-menu.xml.in: add close all next to quit.
2005-09-24 19:30:08 +00:00
David Odin
f94f48f130 Moved the GimpZoomType enum from here...
* app/widgets/widgets-enums.h: Moved the GimpZoomType enum from	here...

* libgimpwidgets/gimpwidgetsenums.h: ...to here.

* app/widgets/widgets-enums.c
* libgimpwidgets/gimpwidgetsenums.c: regenerated.

* app/display/gimpdisplayshell-scale.[ch]: removed
  gimp_display_shell_scale_zoom_step and
  gimp_display_shell_scale_get_fraction from here...

* libgimpwidgets/gimpzoommodel.[ch]: ... to here so we can use these
  utility functions in plug-ins and in the core.
  Also removed the step-size property since the zoom-model now use
  gimp_zoom_model_zoom_step.

* app/actions/view-commands.c
* app/display/gimpdisplayshell-title.c
* app/display/gimpdisplayshell.c
* app/tools/gimpmagnifytool.c: modified accordingly.

* libgimp/gimpzoompreview.c: don't pass any argument to the
  gimp_zoom_model_new function.

* libgimpwidgets/gimpwidgets.def: added gimp_zoom_model_zoom_step
  (gimp_zoom_model_get_fraction was already there)

* devel-docs/app/app-sections.txt: removed
  gimp_display_shell_scale_zoom_step and
  gimp_display_shell_scale_get_fraction.
2005-09-24 17:25:36 +00:00
Michael Natterer
4d77057c68 renamed from set_action_important(). Set the "hide-if-empty" property so
2005-09-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_set_action_hide_empty): renamed from
	set_action_important(). Set the "hide-if-empty" property so
	showing an insensitive "Empty" item instead of hiding the submenu
	works again (did this ever work?).

	* app/actions/tool-options-actions.c (tool_options_actions_setup):
	changed accordingly. Keeps the tool options submenus from
	disappearing.
2005-09-23 23:41:43 +00:00
Michael Natterer
ae4d65ac04 Separated the global buffer logic from the clipboard implementation:
2005-09-21  Michael Natterer  <mitch@gimp.org>

	Separated the global buffer logic from the clipboard
	implementation:

	* app/widgets/gimpclipboard.[ch]: removed all knowledge about
	gimp->global_buffer. Removed the Gimp::buffer-changed callback.
	Made gimp_clipboard_set_buffer() public and remember the set
	buffer in the GimpClipboard struct. Fixed the has_buffer() and
	has_svg() functions.

	* app/gui/gui.c: connect to Gimp::buffer-changed here and call
	gimp_clipboard_set_buffer() from the callback.
2005-09-21 14:35:51 +00:00
Michael Natterer
c7998a1855 added new public function gimp_clipboard_set_svg() and internal stuff to
2005-09-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.[ch]: added new public function
	gimp_clipboard_set_svg() and internal stuff to offer and transfer
	the svg data to the clipboard.

	* app/actions/vectors-commands.c (vectors_copy_cmd_callback)
	(vectors_paste_cmd_callback): implement copy/paste of vectors as
	SVG. Fixes bug #316547.

	* app/widgets/gimpvectorstreeview.c
	(gimp_vectors_tree_view_drag_svg): don't add the terminating
	nul-byte of the svg string to svg_data_length, it confuses the XML
	parser.

	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]
	* menus/vectors-menu.xml: reordered export/import so they are in
	the same order as copy/paste.
2005-09-19 21:33:03 +00:00
Sven Neumann
e9443b5774 autogen.sh configure.in app/main.c app/widgets/gimptoolbox.c changed "The
2005-09-19  Sven Neumann  <sven@gimp.org>

	* autogen.sh
	* configure.in
	* app/main.c
	* app/widgets/gimptoolbox.c
	* plug-ins/script-fu/scripts/web-browser.scm: changed "The GIMP"
	to "GNU Image Manipulation Program" or just "GIMP".
2005-09-19 13:15:31 +00:00
Sven Neumann
3b28167dd2 use GTK_STOCK_FILE for File actions.
2005-09-19  Sven Neumann  <sven@gimp.org>

	* app/actions/actions.c: use GTK_STOCK_FILE for File actions.

	* app/actions/dialogs-actions.c
	* plug-ins/gimpressionist/gimpressionist.c
	* plug-ins/print/gimp_main_window.c: use GTK_STOCK_ABOUT for About
	dialogs.

	* app/actions/actions.c
	* app/actions/brushes-actions.c
	* app/actions/channels-actions.c
	* app/actions/channels-commands.c
	* app/actions/colormap-editor-actions.c
	* app/actions/gradients-actions.c
	* app/actions/layers-actions.c
	* app/actions/layers-commands.c
	* app/actions/palette-editor-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c
	* app/actions/templates-actions.c
	* app/actions/templates-commands.c
	* app/actions/text-editor-actions.c
	* app/actions/tool-options-actions.c
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpcontrollereditor.c
	* app/widgets/gimpcontrollerlist.c
	* plug-ins/flame/flame.c
	* plug-ins/gflare/gflare.c
	* plug-ins/gimpressionist/orientation.c
	* plug-ins/gimpressionist/size.c
	* plug-ins/metadata/interface.c: s/GIMP_STOCK_EDIT/GTK_STOCK_EDIT/
2005-09-19 13:07:24 +00:00
Michael Natterer
1adf3d71af Did a global s/qmask/quick-mask/:
2005-09-19  Michael Natterer  <mitch@gimp.org>

	Did a global s/qmask/quick-mask/:

	* app/actions/qmask-actions.[ch]
	* app/actions/qmask-commands.[ch]
	* app/core/gimpimage-qmask.[ch]
	* menus/qmask-menu.xml
	* themes/Default/images/stock-qmask-off-16.png
	* themes/Default/images/stock-qmask-on-16.png: removed.

	* app/actions/quick-mask-actions.[ch]
	* app/actions/quick-mask-commands.[ch]
	* app/core/gimpimage-quick-mask.[ch]
	* menus/quick-mask-menu.xml
	* themes/Default/images/stock-quick-mask-off-16.png
	* themes/Default/images/stock-quick-mask-on-16.png: added.

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/core/Makefile.am
	* app/core/core-enums.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-undo.c
	* app/core/gimpimage.[ch]
	* app/core/gimpundo.[ch]
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-callbacks.[ch]
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell.[ch]
	* app/menus/menus.c
	* app/widgets/gimphelp-ids.h
	* libgimpwidgets/gimpstock.[ch]
	* menus/Makefile.am
	* menus/image-menu.xml.in
	* themes/Default/images/Makefile.am: changed accordingly.
2005-09-19 12:44:06 +00:00
Michael Natterer
f731cb666a skip actions if their name starts with '<' (menu actions created by
2005-09-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.c (gimp_action_view_new): skip
	actions if their name starts with '<' (menu actions created by
	plug-ins have names like "<Image>/Foo/Bar"). Scroll the
	pre-selected action to the center of the view, not to the top.

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_edit_clicked): make the action editor
	transient to the controller editor. Show the edited event's name
	in the controller editor's header.

	* app/widgets/gimpcontrollerwheel.c: use gimp_get_mod_string()
	instead of hardcoding the modifiers in tons of translatable
	strings. Don't call gettext() in GimpController::get_blurb(),
	the strings are already translated.

	* app/widgets/gimpcontrollerkeyboard.c: removed call to gettext()
	here too.
2005-09-17 20:44:06 +00:00
Michael Natterer
ec5cbbac10 mis-named and mis-placed function that sets a widget's tooltip to the
2005-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch] (gimp_widget_set_accel_help):
	mis-named and mis-placed function that sets a widget's tooltip to
	the action's tooltip plus the action's keyboard shortcut.

	* app/widgets/gimptoolbox.c: at least the code is not here any
	more.

	* app/actions/tools-actions.c: use tool_info->help, not ->blurb
	as the action's tooltip so the above works.
2005-09-16 00:46:21 +00:00
Michael Natterer
710bc36a29 removed.
2005-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (gimp_toolbox_substitute_underscores):
	removed.
2005-09-13 22:20:19 +00:00
Michael Natterer
a14a317722 removed "<>" around modifiers.
2005-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_get_mod_name_*): removed
	"<>" around modifiers.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpthumbbox.c: added "()" around the whole modifier
	string where appropriate.

	* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
	use gimp_get_mod_string() instead of homebrewn variant of the same
	code.

	* app/widgets/gimpcontrollerkeyboard.c: replaced tons of static
	translatable strings containing modifiers by generated ones using
	gimp_get_mod_string() (traded for some more memory consumption).
2005-09-13 22:17:05 +00:00
Michael Natterer
6017accc87 don't make "Detach Tab" insensitive if there are other dockbooks in the
2005-09-13  Michael Natterer  <mitch@gimp.org>

	* app/actions/dockable-actions.c (dockable_actions_update): don't
	make "Detach Tab" insensitive if there are other dockbooks in the
	dock.

	* app/widgets/gimpdock.[ch]
	* app/widgets/gimpdockseparator.[ch]: cleanup.
2005-09-13 21:07:28 +00:00
Michael Natterer
7d08450cbc Really fix bug #150593:
2005-09-12  Michael Natterer  <mitch@gimp.org>

	Really fix bug #150593:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpdockseparator.[ch]: new widget implementing the
	droppable separator bar in docks.

	* app/widgets/gimpdock.c: use it and removed local separator
	utility functions.

	* app/widgets/gimptoolbox.c: use GimpDockSeparator API to show/hide
	the label. Expand the separator initially.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: the separator height style property moved
	from GimpDock to GimpDockSeparator.
2005-09-12 17:48:40 +00:00
Sven Neumann
d32a009ba6 set the label style italic. Moved separator code into utility functions.
2005-09-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolbox.c: set the label style italic. Moved
	separator code into utility functions.
2005-09-11 22:47:42 +00:00
Michael Natterer
99d9597ffe if there is no dockbook added, expand the separator and add a label
2005-09-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (gimp_toolbox_book_added)
	(gimp_toolbox_book_removed): if there is no dockbook added, expand
	the separator and add a label telling the user that she can drop
	dockables there. Fixes bug #150593.
2005-09-11 21:08:27 +00:00
Michael Natterer
1db678df12 take the container's border_width into account.
2005-09-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerbox.c
	(gimp_container_box_set_size_request): take the container's
	border_width into account.

	* app/widgets/gimpcontainergridview.c
	(gimp_container_grid_view_init): make sure GTK_SHADOW_IN is set on
	the scrolled window, not on the viewport, so we get the same
	results for list and grid views when using
	gimp_container_box_set_size_request().

	* app/widgets/gimpcontainerpopup.[ch]: added setters and getters
	for view_type and preview_size, don't allow the preview to grow
	larger than the popup.

	* app/widgets/gimpviewablebutton.[ch]: added "popup-view-type" and
	"popup-preview-size" properties and setters/getters.
2005-09-10 22:50:57 +00:00
Michael Natterer
33f16adfe6 factored out common code in preparation of fixing bug #315443.
2005-09-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewablebox.c: factored out common code in
	preparation of fixing bug #315443.

	* app/widgets/gimpviewablebutton.h (struct GimpViewableButton):
	"popup_preview_size" is a gint, not a GimpViewType.
2005-09-10 20:35:13 +00:00
Michael Natterer
b10adabb5e Added parent window API to the GimpProgress interface and to the libgimp
2005-09-09  Michael Natterer  <mitch@gimp.org>

	Added parent window API to the GimpProgress interface and to
	the libgimp progress stuff. Might look strange, but does
	the right thing in almost all cases (image window, file dialog,
	script-fu dialog etc). Fixes bug #62988.

	* app/core/gimpprogress.[ch]: added GimpProgress::get_window()
	which should return a toplevel window ID if the progress is in a
	window that wants to be the transient parent of plug-in dialogs.

	* app/widgets/gimpwidgets-utils.[ch] (gimp_window_get_native): new
	function which returns the window handle of a GtkWindow's GdkWindow.

	* app/widgets/gimpfiledialog.c: implement ::get_window().

	* app/display/gimpdisplay.[ch]: ditto. Removed window handle API.

	* app/gui/gui-vtable.c: changed accordingly.

	* libgimpbase/gimpbaseenums.[ch] (enum GimpProgressCommand):
	added GIMP_PROGRESS_COMMAND_GET_WINDOW.

	* app/plug-in/plug-in-progress.[ch] (plug_in_progress_get_window):
	new function. Also renamed some functions to match the
	GimpProgress interface, and not the legacy PDB procedure names.

	* tools/pdbgen/pdb/progress.pdb
	* app/core/gimppdbprogress.c: implement get_window() on both
	sides of the wire, keeping backward compatibility (hopefully).

	* libgimp/gimpprogress.[ch]: deprecated gimp_progress_install()
	and added gimp_progress_install_vtable() which takes a vtable with
	padding to be extensible. Added get_window() vtable entry and
	dispatch it accordingly. Also added pulse() which was implemented
	in a hackish way before. Everything is of course backward
	compatible.

	* libgimp/gimpprogressbar.c: inmplement the get_window() stuff
	so a plug-in dialog containing a progress can be the transient
	parent of another dialog in another plug-in.

	* libgimp/gimpui.[ch] (gimp_ui_get_progress_window): new function
	which returns a foreign GdkWindow of this plug-ins progress
	window.

	Renamed gimp_window_set_transient_for_default_display() to
	gimp_window_set_transient() and make it use the progress' window
	handle instead of the display's (which is the right thing to do in
	almost all cases).

	* libgimp/gimp.def
	* libgimp/gimpui.def: add the new functions.

	* tools/pdbgen/enums.pl
	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimpexport.c
	* plug-ins/*/*.c: follow API change.
2005-09-09 18:07:31 +00:00
Michael Natterer
805602b657 if the floating selection has no alpha, manually create BoundSegs of its
2005-09-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayer-floating-sel.c (floating_sel_boundary): if
	the floating selection has no alpha, manually create BoundSegs of
	its outline instead of calling boundary_find() (which creates a
	boundary of the last channel). Fixes bug #145373.

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): update all
	layer names' text attributes, not only for layers with alpha.
	Fixes layer name display when making a new layer out of a floating
	selection without alpha.
2005-09-08 19:38:58 +00:00
Michael Natterer
7e34681f86 app/widgets/gimpcontainergridview.c allow to popup the context menu from
2005-09-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c: allow to popup the context
	menu from the views' empty area. Fixes bug #314719.
2005-09-08 18:23:14 +00:00
Sven Neumann
f142aa4e9a don't set a window icon, the dialog should be transient anyway.
2005-09-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch]: don't set a window icon, the
	dialog should be transient anyway.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-09-07 00:28:31 +00:00
Sven Neumann
19152b85bb app/actions/edit-actions.c app/menus/menus.c app/widgets/gimpundoeditor.c
2005-09-05  Sven Neumann  <sven@gimp.org>

	* app/actions/edit-actions.c
	* app/menus/menus.c
	* app/widgets/gimpundoeditor.c
	* menus/Makefile.am
	* menus/undo-editor-menu.xml: added menu for undo editor.
2005-09-05 19:31:28 +00:00
Michael Natterer
37354a9248 Cleaned up and fixed the order in which default tool options and user
2005-09-04  Michael Natterer  <mitch@gimp.org>

	Cleaned up and fixed the order in which default tool options and
	user context values are initialized, and added loading / saving of
	the global user context.  Fixes bug #165078.

	* app/core/Makefile.am
	* app/core/gimp-contexts.[ch]: new files which manage the global
	contexts. Contains gimp_contexts_init/exit/load/save/clear().

	* app/core/gimp.c: use the new init/exit functions instead of
	implementing the stuff here.

	* app/tools/gimp-tools.c: load/save/clear the user context from
	here so it follows the same logic as the tool options. Reset all
	tool options before loading the user context and copy the user
	context's property to all tool options before loading tool
	options.

	* app/core/gimptoolinfo.c (gimp_tool_info_new): don't initialize
	the tool options with the users context's properties. It's way too
	early here and they will be overwritten later.

	* app/widgets/gimpdevices.c (gimp_devices_restore): initialize all
	device contexts with the user context's properties before loading
	the devices and copying the active one back to the user context.
2005-09-04 10:44:04 +00:00
Michael Natterer
89bb3fffa1 don't create a display here.
2005-09-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-edit.[ch] (gimp_edit_paste_as_new): don't create a
	display here.

	(gimp_edit_named_cut)
	(gimp_edit_named_copy)
	(gimp_edit_named_copy_visible): new functions containing named
	buffer wrappers around the functions affecting the global buffer
	only.

	* app/actions/edit-commands.c: use the new functions instead of
	implementing them here, create a display for the image returned
	by paste as new.

	* app/actions/buffers-commands.c
	* app/widgets/gimptoolbox-dnd.c: create displays here too.

	* tools/pdbgen/pdb/edit.pdb: added wrappers for paste as new and
	wrappers for all the cut/copy/paste named stuff.
	Fixes bug #315130. Cleaned up and de-obfuscated.

	* libgimp/gimp.def: changed accordingly.

	* app/pdb/edit_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpedit_pdb.[ch]: regenerated.
2005-09-02 22:50:06 +00:00
Sven Neumann
5f2904f9c5 app/widgets/gimpcontainergridview.c allow to popup menus on empty
2005-09-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c: allow to popup menus on
	empty container views using the standard Shift-F10 keybinding.
2005-09-02 21:56:20 +00:00
Sven Neumann
32d5c88977 app/tools/gimptextoptions.c dropped the labels from text tool options that
2005-09-02  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c
	* app/widgets/gimpwidgets-utils.[ch]: dropped the labels from text
	tool options that have icons. Reduces visual clutter.
2005-09-02 17:22:29 +00:00
Michael Natterer
7cc7bf4c05 initialize renderer->columns to != 0 to avoid floating point exceptions on
2005-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_init): initialize renderer->columns
	to != 0 to avoid floating point exceptions on initial layout
	calculation. Fixes bug #314663.
2005-08-27 18:13:06 +00:00
Michael Natterer
57f7f66a5f minor code and formatting cleanup.
2005-08-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpview.[ch]: minor code and formatting cleanup.
2005-08-25 19:06:49 +00:00
Sven Neumann
e7a14aaa71 applied capitalization patches contributed by Stephan Binner. Fixes bug
2005-08-23  Sven Neumann  <sven@gimp.org>

	* [lots of files]: applied capitalization patches contributed by
	Stephan Binner. Fixes bug #309657.
2005-08-23 00:18:08 +00:00
Sven Neumann
1a94b2be20 app/actions/channels-commands.c app/actions/qmask-commands.c
2005-08-23  Sven Neumann  <sven@gimp.org>

	* app/actions/channels-commands.c
	* app/actions/qmask-commands.c
	* app/dialogs/channel-options-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/dialogs/module-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/dialogs/resize-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/dialogs/vectors-options-dialog.c
	* app/display/gimpdisplayshell-scale.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpblendoptions.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpstrokeeditor.c
	* libgimpwidgets/gimpcolorselection.c
	* modules/cdisplay_colorblind.c
	* modules/cdisplay_highcontrast.c
	* modules/colorsel_cmyk.c
	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/common/colorify.c
	* plug-ins/common/film.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/lic.c
	* plug-ins/common/pixelize.c
	* plug-ins/common/sample_colorize.c
	* plug-ins/common/sinus.c
	* plug-ins/common/sparkle.c
	* plug-ins/gflare/gflare.c
	* plug-ins/ifscompose/ifscompose.c
	* plug-ins/imagemap/imap_cmd_guides.c
	* plug-ins/imagemap/imap_preferences.c
	* plug-ins/metadata/interface.c
	* plug-ins/print/gimp_color_window.c
	* plug-ins/print/gimp_main_window.c
	* plug-ins/rcm/rcm_dialog.c
	* plug-ins/script-fu/script-fu-server.c: applied patch from
	Stephan Binner that fixes capitalization issues (bug #309657).
2005-08-22 23:39:12 +00:00
Michael Natterer
6dbac4fae1 app/paint/gimppencil.h app/paint/gimppenciloptions.h
2005-08-21  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppencil.h
	* app/paint/gimppenciloptions.h
	* app/widgets/widgets-types.h
	* app/widgets/gimptooldialog.h: don't simply typedef object
	instance structs which add no members as their parent instance
	structs. Give them their own instance structs.  Fixes gtk-doc
	confusion.
2005-08-21 17:28:18 +00:00
Sven Neumann
2cbf6ca5f4 when looking for the file extension, only look at the part after the last
2005-08-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	when looking for the file extension, only look at the part after
	the last directory separator.
2005-08-20 20:34:25 +00:00
Michael Natterer
c0b1fcb92c cursors/Makefile.am cursors/gimp-tool-cursors.xcf
2005-08-18  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/gimp-tool-cursors.xcf
	* cursors/modifier-join.png
	* cursors/xbm/modifier-join-mask.xbm
	* cursors/xbm/modifier-join.xbm: images for a "join" cursor modifier.

	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c: add the cursor.

	* app/tools/gimpvectortool.c: use it for connecting strokes.
	Fixes bug #313252.
2005-08-18 21:35:06 +00:00
Sven Neumann
2ebf0647c5 go back to using dpi as the default resolution unit.
2005-08-18  Sven Neumann  <sven@gimp.org>

	* app/core/gimptemplate.c: go back to using dpi as the default
	resolution unit.

	* app/core/gimp-utils.[ch]: moved the code to determine the unit
	from the locale settings here as gimp_get_default_unit().

	* app/dialogs/print-size-dialog.c
	* app/widgets/gimpimagepropview.c: use the unit returned by the
	new function to display the print size (bug #107497).
2005-08-18 15:08:49 +00:00
Michael Natterer
047a01e24f when focussing the widget, select the palette's first entry if none is
2005-08-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteview.c (gimp_palette_view_focus): when
	focussing the widget, select the palette's first entry if none is
	selected. Enables cursor navigation after tabbing in.
2005-08-17 01:25:20 +00:00
Michael Natterer
1e483fcb10 return FALSE on TAB_FORWARD and TAB_BACKWARD. Enables tabbing out of the
2005-08-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteview.c (gimp_palette_view_focus): return
	FALSE on TAB_FORWARD and TAB_BACKWARD. Enables tabbing out of the
	widget.
2005-08-17 00:39:44 +00:00
Sven Neumann
19e7e076dc added utility function gimp_container_view_install_properties() to reduce
2005-08-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.[ch]: added utility function
	gimp_container_view_install_properties() to reduce code duplication
	in classes implementing this interface.

	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainerentry.c: changed accordingly.
2005-08-16 11:40:04 +00:00
Sven Neumann
ad77d59c97 added casts to silent signedness warnings 2005-08-09 21:27:36 +00:00
Michael Natterer
6c88e46d72 changed path tool cursor to actually show a path and added 3 new cursors
2005-08-09  Michael Natterer  <mitch@gimp.org>

	* cursors/gimp-tool-cursors.xcf: changed path tool cursor to
	actually show a path and added 3 new cursors which are supposed
	to show a path's anchor, handle and segments. Someone really
	needs to beautify these...

	* cursors/tool-paths.png
	* cursors/xbm/tool-paths-mask.xbm
	* cursors/xbm/tool-paths.xbm: changed accordingly.

	* cursors/Makefile.am
	* cursors/tool-paths-anchor.png
	* cursors/tool-paths-control.png
	* cursors/tool-paths-segment.png
	* cursors/xbm/tool-paths-anchor-mask.xbm
	* cursors/xbm/tool-paths-anchor.xbm
	* cursors/xbm/tool-paths-control-mask.xbm
	* cursors/xbm/tool-paths-control.xbm
	* cursors/xbm/tool-paths-segment-mask.xbm
	* cursors/xbm/tool-paths-segment.xbm: new files.

	* app/widgets/widgets-enums.h (enum GimpToolCursorType): added
	PATH_ANCHOR, PATH_CONTROL and PATH_SEGMENTS.

	* app/widgets/gimpcursor.c: added the new cursors.

	* app/tools/gimpvectortool.c (gimp_vector_tool_cursor_update):
	use them.
2005-08-09 21:22:11 +00:00
Michael Natterer
a8257d8ded made hitting Escape in the name entry restore the data's original name.
2005-08-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.c: made hitting Escape in the name
	entry restore the data's original name. Enables undoing of
	accidential editing. Addresses bug #169257.
2005-08-08 01:04:26 +00:00
Michael Natterer
4c6d9ddd78 new function.
2005-08-07  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayer.[ch] (gimp_layer_flatten): new function.

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in
	* menus/layers-menu.xml: added "Remove Alpha Channel" action,
	action callback, help ID and menu items. Fixes bug #309762.
2005-08-07 16:38:35 +00:00
Michael Natterer
39f4e7bdb3 applied patch from Robert Ögren that frees the event returned by
2005-08-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c (gimp_ui_manager_ui_popup): applied
	patch from Robert Ögren that frees the event returned by
	gtk_get_current_event(). Fixes bug #312017.
2005-08-06 14:37:53 +00:00
Sven Neumann
d60faca9a1 libgimpwidgets/gimppropwidgets.[ch] added gimp_prop_hscale_new().
2005-08-06  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimppropwidgets.[ch]
	* libgimpwidgets/gimpwidgets.def: added gimp_prop_hscale_new().

	* app/tools/gimpforegroundselectoptions.c: added a control for the
	stroke width.

	* app/tools/gimpforegroundselecttool.c: cancel the tool if the
	active drawable or the image size changes.

	* app/widgets/gimpcontrollerlist.c: fixed signedness warning.
2005-08-06 13:03:59 +00:00
Michael Natterer
2b588cdec1 increased spacing between property groups to 12 pixels.
2005-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpimagepropview.c: increased spacing between
	property groups to 12 pixels.
2005-08-04 19:42:24 +00:00
Michael Natterer
2754328fc8 added cursor navigation.
2005-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteview.c: added cursor navigation.
2005-08-04 00:09:33 +00:00
Michael Natterer
4e9fd4f69f canonicalize hardcoded procedure names.
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new):
	canonicalize hardcoded procedure names.
2005-08-03 09:38:01 +00:00
Michael Natterer
32d875d070 app/dialogs/module-dialog.c app/dialogs/palette-import-dialog.c
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/module-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/gui/gui.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpenumaction.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimpmessagebox.c
	* app/widgets/gimpmessagedialog.c
	* app/widgets/gimppluginaction.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpsamplepointeditor.c
	* app/widgets/gimpstringaction.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox.c: use canonical names for signals and
	properties.
2005-08-03 09:34:55 +00:00
Sven Neumann
4f870bc132 deprecated RGB intensity functions and definitions. These coefficients do
2005-08-03  Sven Neumann  <sven@gimp.org>

	* libgimpcolor/gimprgb.[ch]: deprecated RGB intensity functions
	and definitions. These coefficients do not accurately compute
	luminance for contemporary monitors. Instead the coefficients from
	the sRGB spec should be used which have now been added.

	* libgimpcolor/gimpcolor.def: updated.

	* libgimp/gimpdrawable.c
	* libgimp/gimppixelfetcher.c
	* app/base/colorize.c
	* app/base/levels.c
	* app/base/temp-buf.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-convert.c
	* app/core/gimpdrawable-desaturate.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage.c
	* app/gui/splash.c
	* app/widgets/gimpgradienteditor.c
	* modules/colorsel_triangle.c
	* plug-ins/common/aa.c
	* plug-ins/common/bumpmap.c
	* plug-ins/common/colorify.c
	* plug-ins/common/despeckle.c
	* plug-ins/common/displace.c
	* plug-ins/common/engrave.c
	* plug-ins/common/gradmap.c
	* plug-ins/common/grid.c
	* plug-ins/common/mng.c
	* plug-ins/common/newsprint.c
	* plug-ins/common/png.c
	* plug-ins/common/whirlpinch.c
	* plug-ins/gflare/gflare.c
	* plug-ins/gfli/gfli.c
	* plug-ins/maze/handy.c
	* plug-ins/pagecurl/pagecurl.c: use gimp_rgb_luminance() and
	friends instead of the deprecated intensity functions.
2005-08-03 00:36:41 +00:00
Michael Natterer
335ba07644 app/actions/vectors-commands.c canonicalized some hardcoded procedure
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/actions/vectors-commands.c
	* app/widgets/gimphelp.c: canonicalized some hardcoded procedure
	names because internal functions accept only canonical names now.
2005-08-02 23:02:56 +00:00
Sven Neumann
26eecddbdc loop unrolling.
2005-07-30  Sven Neumann  <sven@gimp.org>

	* app/base/gimphistogram.c (gimp_histogram_calculate_sub_region):
	loop unrolling.

	* app/dialogs/about-dialog.c
	* app/widgets/gimpselectiondata.c
	* plug-ins/bmp/bmpread.c (ReadBMP)
	* plug-ins/gfig/gfig.c (gfig_load)
	* plug-ins/imagemap/imap_preview.c
	* plug-ins/imagemap/imap_selection.c
	* plug-ins/jpeg/jpeg-exif.c
	* plug-ins/common/dicom.c: fixed signedness warnings.
2005-07-30 14:05:57 +00:00
Sven Neumann
b8fc8e6050 themes/Default/images/Makefile.am
2005-07-29  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/tools/stock-tool-foreground-select-16.png
	* themes/Default/images/tools/stock-tool-foreground-select-22.png:
	added placeholder for yet-to-be-drawn tool icon.

	* libgimpwidgets/gimpstock.[ch]: register it.

	* app/tools/gimpforegroundselecttool.c: use it.

	* app/widgets/gimpclipboard.[ch] (gimp_clipboard_get_svg): return
	a signed char pointer.

	* app/actions/edit-commands.c
	* app/tools/gimpinkoptions-gui.c: fixed signedness issues.
2005-07-29 18:04:59 +00:00
Sven Neumann
a5abd45337 added gimp_scan_convert_render_value(), a variant of
2005-07-29  Sven Neumann  <sven@gimp.org>

	* app/core/gimpscanconvert.[ch]: added
	gimp_scan_convert_render_value(), a variant of
	gimp_scan_convert_render() that allows to pass the foreground value.

	* app/tools/gimpfreeselecttool.[ch]: added a virtual "select" method.

	* app/tools/Makefile.am
	* app/tools/gimp-tools.c
	* app/tools/gimpforegroundselecttool.[ch]: added a rough first
	version of foreground selection tool based on the SIOX algorithm.
	Work in progress...

	* app/widgets/gimphelp-ids.h: added help-id for the new tool.
2005-07-29 01:48:56 +00:00
Sven Neumann
0728f76b35 added gimp_undo_stack_get_depth().
2005-07-29  Sven Neumann  <sven@gimp.org>

	* app/core/gimpundostack.[ch]: added gimp_undo_stack_get_depth().

	* app/widgets/gimpimagepropview.[ch]: display number and memory
	usage of undo/redo steps.

	* app/core/gimpimage-merge.c: fixed signedness issue.
2005-07-28 22:40:32 +00:00
Michael Natterer
c1c876a963 Some DND fixes / cleanup:
2005-07-25  Michael Natterer  <mitch@gimp.org>

	Some DND fixes / cleanup:

	* app/widgets/widgets-enums.h: renamed GIMP_DND_TYPE_TOOL to
	GIMP_DND_TYPE_TOOL_INFO.

	* app/widgets/gimpselectiondata.[ch]: s/tool/tool_info/g. Moved
	private functions to the end of the file. Include GIMP's PID in
	all GtkSelectionData strings which are used to pass around stuff
	by reference. For things which are referenced by name, also encode
	the object's address in the GtkSelectionData so having a brush
	called "Standard" or a named buffer called "Global Buffer" will
	work together with DND.

	* app/widgets/gimpdnd.[ch]: s/tool/tool_info/g. Renamed
	gimp_dnd_get_data_data() to gimp_dnd_get_object_data() since it's
	not limited to GimpData objects. Follow above selection data API
	changes. Cleanup.

	* libgimp/gimpbrushmenu.c
	* libgimp/gimpdrawablecombobox.c
	* libgimp/gimpfontselectbutton.c
	* libgimp/gimpgradientmenu.c
	* libgimp/gimpimagecombobox.c
	* libgimp/gimppalettemenu.c
	* libgimp/gimppatternmenu.c: follow GtkSelectionData format change
	and check the dropped things' PID against the return value of
	gimp_getpid().
2005-07-25 13:53:00 +00:00
Michael Natterer
b886b0179b special case the global buffer so it can be dropped, not only dragged
2005-07-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.c
	(gimp_selection_data_get_buffer): special case the global buffer
	so it can be dropped, not only dragged around.
2005-07-23 19:42:20 +00:00
Michael Natterer
f0c7009c29 allow to drop palettes onto the palette view again.
2005-07-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteeditor.c (gimp_palette_editor_init):
	allow to drop palettes onto the palette view again.
2005-07-22 11:12:43 +00:00
Sven Neumann
afc7754c9e fixed the GIMP_ZOOM_TO case for palettes with a number of colors that is
2005-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppaletteeditor.c (gimp_palette_editor_zoom):
	fixed the GIMP_ZOOM_TO case for palettes with a number of colors
	that is not a multiple of the number of columns.
2005-07-22 08:19:05 +00:00
Sven Neumann
222d5a8935 reverted my last change here and replaced it with a better fix.
2005-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_render): reverted my last change here
	and replaced it with a better fix.
2005-07-22 08:09:40 +00:00
Michael Natterer
2a48c63e90 setup the dnd stuff in GimpView::set_viewable() and remove GimpView's
2005-07-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteview.c: setup the dnd stuff in
	GimpView::set_viewable() and remove GimpView's automatically added
	GimpPalette drag source. Fixes color dragging (bug #113237).
2005-07-21 22:36:14 +00:00
Michael Natterer
19ea2a9db4 app/widgets/Makefile.am new files keeping the render acceleration check
2005-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimprender.[ch]: new files keeping the render
	acceleration check buffers.

	* app/display/gimpdisplayshell-render.[ch]: removed them here.

	* app/gui/gui.c: initialize/shutdown the new buffers.

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/actions/view-actions.c
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell.c: use the new stuff. Removes
	lots of broken widgets -> display dependencies.
2005-07-19 20:42:14 +00:00
Michael Natterer
7e11ba99b8 renamed member "palette" to "preview", cleanup.
2005-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.[ch]: renamed member "palette"
	to "preview", cleanup.
2005-07-19 19:37:07 +00:00
Sven Neumann
1e76f341f9 try a different style for the info labels below the histogram; mainly to
2005-07-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c: try a different style for the
	info labels below the histogram; mainly to avoid repositioning.
2005-07-19 09:44:46 +00:00
Sven Neumann
2c544f73bd added missing casts.
2005-07-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd-xds.c: added missing casts.
2005-07-17 20:01:59 +00:00
Sven Neumann
e28327299a also show the number of pixels.
2005-07-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagepropview.[ch]: also show the number of pixels.
2005-07-15 22:51:48 +00:00
Sven Neumann
873dec37d7 don't crash on empty palettes.
2005-07-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_render): don't crash on empty palettes.
2005-07-15 08:30:39 +00:00
Michael Natterer
8d856ef5de app/widgets/gimphistogramview.c cleanup.
2005-07-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogramview.c
	* app/widgets/gimpnavigationview.c: cleanup.
2005-07-14 18:51:32 +00:00
Michael Natterer
d280c77f3f added "entry-clicked" and "color-dropped" signals. Completely handle color
2005-07-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteview.[ch]: added "entry-clicked" and
	"color-dropped" signals. Completely handle color DND. Cleanup.

	* app/core/gimpmarshal.list: marshallers for above signals.

	* app/widgets/gimppaletteeditor.[ch]: chopped and reassembled.
	Remove tons of code and use a GimpPaletteView instead of the
	deprecated GtkPreview. Addresses bug #102204.
2005-07-14 18:37:33 +00:00
Michael Natterer
c0a10c8303 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-07-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppaletteview.[ch]: new widget which manages the
	selected palette entry itself and emits "selected", "activated"
	and "context" signals. Not used yet.

	* app/widgets/gimpviewrendererpalette.[ch]: reimplemented palette
	drawing: added optional grid drawing and APIs to configure the
	renderer. Should be ready for the palette editor now.
2005-07-14 14:41:29 +00:00
Michael Natterer
e9c1b3d207 implement it the same way as gimp_palette_get_preview(). Can't be used for
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererpalette.c
	(gimp_view_renderer_palette_render): implement it the same way as
	gimp_palette_get_preview(). Can't be used for the palette editor
	yet.
2005-07-13 20:47:08 +00:00
Michael Natterer
98dc0a67b7 app/widgets/Makefile.am app/widgets/widgets-types.h new view renderer,
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererpalette.[ch]: new view renderer,
	does nothing yet except chaining up in ::render().

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_by_viewable_type): use it for palettes.
2005-07-13 20:11:24 +00:00
Michael Natterer
8938834a72 actually return the added entry, and not always the palette's last entry
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/core/gimppalette.c (gimp_palette_add_entry): actually return
	the added entry, and not always the palette's last entry (argh!).

	* app/widgets/gimppaletteeditor.c: make sure the cursor is always
	on the newly added color. Really fixes #15060 this time.
2005-07-13 17:46:12 +00:00
Michael Natterer
153748330a added new public function gimp_dockable_blink_cancel() which stops title
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.[ch]: added new public function
	gimp_dockable_blink_cancel() which stops title blinking.

	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
	cancel blinking when updating a picked color so the dockable
	doesn't flicker for each cursor movement.
2005-07-13 17:03:44 +00:00
Michael Natterer
736c547bd8 add colors after the cursor. Fixes bug #150608.
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppaletteeditor.c (gimp_palette_editor_pick_color):
	add colors after the cursor. Fixes bug #150608.
2005-07-13 16:23:54 +00:00
Michael Natterer
e1be822e3d moved the lock alpha toggle to a separate "Lock:" line.
2005-07-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_init):
	moved the lock alpha toggle to a separate "Lock:" line.
2005-07-10 21:24:21 +00:00
Michael Natterer
20b4769cf5 app/actions/layers-actions.c app/actions/layers-commands.[ch]
2005-07-10  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/core/core-enums.[ch]
	* app/core/gimpimage-undo-push.[ch]
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.[ch]
	* app/text/gimptextlayer-xcf.c
	* app/widgets/gimphelp-ids.h
	* app/widgets/gimplayertreeview.[ch]
	* app/xcf/xcf-load.c
	* app/xcf/xcf-private.h
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb
	* menus/image-menu.xml.in
	* libgimp/gimp.def: did a global s/preserve_trans/lock_alpha/ in
	preparation for more layer locking flags.

	* app/pdb/procedural_db.c
	* libgimp/gimplayer.[ch]: added compat stuff for preserve_trans.

	* app/pdb/layer_cmds.c
	* libgimp/gimplayer_pdb.[ch]: regenerated.

	* plug-ins/common/colortoalpha.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/psd.c
	* plug-ins/common/psd_save.c
	* plug-ins/common/psp.c
	* plug-ins/common/rotate.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/common/vpropagate.c
	* plug-ins/script-fu/scripts/3d-outline.scm
	* plug-ins/script-fu/scripts/alien-glow-bar.scm
	* plug-ins/script-fu/scripts/alien-glow-bullet.scm
	* plug-ins/script-fu/scripts/alien-glow-logo.scm
	* plug-ins/script-fu/scripts/basic1-logo.scm
	* plug-ins/script-fu/scripts/basic2-logo.scm
	* plug-ins/script-fu/scripts/beveled-pattern-button.scm
	* plug-ins/script-fu/scripts/blend-anim.scm
	* plug-ins/script-fu/scripts/blended-logo.scm
	* plug-ins/script-fu/scripts/bovinated-logo.scm
	* plug-ins/script-fu/scripts/burn-in-anim.scm
	* plug-ins/script-fu/scripts/carved-logo.scm
	* plug-ins/script-fu/scripts/chalk.scm
	* plug-ins/script-fu/scripts/chip-away.scm
	* plug-ins/script-fu/scripts/comic-logo.scm
	* plug-ins/script-fu/scripts/coolmetal-logo.scm
	* plug-ins/script-fu/scripts/crystal-logo.scm
	* plug-ins/script-fu/scripts/drop-shadow.scm
	* plug-ins/script-fu/scripts/gimp-headers.scm
	* plug-ins/script-fu/scripts/gimp-labels.scm
	* plug-ins/script-fu/scripts/glowing-logo.scm
	* plug-ins/script-fu/scripts/gradient-bevel-logo.scm
	* plug-ins/script-fu/scripts/image-structure.scm
	* plug-ins/script-fu/scripts/neon-logo.scm
	* plug-ins/script-fu/scripts/perspective-shadow.scm
	* plug-ins/script-fu/scripts/starburst-logo.scm
	* plug-ins/script-fu/scripts/starscape-logo.scm
	* plug-ins/script-fu/scripts/textured-logo.scm
	* plug-ins/script-fu/scripts/title-header.scm
	* plug-ins/script-fu/scripts/waves-anim.scm
	* plug-ins/xjt/xjt.c: changed accordingly.
2005-07-10 21:17:22 +00:00
Hans Breuer
d9ac028c50 updated dont include "gimpmessagedialog.c" to avoid redefinitions. Instead
2005-07-10  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc app/gimpcore.def : updated
	* app/widgets/gimpcontrollerlist.c : dont include
	"gimpmessagedialog.c" to avoid redefinitions.
	Instead include gimpmessagebox.h and gimpmessagedialog.h

	* plug-ins/common/raw.c : include <io.h>
	* plug-ins/common/screenshot.c : make it compile. It
	still has no code to actually work on win32.
2005-07-10 16:24:57 +00:00
Michael Natterer
df4aa0715a added "sample-merged" property and API. Pass it to
2005-07-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsamplepointeditor.[ch]: added "sample-merged"
	property and API. Pass it to gimp_image_pick_color().

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/sample-point-editor-actions.[ch]
	* app/actions/sample-point-editor-commands.[ch]: actions and
	callbacks for the sample point editor's menu.

	* app/widgets/gimphelp-ids.h: its help IDs.

	* app/menus/menus.c
	* menus/Makefile.am
	* menus/sample-point-editor-menu.xml: the sample point editor menu.
2005-07-09 11:23:15 +00:00
Michael Natterer
2a71ce5e59 if sample_merged is FALSE and drawable is NULL, just get the image's
2005-07-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-pick-color.c (gimp_image_pick_color): if
	sample_merged is FALSE and drawable is NULL, just get the image's
	active drawable instead of bailing out.

	* app/widgets/gimpcursorview.c (gimp_cursor_view_update_cursor):
	use gimp_image_pick_color() insted of duplicating its code.
2005-07-09 11:07:36 +00:00
Sven Neumann
184895d9fb ellipsize the name label.
2005-07-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: ellipsize the name label.
2005-07-08 23:57:47 +00:00
Michael Natterer
2f7388db6f added boolean "sample-merged" property, API and GUI. Pick from the active
2005-07-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcursorview.[ch]: added boolean "sample-merged"
	property, API and GUI. Pick from the active drawable if it's
	FALSE.

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/cursor-info-actions.[ch]
	* app/actions/cursor-info-commands.[ch]: new files with actions
	and callbacks for the cursor info dialog's menu.

	* app/widgets/gimphelp-ids.h: help IDs for above actions.

	* app/dialogs/dialogs.c: follow help ID change.

	* app/menus/menus.c
	* menus/Makefile.am
	* menus/cursor-info-menu.xml: add the cursor-info menu.

	* app/dialogs/dialogs-constructors.c: pass the menu factory to
	gimp_cursor_view_new().
2005-07-08 22:54:46 +00:00
Michael Natterer
7a883afa3a pass the color index value to gimp_color_frame_set_color() so it would
2005-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcursorview.c (gimp_cursor_view_update_cursor):
	pass the color index value to gimp_color_frame_set_color() so it
	would show up in the frame if we actually picked from indexed
	things.
2005-07-08 18:53:09 +00:00
Michael Natterer
c6ca1a8419 enable remote files: set local_only to FALSE if the PDB has
2005-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): enable
	remote files: set local_only to FALSE if the PDB has
	"file_uri_load/save" procedures (yes, this is questionable).
2005-07-08 18:27:24 +00:00
Michael Natterer
8611bb4c4c app/actions/documents-actions.c app/actions/documents-commands.[ch]
2005-07-07  Michael Natterer  <mitch@gimp.org>

	* app/actions/documents-actions.c
	* app/actions/documents-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/documents-menu.xml: added "Copy Image Location" to the
	document history popup menu which copies the image's URI to
	clipbpard and primary.
2005-07-07 21:49:35 +00:00
Sven Neumann
0c9b36d8e8 app/actions/gradient-editor-commands.c app/widgets/gimpcolordialog.c
2005-07-07  Sven Neumann  <sven@gimp.org>

	* app/actions/gradient-editor-commands.c
	* app/widgets/gimpcolordialog.c
	* app/widgets/gimpdock.c
	* plug-ins/gflare/gflare.c
	* plug-ins/script-fu/script-fu-server.c: specify alternative
	button order in some places that were missed earlier (spotted by
	Stephan Binner).
2005-07-07 13:39:33 +00:00
Michael Natterer
bb3cdd5397 set a search column.
2005-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.c (gimp_action_view_new): set a
	search column.
2005-07-06 21:04:37 +00:00
Sven Neumann
d9c4bdc4aa app/tools/gimpcurvestool.c app/tools/gimplevelstool.c added missing casts.
2005-06-27  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpwidgets-constructors.c: added missing casts.
2005-06-27 15:28:44 +00:00
Sven Neumann
b23b035062 added new constructor gimp_enum_combo_box_new_with_model(). Also override
2005-06-27  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpenumcombobox.[ch]: added new constructor
	gimp_enum_combo_box_new_with_model(). Also override the "model"
	property to make it clear that GimpEnumComboBox expects to be
	used with GimpEnumStore.

	* libgimpwidgets/gimpwidgets.def: updated.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpwidgets-constructors.c: use the new constructor.

	* libgimpwidgets/gimpenumlabel.h
	* libgimpwidgets/gimpenumstore.h
	* libgimpwidgets/gimpintcombobox.h
	* libgimpwidgets/gimpintstore.h: use "parent_class", not
	"parent_instance" when including the parent struct.
2005-06-27 13:41:11 +00:00
Sven Neumann
7215e14c34 dialog layout tweaks.
2005-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolordisplayeditor.c: dialog layout tweaks.
2005-06-27 09:35:41 +00:00
Sven Neumann
259e1d13f3 use bold and right-aligned labels for the label titles.
2005-06-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagepropview.c: use bold and right-aligned
	labels for the label titles.
2005-06-25 18:24:00 +00:00
Sven Neumann
feadca6859 use gimp_enum_get_value() to avoid string duplication.
2005-06-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagepropview.c (gimp_image_prop_view_update):
	use gimp_enum_get_value() to avoid string duplication.
2005-06-25 17:01:50 +00:00
Sven Neumann
b40453748b shortened bold labels.
2005-06-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolordisplayeditor.c: shortened bold labels.
2005-06-25 01:05:22 +00:00
Sven Neumann
c002db7b22 use a GtkVPaned.
2005-06-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolordisplayeditor.c: use a GtkVPaned.
2005-06-25 00:11:59 +00:00
Sven Neumann
afddacb1bc added missing id to fix the build.
2005-06-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h: added missing id to fix the build.
2005-06-20 22:00:57 +00:00
Michael Natterer
213deb5bf1 Oops... 2005-06-20 19:38:07 +00:00
Sven Neumann
57a90113ac capitalization.
2005-06-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgrideditor.c: capitalization.
2005-06-15 21:11:03 +00:00
Sven Neumann
7123168f22 there's no need to keep a reference to the anchor button.
2005-06-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplayertreeview.[ch]: there's no need to keep a
	reference to the anchor button.
2005-06-15 14:52:01 +00:00
Sven Neumann
e3800a406e don't display a preview and don't attempt to create one if the image file
2005-06-15  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c (gimp_imagefile_load_thumb):
	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail):
	don't display a preview and don't attempt to create one if the
	image file does not exist any longer (bug #307672).
2005-06-15 10:57:33 +00:00
Michael Natterer
699ad10f79 Allow to use the selected font in the text editor (bug #170299):
2005-06-11  Michael Natterer  <mitch@gimp.org>

	Allow to use the selected font in the text editor (bug #170299):

	* app/widgets/gimptexteditor.[ch]: added a "Use selected font"
	toggle and an API to set/get the selected font name.

	* app/tools/gimptextoptions.c: update the editor's font when the
	text option's font changes. Renamed text editor callbacks to
	gimp_text_options_editor_foo().
2005-06-11 14:18:51 +00:00
Sven Neumann
365f79262b removed unused variable.
2005-06-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcellrendererdashes.c: removed unused variable.
2005-06-06 09:40:07 +00:00
Sven Neumann
157fd5bbca if the area is larger than the brush, center the brush.
2005-06-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrendererbrush.c
	(gimp_view_renderer_brush_render_timeout): if the area is larger
	than the brush, center the brush.
2005-06-05 00:03:24 +00:00
Sven Neumann
e09ee5e501 app/widgets/gimpcoloreditor.c app/widgets/gimpcursorview.c
2005-06-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppaletteeditor.c: peek at the default interface to
	get the parent interface. Unconditionally chain up in get_aux_info()
	and set_aux_info() methods.
2005-06-04 22:49:53 +00:00
Sven Neumann
f173198669 app/widgets/gimpdocked.[ch] moved button-bar API to the GimpDocked
2005-06-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdocked.[ch]
	* app/widgets/gimpeditor.[ch]: moved button-bar API to the
	GimpDocked interface.

	* app/widgets/gimpcontainereditor.c: implement the new interface
	methods and proxy them to the embedded docked.

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.c: changed accordingly.
2005-06-04 22:32:31 +00:00
Sven Neumann
2832700c04 don't include gimpeditor.h.
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.h: don't include gimpeditor.h.

	* app/widgets/gimpbufferview.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpfontview.c
	* app/widgets/gimpimageview.c: include it here instead.
2005-06-04 21:20:31 +00:00
Sven Neumann
5412fac02b app/actions/dockable-actions.c app/actions/dockable-commands.[ch]
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]
	* app/widgets/gimpeditor.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/dockable-menu.xml.in: allow to show/hide the button-bar in
	GimpEditor. Should be merged into the GimpDocked interface.
2005-06-04 21:00:48 +00:00
Sven Neumann
1d59a0c818 validate the iter after appending to the text buffer.
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_text_buffer_load):
	validate the iter after appending to the text buffer.
2005-06-04 17:38:27 +00:00
Sven Neumann
8404a9e4e3 use the viewable's description in the drag icon. Use a larger preview.
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_get_viewable_icon): use the
	viewable's description in the drag icon. Use a larger preview.

	* app/widgets/gimpdockbook.c: tweak spacing and border-width of
	the tab widget if it is being used as drag icon.
2005-06-04 12:54:24 +00:00
Sven Neumann
be3a1dcc08 reduced the number of characters to show before ellipsizing the label.
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_get_viewable_icon): reduced the
	number of characters to show before ellipsizing the label.

	* libgimpwidgets/gimpcolorarea.c: added a "draw-border" property.

	* app/widgets/gimpcolorframe.c: draw a border around the color area.
2005-06-04 10:12:03 +00:00
Sven Neumann
b9186b8378 added property for "mode", fixed some implementation issues.
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.[ch]: added property for "mode",
	fixed some implementation issues.

	* app/widgets/gimpsamplepointeditor.c: create the color frames
	using g_object_new().
2005-06-04 00:56:00 +00:00
William Skaggs
48845d0a05 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpcolorframe.[ch]: add "has-color-area" property,
	FALSE by default.

	* app/widgets/gimpsamplepointeditor.c: explicitly add a color
	area to the color frames.
2005-06-03 23:57:02 +00:00
Sven Neumann
33131e6a82 show the viewable's name in the drag icon.
2005-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_get_viewable_icon): show the
	viewable's name in the drag icon.
2005-06-03 23:55:05 +00:00
Michael Natterer
5dd7b6443b bail out early if the view has no container (instead of crashing).
2005-06-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c
	(gimp_container_tree_view_drop_status): bail out early if the view
	has no container (instead of crashing).
2005-06-03 23:53:48 +00:00
Michael Natterer
39a8c9685a added API to show a number in front of the color area.
2005-06-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorframe.[ch]: added API to show a number in
	front of the color area.

	* app/widgets/gimpsamplepointeditor.c: use the new API to put the
	sample points' numbers there.
2005-06-03 22:34:28 +00:00
Michael Natterer
635795cc50 pack the color area and the labels into different vboxes to make the
2005-06-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_init): pack the
	color area and the labels into different vboxes to make the widget
	compact again.
2005-06-03 21:36:29 +00:00
William Skaggs
b2465d29f7 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpcolorframe.[ch]: add a color area, to make
	sample points dialog show a swatch of color for each point.
2005-06-01 20:10:39 +00:00
Sven Neumann
07d6c60432 added missing cast.
2005-05-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): added missing
	cast.
2005-05-31 14:51:13 +00:00
Michael Natterer
82d1b13b5c re-enabled tooltips on the "Open Recent" menu items, using an evil but
2005-05-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): re-enabled
	tooltips on the "Open Recent" menu items, using an evil but
	documented heuristic.
2005-05-31 13:56:46 +00:00
Sven Neumann
101c5a2dc9 pass GIMP_COLOR_AREA_CHECKS_SMALL instead of TRUE for the type of the
2005-05-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_get_color_icon): pass
	GIMP_COLOR_AREA_CHECKS_SMALL instead of TRUE for the type of the
	GimpColorArea.

	* app/widgets/gimpcoloreditor.c: added a "context" property.

	* libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color):
	always use gimp_rgba_distance(), regardless of the area's type.
2005-05-29 13:48:03 +00:00
Sven Neumann
3dcd00c127 Use the canonical form for signal names.
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names.
2005-05-28 00:21:58 +00:00
Sven Neumann
93eab43eef Use the canonical form for signal names.
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names.
2005-05-27 16:51:39 +00:00
Sven Neumann
3ca90a182e Use the canonical form for signal names in lots of places (but by far not
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names in lots
	of places (but by far not all).
2005-05-27 13:05:26 +00:00
Sven Neumann
9a5cd29c69 connect to "name-changed" of the active drawable and change the name
2005-05-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.[ch]: connect to "name-changed"
	of the active drawable and change the name displayed in the editor.
2005-05-27 11:48:50 +00:00
Sven Neumann
684591f81c added a name label (with properties to show/hide and to set it).
2005-05-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpeditor.[ch]: added a name label (with properties
	to show/hide and to set it).

	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimphistogrameditor.[ch]: removed the label here and
	use the functionality now provided by GimpEditor instead.

	* app/widgets/gimpcontainerpopup.c: changed accordingly.
2005-05-27 11:40:06 +00:00
Sven Neumann
e0b3fdfc3c fixed gtk-doc comments.
2005-05-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.[ch]: fixed gtk-doc comments.
2005-05-25 11:23:06 +00:00
Michael Natterer
7abaab62e0 added virtual function GimpViewable::get_size() and public API
2005-05-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpviewable.[ch]: added virtual function
	GimpViewable::get_size() and public API gimp_viewable_get_size()
	which return width and height and a boolean indicating if the
	viewable has a size at all.
	Added default implementation of GimpViewable::get_popup_size()
	using the new get_size() API.

	* app/core/gimpbrush.c
	* app/core/gimpbuffer.c
	* app/core/gimpdrawable.c
	* app/core/gimpimage.c
	* app/core/gimppattern.c: implement GimpViewable::get_size().

	* app/core/gimpbrush.c
	* app/core/gimppattern.c: removed GimpViewable::get_popup_size()
	implementations, the default one is good enough.

	* app/core/gimpbrushpipe.c (gimp_brush_pipe_get_popup_size):
	redirect to gimp_viewable_get_size() instead of duplicating its
	return values.

	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpview.c: allow pixbuf dragging out of any
	viewable that has a size.

	* app/widgets/gimpdrawabletreeview.c: removed pixbuf dragging code
	here.

	* app/widgets/gimpdnd.c: set gimp busy around encoding/decoding
	pixbufs into/from GtkSelectionData, because it can be a time
	consuming operation.
2005-05-25 10:05:17 +00:00
Michael Natterer
4bbeec9640 fixed type of the dropped layer.
2005-05-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox-dnd.c (gimp_toolbox_drop_pixbuf): fixed
	type of the dropped layer.
2005-05-25 09:54:05 +00:00
Sven Neumann
8f141bcb08 ellipsize the dockable title if it is too wide.
2005-05-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c: ellipsize the dockable title if it
	is too wide.

	* app/widgets/gimpstrokeeditor.c: added mnemonic for the presets
	combo.
2005-05-25 09:45:06 +00:00
Michael Natterer
6ada399543 oops... 2005-05-24 22:24:44 +00:00
Michael Natterer
a398aba3d2 implemented dropping of pixbufs. Bail out early from all callbacks if
2005-05-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox-dnd.c: implemented dropping of pixbufs.
	Bail out early from all callbacks if gimp->busy is TRUE.
2005-05-24 22:22:24 +00:00
Sven Neumann
ed19b5aabe we don't actually need to keep a pointer to the dashes array.
2005-05-23  Sven Neumann  <neumann@jpk.com>

	* app/widgets/gimpcellrendererdashes.[ch]: we don't actually need to
	keep a pointer to the dashes array.
	(gimp_cell_renderer_dashes_render): respect horizontal padding.

	* app/widgets/gimpstrokeeditor.c: added 2 pixels horizontal
	padding for the dashes cell-renderer.
2005-05-23 09:37:05 +00:00
Sven Neumann
7358758f68 minor cleanup.
2005-05-22  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.c: minor cleanup.

	* app/widgets/gimpcellrendererdashes.c: don't draw a background,
	draw the dash pattern twice, use the correct widget state.
2005-05-22 12:20:25 +00:00
Sven Neumann
a8318e18c5 added utility functions to copy and to free a dash pattern.
2005-05-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.[ch]: added utility functions to copy
	and to free a dash pattern.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendererdashes.[ch]: added a simple cell
	renderer to visualize a dash pattern.

	* app/widgets/gimpstrokeeditor.c: show previews of the dash
	presets in the combo-box.
2005-05-21 20:24:42 +00:00
Sven Neumann
5dd652faba improved reporting of errors while parsing the menu definitions.
2005-05-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpuimanager.c: improved reporting of errors
	while parsing the menu definitions.
2005-05-21 14:13:33 +00:00
Sven Neumann
282da81e53 moved the color picker button out of the row of notebook switching buttons
2005-05-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcoloreditor.c: moved the color picker button out
	of the row of notebook switching buttons next to the hex entry.
2005-05-20 10:54:44 +00:00
Sven Neumann
38f5546f5b removed the hex entry from the GimpColorScales widget.
2005-05-19  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcolorscales.c: removed the hex entry from the
	GimpColorScales widget.

	* libgimpwidgets/gimpcolorselection.c: added it here instead.

	* app/widgets/gimpcoloreditor.[ch]: and here, next to the FG/BG
	editor.
2005-05-19 17:08:03 +00:00
Sven Neumann
9b29707961 renamed property "miter" to "miter-limit" and added a description to be
2005-05-19  Sven Neumann  <sven@gimp.org>

	* app/core/gimpstrokeoptions.[ch]: renamed property "miter" to
	"miter-limit" and added a description to be used as a tooltip in
	the stroke editor.

	* app/core/gimpdrawable-stroke.c
	* app/widgets/gimpstrokeeditor.c: changed accordingly.
2005-05-19 15:17:30 +00:00
Sven Neumann
7902e11bee app/core/gimpstrokeoptions.[ch] app/widgets/gimpdasheditor.c small change
2005-05-19  Sven Neumann  <sven@gimp.org>

	* app/core/gimpstrokeoptions.[ch]
	* app/widgets/gimpdasheditor.c
	* app/widgets/gimpstrokeeditor.c: small change to the internal API
	to reduce code and conversion between GArray and GValueArray.
2005-05-19 11:08:50 +00:00
Sven Neumann
9bb255a3cf app/core/gimpdashpattern.[ch] moved more code out of GimpDashEditor to
2005-05-19  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.[ch]
	* app/widgets/gimpdasheditor.c: moved more code out of
	GimpDashEditor to gimpdashpattern.c. Fixed bug in last commit.
2005-05-19 00:40:48 +00:00
Sven Neumann
c7ba1dfc71 app/core/gimpdashpattern.[ch] moved code out of GimpDashEditor to
2005-05-19  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.[ch]
	* app/widgets/gimpdasheditor.c: moved code out of GimpDashEditor
	to gimpdashpattern.c.
2005-05-18 23:59:35 +00:00
Michael Natterer
cd53b60701 added gimp_clipboard_has_svg() and gimp_clipboard_get_svg().
2005-05-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.[ch]: added gimp_clipboard_has_svg()
	and gimp_clipboard_get_svg().

	* app/actions/edit-commands.c (edit_paste_cmd_callback): enabled
	pasting of SVG data using gimp_vectors_import_buffer().
2005-05-16 12:31:04 +00:00
Michael Natterer
8403515bd2 implement removing of controllers, confirmed by a dialog.
2005-05-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerlist.c
	(gimp_controller_list_remove_clicked): implement removing of
	controllers, confirmed by a dialog.

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_edit_clicked): set an alternative button
	order for the event mapping dialog.
2005-05-12 22:00:17 +00:00
Sven Neumann
35b50986ae refactoring.
2005-05-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c: refactoring.
2005-05-12 21:21:38 +00:00
Sven Neumann
35b4627cc2 request notification about changes to the "transient-docks" preference and
2005-05-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimagedock.c: request notification about changes
	to the "transient-docks" preference and drop the transient
	relationship if it is disabled.

plus some other changes / fixes to my previous commit
2005-05-11 23:12:36 +00:00
Sven Neumann
840e5f4601 app/config/gimpguiconfig.[ch] added new gimprc option "transient-docks".
2005-05-12  Sven Neumann  <sven@gimp.org>

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added new gimprc option
	"transient-docks".

	* app/widgets/gimpimagedock.c (gimp_image_dock_display_changed):
	as an experiment
	, obey the "transient-docks" preference and set
	the dock window transient to the active display shell. Please
	comment on the behaviour you observe.

	* app/dialogs/preferences-dialog.c (prefs_dialog_new): added a
	view on the new gimprc property.

	* app/config/gimpguiconfig.[ch]: set the IGNORE flag on the
	"info-window-per-display" property; it isn't used any longer.

	* app/config/gimpconfig-dump.c (dump_gimprc_system): don't dump
	properties that have the GIMP_CONFIG_PARAM_IGNORE flag set.
2005-05-11 22:18:47 +00:00
Michael Natterer
fb03c60e15 allow to pass a NULL group_name and iterate all action groups to find the
2005-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c (gimp_ui_manager_find_action): allow
	to pass a NULL group_name and iterate all action groups to find
	the action in that case.

	* app/widgets/gimpcontrollereditor.c: show the action's stock icon
	in the "Action" column, using above function.
2005-05-11 21:15:16 +00:00
Michael Natterer
1f1305c372 Some dock refactoring which separates the docking logic from active image
2005-05-11  Michael Natterer  <mitch@gimp.org>

	Some dock refactoring which separates the docking logic from
	active image and UI manager stuff:

	* app/widgets/gimpmenudock.[ch]: new widget renamed from
	GimpImageDock, zero changes except the name change.

	* app/widgets/gimpimagedock.[ch]: new widget derived from
	GimpDock. Keeps the UI manager.

	* app/widgets/gimpdock.[ch]: removed the UI manager. GimpDock only
	contains the basic docking logic again.

	* app/widgets/gimpmenudock.[ch]
	* app/widgets/gimptoolbox.[ch]: derive them from GimpImageDock.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/actions/dialogs-commands.c
	* app/actions/dock-actions.c
	* app/actions/dock-commands.c
	* app/actions/dockable-commands.c
	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-05-11 20:26:12 +00:00
Michael Natterer
a98adfd829 added API to set an event snooper which, if set, receives any controller
2005-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerinfo.[ch]: added API to set an event
	snooper which, if set, receives any controller event first, even
	if event dispatching is disabled for the controller.

	* app/widgets/gimpcontrollereditor.[ch]: use the new API to
	implement a "Grab Event" button, which takes the next event from
	the controller and selects it in the event mapping tree view.
2005-05-10 22:08:48 +00:00
Michael Natterer
66ce4f85de some more stuff: up/down buttons, remember the dialogs' size and
2005-05-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerlist.[ch]: some more stuff: up/down
	buttons, remember the dialogs' size and positions, misc stuff.

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_edit_clicked): use a GimpViewableDialog
	now that GimpControllerInfo is a GimpViewable.

	* app/dialogs/dialogs.c: added a foreign entry for the controller
	editor dialog. Allow the controller editors and its event mapping
	dialogs to exist multiple times.

	* app/dialogs/preferences-dialog.c (prefs_notebook_append_page):
	create the pages' event boxes with input-only windows.
2005-05-10 19:48:03 +00:00
Michael Natterer
92ad7c1d53 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-05-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerlist.[ch]: new widget which allows
	adding/removing controllers using two lists of available/active
	controllers. Work in progress...

	* app/widgets/gimpcontrollerinfo.[ch]: derive it from GimpVieable
	so it can have an icon (unfinished). Added convenience constructor
	gimp_controller_info_new().

	* app/dialogs/preferences-dialog.c: use a GimpControllerList
	instead of a notebook of GimpControllerEditors.
2005-05-09 09:35:41 +00:00
Sven Neumann
2a08c79b2b app/actions/layers-actions.c app/core/gimpimage.c
2005-05-06  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.c
	* app/core/gimpimage.c (gimp_image_position_layer)
	* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_drop_possible):
	drop the limitation that layers not at the bottom of the stack
	have to have an alpha channel. Allow the user to move the
	background layer up in the stack or reposition it using DND.

	* tips/gimp-tips.xml.in: changed the relevant tip and some more.
2005-05-06 20:45:21 +00:00
Michael Natterer
b4f942055a added enum for the "load_color" actions.
2005-05-06  Michael Natterer  <mitch@gimp.org>

	* app/actions/gradient-editor-commands.h: added enum for the
	"load_color" actions.

	* app/actions/gradient-editor-actions.c
	* app/actions/gradient-editor-commands.c: use the new enum instead
	of magic values, cleanup.

	* app/actions/palette-editor-commands.c: cleanup.

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpdataeditor.c: cleanup.

	* app/widgets/gimpgradienteditor.c: added GtkObject::destroy() and
	GtkWidget::unmap() implementations which destroy the color dialog.
	Destroy color dialogs by cancelling them via gtk_dialog_response(),
	so temporarily changed colors are restored correctly. Refactored
	my last commit below a bit. Various cleanups.

	* app/widgets/gimppaletteeditor.[ch]: no need to remember the
	buttons in the GimpPaletteEditor struct.
2005-05-06 15:07:34 +00:00
Michael Natterer
c15742da22 changed handle colors to be always black and white. Fixes bug #303118.
2005-05-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.c (control_draw)
	(control_draw_normal_handle)
	(control_draw_middle_handle): changed handle colors to be always
	black and white. Fixes bug #303118. Also changed the handle bar's
	background and the handles' outlines to theme colors which should
	make the handles distinguishable from the background for all
	themes.

	Various unrelated cleanups.
2005-05-05 13:59:32 +00:00
Sven Neumann
33a06ab5d8 emit "color-clicked" on first click.
2005-05-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfgbgeditor.c (gimp_fg_bg_editor_button_press):
	emit "color-clicked" on first click.

	* app/widgets/gimptoolbox.c: changed tooltip accordingly.
2005-05-04 00:09:09 +00:00
Michael Natterer
3184148c02 include the parent class, not gimpeditor.h
2005-05-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolordisplayeditor.h: include the parent class,
	not gimpeditor.h

	* app/widgets/gimpcolordisplayeditor.c: include gimpeditor.h here
2005-05-03 21:38:07 +00:00
Sven Neumann
2eba891d93 unset "can-focus" on the message labels. Fixes bug #302400.
2005-04-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c (gimp_message_box_init): unset
	"can-focus" on the message labels. Fixes bug #302400.
2005-04-29 13:59:57 +00:00
Sven Neumann
55be97a021 free all memory allocated for GimpClipboard.
2005-04-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c (gimp_clipboard_free): free all
	memory allocated for GimpClipboard.

	* libgimpwidgets/gimppatheditor.c (gimp_path_editor_set_path):
	always free old_path.
2005-04-27 15:59:14 +00:00
Sven Neumann
5978e395a3 don't call va_arg() too often.
2005-04-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpunitstore.c: don't call va_arg() too often.

	* libgimpconfig/gimpcolorconfig.c (gimp_color_config_finalize):
	free the string allocated for the display module.
2005-04-27 15:13:59 +00:00
Hans Breuer
28a2b13581 build menus with nmake, too menus/Makefile.am : added to EXTRA_DIST
2005-04-24  Hans Breuer  <hans@breuer.org>

	* menus/makefile.msc : build menus with nmake, too
	  menus/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc app/gimpcore.def : updated

	* app/base/tmp-buf.c : there is no pid_t with msvc so typedef one
2005-04-24 15:39:15 +00:00
Sven Neumann
e37143c28b removed Close button from dockables as suggested in bug #301348.
2005-04-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.[ch]: removed Close button from
	dockables as suggested in bug #301348.
2005-04-21 23:30:38 +00:00
Michael Natterer
88378adfde Connect to the GimpImage::update-sample-point and GimpProjection::update
2005-04-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsamplepointeditor.[ch]: Connect to the
	GimpImage::update-sample-point and GimpProjection::update signals
	and idle-pick colors at the sample points' coordinates.
	Addresses bug #137776.
2005-04-18 13:54:24 +00:00
Sven Neumann
1967e63d6a app/widgets/gimpaction.h app/widgets/gimpactiongroup.h
2005-04-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.h
	* app/widgets/gimpactiongroup.h
	* app/widgets/gimpcellrendereraccel.h
	* app/widgets/gimpenumaction.h
	* app/widgets/gimppluginaction.h
	* app/widgets/gimpstringaction.h
	* app/widgets/gimpuimanager.h: declare get_type() function as
	G_GNUC_CONST.
2005-04-16 23:48:29 +00:00
Michael Natterer
4e92a6cf32 no need to get base_config twice in the same function.
2005-04-16  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.c (gimp_context_real_set_brush)
	(gimp_context_real_set_pattern): no need to get base_config twice
	in the same function.

	* app/widgets/gimpblobeditor.h: include the parent class.

	* app/widgets/gimpdataeditor.c (gimp_data_editor_init): set the
	name entry insensitive.
2005-04-16 21:53:12 +00:00
Michael Natterer
b8e8822c7d implement GimpDocked::get_title() and add "(read only)" to the dialog's
2005-04-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.[ch]: implement
	GimpDocked::get_title() and add "(read only)" to the dialog's
	title if the data is not editable. Fixes bug #164003.

	(gimp_data_editor_real_set_data): call gimp_docked_title_changed()
	when the editable state changes.

	(struct GimpDataEditorClass): added "const gchar *title" member.

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimppaletteeditor.c (class_init): set titles.
2005-04-16 20:48:33 +00:00
William Skaggs
5a9dbb44e2 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/dialogs/image-new-dialog.c
	* app/dialogs/image-scale-dialog.c
	* app/widgets/gtkhwrapbox.c
	* app/widgets/gtkvwrapbox.c: s/choosen/chosen/g; fixes bug #300608.
2005-04-14 16:19:30 +00:00
Michael Natterer
bf1b9651f8 don't use the image container as display container.
2005-04-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpimagedock.c (gimp_image_dock_image_changed):
	don't use the image container as display container.
2005-04-12 23:31:47 +00:00
Sven Neumann
0c91d7d672 n2005-04-12 Sven Neumann <sven@gimp.org>
* app/core/gimpcontainer.[ch]: added gimp_container_is_empty().

	* app/core/gimpcontext.c
	* app/core/gimpimage.c
	* app/dialogs/palette-import-dialog.c
	* app/text/gimptextlayer.c
	* app/widgets/gimpimagedock.c: use the new function.
2005-04-12 21:36:54 +00:00
Michael Natterer
1fe869bbfd don't include "core/gimpviewable.h"
2005-04-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.c: don't include "core/gimpviewable.h"
2005-04-11 16:01:25 +00:00
Michael Natterer
09ef4b1d00 app/file/file-utils.c app/tools/gimpfliptool.c
2005-04-10  Michael Natterer  <mitch@gimp.org>

	* app/file/file-utils.c
	* app/tools/gimpfliptool.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimppaletteselect.c: removed unneeded base/ includes.
2005-04-09 22:47:51 +00:00
Michael Natterer
9d439fe018 added gimp_buffer_new_from_pixbuf().
2005-04-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpbuffer.[ch]: added gimp_buffer_new_from_pixbuf().

	* app/widgets/gimpclipboard.c: removed
	tile_manager_new_from_pixbuf() and base/ dependency.
2005-04-09 21:52:21 +00:00
Manish Singh
b31216d037 #include <string.h> for strcmp, and fix gdk_atom_intern usage.
005-04-09  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimppixbuf.c: #include <string.h> for strcmp, and
        fix gdk_atom_intern usage.
2005-04-09 19:52:36 +00:00
Michael Natterer
7609645970 Implement dragging and dropping in any GdkPixbuf supported format. Fixes
2005-04-09  Michael Natterer  <mitch@gimp.org>

	Implement dragging and dropping in any GdkPixbuf supported
	format. Fixes bug #172794 and bug #172795.

	* app/core/gimplayer.[ch] (gimp_layer_new_from_region): new
	function which contains all stuff that was in
	gimp_layer_new_from_tiles().

	(gimp_layer_new_from_tiles): use above function.
	(gimp_layer_new_from_pixbuf): new function.

	* app/widgets/Makefile.am
	* app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf
	utility functions for clipboard and DnD.

	* app/widgets/gimpselectiondata.[ch]: removed
	gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API.
	Also removed GdkAtom parameters all over the place because it's
	always the same as selection_data->target.

	* app/widgets/gimpclipboard.c: use the new pixbuf utility
	functions and gtk_selection_data_set,get_pixbuf().

	* app/widgets/widgets-enums.h
	* app/widgets/gimpdnd.[ch]: removed never-implemented
	GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF
	instead. Added API to drag and drop GdkPixbufs which transparently
	converts from/to and GdkPixbuf-supported image format. Removed
	passing around of GdkAtoms, since they were always the same
	as selection_data->target.

	* app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal.

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_pixbuf().

	* app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf().

	* app/widgets/gimplayertreeview.c: implement drop_pixbuf().

	* app/widgets/gimpdrawabletreeview.c: allow to drag all drawables
	as pixbufs.

	* app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
Sven Neumann
50dbf2a848 same optimisation in gimp_color_frame_set_invalid() 2005-04-07 11:34:26 +00:00
Sven Neumann
aeff2f27f7 only update the view if there's actually a change.
2005-04-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_set_color): only
	update the view if there's actually a change.
2005-04-07 11:15:13 +00:00
Sven Neumann
ec1b12e14e app/actions/plug-in-actions.c (plug_in_actions_add_branch)
2005-04-07  Sven Neumann  <sven@gimp.org>

	* app/actions/plug-in-actions.c (plug_in_actions_add_branch)
	* app/core/gimpinterpreterdb.c (resolve_extension)
	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): plugged
	memleaks.
2005-04-07 00:04:10 +00:00
Sven Neumann
d0c80e7629 plugged a small memleak.
2005-04-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: plugged a small memleak.

	* libgimpwidgets/gimpcontroller.c: added a finalizer and free the
	allocated strings.
2005-04-06 23:19:04 +00:00
Sven Neumann
83acacc28f s/Colorspace/Color space/
2005-04-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: s/Colorspace/Color space/
2005-04-05 09:12:29 +00:00
Michael Natterer
dba31b149c More unfinished replacement for the info window:
2005-04-05  Michael Natterer  <mitch@gimp.org>

	More unfinished replacement for the info window:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagepropview.[ch]: new widget showing an image's
	size, resolution, mode, memsize etc.

	* app/dialogs/Makefile.am
	* app/dialogs/image-properties-dialog.[ch]: a dialog keeping the
	widget.

	* app/widgets/gimphelp-ids.h: a help ID for the dialog.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* menus/image-menu.xml.in: action and menu entry for the dialog.
2005-04-04 22:34:29 +00:00
Tor Lillqvist
61ca231ce2 On Win32, move the "bmp" format to the front. Means less conversion in
2005-04-04  Tor Lillqvist  <tml@novell.com>

	* app/widgets/gimpclipboard.c (gimp_clipboard_format_compare): On
	Win32, move the "bmp" format to the front. Means less conversion
	in most cases, as other apps on Win32 typically provide/want the
	BMP format on the Clipboard. (Actually CF_DIB, but that's the
	same, just without the BMP file header.) See also bug #168173.
2005-04-04 00:33:35 +00:00
Michael Natterer
ff1e1ba290 fixed spacings and update them in GtkWidget::style_set(). Removed lots of
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcursorview.[ch]: fixed spacings and update them
	in GtkWidget::style_set(). Removed lots of cruft from the widget
	this files were copied from, including the GimpContext param
	to gimp_cursor_view_new(). Remember the state of the two color
	frames as aux-info in sessionrc.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-04-03 17:15:45 +00:00
Michael Natterer
327f1a007a switch from a table to a vbox containing hboxes, so the widget's width is
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_init): switch
	from a table to a vbox containing hboxes, so the widget's width is
	not determined by the longest label *plus* the longest value.
2005-04-03 16:18:00 +00:00
Michael Natterer
0231374c86 added new signals "sample-point-added" and "sample-point-removed" and
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added new signals "sample-point-added"
	and "sample-point-removed" and public functions to emit them.

	* app/core/gimpimage-sample-points.c (gimp_image_add_sample_point)
	(gimp_image_remove_sample_point): emit them accordingly.

	* app/core/gimpimage-undo-push.c (undo_pop_image_sample_point):
	ditto.

	(undo_pop_image_guide)
	(undo_pop_image_sample_point): added comments why we add/remove
	stuff manually instead of using the GimpImage APIs.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcursorview.[ch]
	* app/widgets/gimpsamplepointeditor.[ch]: new widgets.
	GimpCursorView is a replacement for the info window's "Cursor"
	page, GimpSamplePointEditor is a view on an image's sample points.
	The sample point editor does nothing yet except keeping a 2x2 grid
	of GimpColorFrames. Addresses bug #137776.

	* app/dialogs/dialogs.c
	* app/dialogs/dialogs-constructors.[ch]: register the new widgets
	as dockable dialogs.

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* menus/dialogs-menuitems.xml: added actions and menu items for
	the new dialogs.

	* app/display/gimpdisplayshell-cursor.c
	(gimp_display_shell_update_cursor)
	(gimp_display_shell_clear_cursor): update the new cursor view.

	* app/widgets/gimphelp-ids.h: help IDs for the new dialogs.

	* app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode):
	changed description "Pixel values" to "Pixel" because the former
	was too long.
2005-04-03 15:48:03 +00:00
Sven Neumann
3ba107f1f9 app/widgets/Makefile.am app/widgets/gimpfgbgview.[ch] added new widget
2005-03-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpfgbgview.[ch]
	* app/widgets/widgets-types.h: added new widget GimpFgBgView;
	somewhat similar to GimpFgBgEditor but a lot simpler.

	* app/widgets/gimpcoloreditor.c: use GimpFgBgView as preview widget.
	Closes bug #168592.

	* app/widgets/gimpfgbgeditor.c: gracefully handle a very small
	size allocation.
2005-03-31 13:39:18 +00:00
Sven Neumann
cf56c79553 allow to store the clipboard content in a clipboard manager when GIMP
2005-03-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c: allow to store the clipboard content
	in a clipboard manager when GIMP exits.
2005-03-29 22:05:50 +00:00
Sven Neumann
1ce630e929 don't add the same target multiple times. This used to happen when
2005-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd.c: don't add the same target multiple times.
	This used to happen when  gimp_dnd_foo_source_add() is called
	after calling gimp_dnd_drag_source_set_by_type().
2005-03-26 16:39:51 +00:00
Sven Neumann
deb8eaeac9 added a hint about XDS to the tooltip, but only if compiled for X11.
2005-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolbox-image-area.c: added a hint about XDS to
	the tooltip, but only if compiled for X11.
2005-03-26 13:43:19 +00:00
Sven Neumann
21942731de initialize the tab style to a supported one. Fixes bug #171562.
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_add): initialize the
	tab style to a supported one. Fixes bug #171562.
2005-03-25 21:58:48 +00:00
Sven Neumann
f6cb341c3c app/dialogs/file-save-dialog.c moved overwrite confirmation dialog to
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/dialogs/file-save-dialog.c
	* app/widgets/gimpfiledialog.[ch]: moved overwrite confirmation
	dialog to app/widgets.

	* app/widgets/gimpdnd-xds.c: set "Untitled.xcf" as default name
	for untitled images; ask for confirmation before overwriting a
	local file.
2005-03-25 20:18:55 +00:00
Sven Neumann
5e32e298d2 added VOID: OBJECT, OBJECT.
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/core/gimpmarshal.list: added VOID: OBJECT, OBJECT.

	* app/widgets/gimpview.[ch]: pass old and new viewable in the
	"set-viewable" signal.

	* app/widgets/gimptoolbox-image-area.c: don't add the XDS drag source
	more than once.
2005-03-25 18:58:04 +00:00
Sven Neumann
8eefacf568 let drag_end take care of unsetting the property 2005-03-25 18:28:50 +00:00
Sven Neumann
b948397482 in case of an error, answer with E (error) instead of F (failure).
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdnd-xds.c (gimp_dnd_xds_save_image): in case of
	an error, answer with E (error) instead of F (failure).
2005-03-25 18:09:50 +00:00
Sven Neumann
c52643ed0f added myself as author 2005-03-25 17:41:20 +00:00
Sven Neumann
2a466d29b5 removed unused function prototype.
* app/widgets/gimpimageview.c: removed unused function prototype.
2005-03-25 17:18:46 +00:00
Sven Neumann
7684721c15 virtualized GimpView::set_viewable.
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpview.[ch]: virtualized GimpView::set_viewable.

	* app/widgets/gimptoolbox-image-area.c: hook into "set_viewable"
	and add an XDS drag source.

	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpdnd.c: unset the XdndDirectSave0 property when
	the drag ends, minor cleanups.
2005-03-25 17:16:07 +00:00
Sven Neumann
0bc3233be7 app/widgets/Makefile.am new files.
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpdnd-xds.[ch]: new files.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/widgets-enums.h: added a basic XDS (Direct Save
	Protocol) implementation.

	* app/widgets/gimpimageview.c: allow to save images by dragging
	them from the Images dialog to an XDS capable file manager.
2005-03-25 14:23:35 +00:00
Sven Neumann
13bd5eabe5 use a GimpColorHexEntry widget.
2005-03-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolormapeditor.c: use a GimpColorHexEntry widget.
2005-03-24 15:29:48 +00:00
Sven Neumann
45fd7984bb Merged from gimp-2-2 branch:
2005-03-24  Sven Neumann  <sven@gimp.org>

	Merged from gimp-2-2 branch:

	* app/widgets/gimphistogrameditor.c: change to the Value channel
	if the current channel becomes invalid due to an image mode change.
	Fixes bug #170116.
2005-03-24 13:09:10 +00:00
Sven Neumann
e6b63117cf app/widgets/gimpmessagebox.h added G_GNUC_PRINTF attributes.
2005-03-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.h
	* libgimpconfig/gimpconfigwriter.h: added G_GNUC_PRINTF attributes.
2005-03-23 23:36:17 +00:00
Michael Natterer
e243c26985 same fix as below for ID-based DND types.
2005-03-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.c (gimp_selection_data_get_image)
	(gimp_selection_data_get_component)
	(gimp_selection_data_get_item): same fix as below for ID-based DND
	types.
2005-03-23 12:29:56 +00:00
Sven Neumann
ec7fb058c6 added a g_warning() if UTF-8 validation fails 2005-03-23 11:30:52 +00:00
Sven Neumann
2bea01cab8 libgimp/gimpbrushmenu.c libgimp/gimpfontmenu.c libgimp/gimpgradientmenu.c
2005-03-23  Sven Neumann  <sven@gimp.org>

	* libgimp/gimpbrushmenu.c
	* libgimp/gimpfontmenu.c
	* libgimp/gimpgradientmenu.c
	* libgimp/gimppalettemenu.c
	* libgimp/gimppatternmenu.c: accept names passed over DND no matter
	whether they are NULL-terminated or not.

	* app/widgets/gimpselectiondata.c: same change here, also
	UTF8-validate the selection data before accepting it.
2005-03-23 11:26:56 +00:00
Sven Neumann
749915136a app/widgets/gimpactiongroup.c use gtk_action_set_sensitive() and
2005-03-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactiongroup.c
	* app/widgets/gimpcolorpanel.c: use gtk_action_set_sensitive()
	and gtk_action_set_visible() instead of setting the respective
	properties.
2005-03-22 18:51:57 +00:00
Sven Neumann
2bb4d73e13 disable search for tree views so that treeview typeahead doesn't collide
2005-03-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_constructor): disable search for tree
	views so that treeview typeahead doesn't collide with global
	accelerators. Fixes bug #169339 and would suck less if bug #170435
	got fixed.
2005-03-21 19:20:11 +00:00
Sven Neumann
b8cf0e436f make "preview-size" and "preview-border-width" construct properties. Fixes
2005-03-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c: make "preview-size" and
	"preview-border-width" construct properties. Fixes creation
	using g_object_new().

	* app/widgets/gimpcontainerentry.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimplayertreeview.c (set_preview_size): handle
	unset model and/or view gracefully.

	* app/dialogs/image-new-dialog.c: unset "focus-on-click" on the
	template combo-box.
2005-03-18 00:31:29 +00:00
Sven Neumann
73bfd57273 app/widgets/gimpcontainerview.c app/widgets/gimpimagedock.c
2005-03-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpimagedock.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gtkwrapbox.c
	* libgimpwidgets/gimpcellrenderercolor.c
	* libgimpwidgets/gimpcellrenderertoggle.c
	* libgimpwidgets/gimpframe.c: use canonical names when registering
	param specs.
2005-03-09 17:02:35 +00:00
Sven Neumann
3285ee6ef5 renamed again, to gimp_palette_[gs]et_columns this time.
2005-03-09  Sven Neumann  <sven@gimp.org>

	* app/core/gimppalette.[ch]: renamed again, to
	gimp_palette_[gs]et_columns this time.

	* app/dialogs/palette-import-dialog.c
	* app/widgets/gimppaletteeditor.c: changed accordingly.

	* tools/pdbgen/pdb/palette.pdb: renamed newly added PDB function.
	Also added a getter for the columns.

	* app/pdb/internal_procs.c
	* app/pdb/palette_cmds.c
	* libgimp/gimppalette_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-03-09 00:50:09 +00:00
William Skaggs
37e5bdd2e6 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpviewrenderergradient.c: revert previous
	change.  Didn't read the code carefully enough.
2005-03-08 18:28:09 +00:00
William Skaggs
0f8c9df9db Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpviewrenderergradient.c:
	(gimp_view_renderer_gradient_render): Make sure specified
	point lies within specified gradient segment; should
	fix bug #167604.
2005-03-08 18:14:58 +00:00
Sven Neumann
243cdf5306 renamed gimp_palette_[gs]et_n_columns to
2005-03-08  Sven Neumann  <sven@gimp.org>

	* app/core/gimppalette.[ch]: renamed gimp_palette_[gs]et_n_columns
	to gimp_palette_[gs]et_num_columns().

	* app/dialogs/palette-import-dialog.c
	* app/widgets/gimppaletteeditor.c: changed accordingly.

	* tools/pdbgen/pdb/palette.pdb: added new PDB function to control
	the number of columns used when displaying a palette (bug #169370).

	* app/pdb/internal_procs.c
	* app/pdb/palette_cmds.c
	* libgimp/gimppalette_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-03-08 14:44:29 +00:00
Michael Natterer
be6a9d2a8b app/actions/view-actions.c app/actions/view-commands.[ch]
2005-03-05  Michael Natterer  <mitch@gimp.org>

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* app/config/gimprc-blurbs.h
	* app/core/core-enums.[ch]
	* app/core/gimp.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-undo-push.[ch]
	* app/core/gimpimage.c
	* app/display/gimpdisplayoptions.[ch]
	* app/display/gimpdisplayshell-appearance.[ch]
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-draw.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: reordered stuff to be in guides, grid,
	sample points order. Some cleanup and indentation.
2005-03-05 00:10:40 +00:00
Sven Neumann
cc4e204b83 eeek, that g_open() call had the correct number of arguments _before_
I "fixed" it...
2005-03-04 21:02:10 +00:00
Sven Neumann
74002a72e1 app/dialogs/user-install-dialog.c app/file/gimprecentlist.c
2005-03-04  Sven Neumann  <sven@gimp.org>

	* app/dialogs/user-install-dialog.c
	* app/file/gimprecentlist.c
	* app/widgets/gimpwidgets-utils.c
	* modules/controller_linux_input.c
	* modules/controller_midi.c
	* plug-ins/common/compressor.c
	* plug-ins/common/mail.c
	* plug-ins/common/psp.c
	* plug-ins/common/raw.c
	* plug-ins/helpbrowser/dialog.c
	* plug-ins/imagemap/imap_cern.y
	* plug-ins/imagemap/imap_cern_parse.[ch]
	* plug-ins/imagemap/imap_csim.y
	* plug-ins/imagemap/imap_csim_parse.[ch]
	* plug-ins/imagemap/imap_main.c
	* plug-ins/imagemap/imap_ncsa.y
	* plug-ins/imagemap/imap_ncsa_parse.[ch]
	* plug-ins/uri/uri.c
	* plug-ins/xjt/xjt.c: ported the remaining functions to gstdio.
2005-03-04 19:13:21 +00:00
William Skaggs
ea267753f6 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpimage-sample-points.c
	* app/core/gimpimage-sample-points.h: new files

	* app/actions/view-actions.c
	* app/actions/view-commands.c
	* app/actions/view-commands.h
	* app/config/gimprc-blurbs.h
	* app/core/Makefile.am
	* app/core/core-enums.c
	* app/core/core-enums.h
	* app/core/core-types.h
	* app/core/gimp.c
	* app/core/gimp.h
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpimage-undo-push.h
	* app/core/gimpimage.c
	* app/core/gimpimage.h
	* app/display/gimpdisplayoptions.c
	* app/display/gimpdisplayoptions.h
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-appearance.h
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-draw.h
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell.h
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: add support for a list of "sample
	points" in each image, coded and handled very similarly to
	guides, for use mainly in color correction.  See bug #137776.
2005-03-04 16:34:59 +00:00
William Skaggs
d8457740b3 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* gimp/app/widgets/gimpgradienteditor.c: allow dnd of colors
	into preview and control areas, as described in
	bug #119470.
2005-03-02 16:18:47 +00:00
Sven Neumann
49005d9bfd removed gimp_enum_combo_box_set_visible().
2005-03-01  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpenumcombobox.[ch]: removed
	gimp_enum_combo_box_set_visible().

	* libgimpwidgets/gimpintcombobox.[ch]: added
	gimp_int_combo_box_set_sensitivity() instead.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimphistogrameditor.c: changed accordingly.

	* libgimpwidgets/gimpenumstore.h: added padding for future expansion.

	* libgimpwidgets/gimpwidgets.def: updated.
2005-02-28 23:27:12 +00:00
Sven Neumann
c0c6d837c0 avoid compiler warning 2005-02-28 21:33:02 +00:00
Sven Neumann
7684b18117 use g_get_language_names().
2005-02-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help_get_locales): use
	g_get_language_names().

	* plug-ins/help/locales.c (locales_parse): simplified;
	g_get_language_names() already takes care of this.
2005-02-28 21:23:53 +00:00
Sven Neumann
8de1e94bb7 removed the "last_visited" field from GimpGradient. Instead added the new
2005-02-27  Sven Neumann  <sven@gimp.org>

	* app/core/gimpgradient.[ch]: removed the "last_visited" field
	from GimpGradient. Instead added the new function
	gimp_gradient_get_color_at_segment() that allows the caller to do
	the same optimization.

	* app/actions/gradient-editor-commands.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimppalette-import.c
	* app/paint/gimppaintoptions.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimpviewrenderergradient.c: changed accordingly.

	* app/pdb/gradient_cmds.c
	* app/pdb/gradients_cmds.c: regenerated.
2005-02-26 23:55:50 +00:00
Michael Natterer
b83dff24d5 apply evil size_request hacks to the color/image/foo areas' wrapbox
2005-02-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (toolbox_area_notify): apply evil
	size_request hacks to the color/image/foo areas' wrapbox because
	its child requisition/allocation code is apparently broken. Works
	around bug #162500.
2005-02-21 18:21:50 +00:00
Manish Singh
9706fce0a3 Support for custom plug-in interpreters, independent of OS support.
2005-02-20  Manish Singh  <yosh@gimp.org>

        Support for custom plug-in interpreters, independent of OS support.

        * app/core/Makefile.am
        * app/core/core-types.h
        * app/core/gimpinterpreterdb.[ch]: implemented GimpInterpreterDB,
        which handles registering and resolving custom plug-in interpreters.

        * app/core/gimp.[ch]: keep a GimpInterpreterDB around.

        * app/config/gimpcoreconfig.[ch]
        * app/config/gimprc-blurbs.h
        * app/dialogs/preferences-dialog.c
        * app/dialogs/user-install-dialog.c
        * app/widgets/gimphelp-ids.h: interpreter-path config stuff.

        * app/plug-in/plug-in.c: use registered interpreters when running
        plug-ins.

        * themes/Default/images/preferences/Makefile.am
        * themes/Default/images/preferences/folders-interp.png: just copied
        folders-plug-ins.png here, need a better one.

        * data/interpreters/Makefile.am: creates system interpreter directory.

        * data/interpreters/default.interp: sample interpreter file info.

        * data/Makefile.am
        * configure.in: add data/interpreters directory.

        * plug-ins/pygimp/Makefile.am: install pygimp.interp, which configures
        the python interpreter to point to the python we were built with. Also
        register the .py extension.

        * etc/gimprc
        * docs/gimprc.5.in: regenerated
2005-02-21 02:56:29 +00:00
Sven Neumann
35d7fdfa5a app/widgets/gimpdockable.c added a tooltip and a help-id for the dockable
2005-02-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c
	* app/widgets/gimphelp-ids.h: added a tooltip and a help-id for the
	dockable menu.
2005-02-19 02:13:33 +00:00
Hans Breuer
c6f63ea4e1 TILE_WIDTH is used unconditionally so always include "tile.h" WIN32 needs
2005-02-19  Hans Breuer  <hans@breuer.org>

	* app/base/pixel-processor.c : TILE_WIDTH is used unconditionally
	so always include "tile.h"
	* app/base/tile-swap.c : WIN32 needs <process.h> for _getpid()

	* app/dialogs/user-install-dialog.c : include gimpwin32-io.h
	* libgimpbase/gimpwin32-io.h : there are no group or other
	flags in msvcrt, define S_IGRP etc in terms of _S_IREAD etc

	* plug-ins/script-fu/script-fu.c plug-ins/script-fu/siod-wrapper.c :
	no script-fu server on win32, make respective function calls conditional

	* libgimpconfig/makefile.msc : new file
	* **/makefile.msc app/gimpcore.def : updated, gimp builds
	and runs once more with ms toolchain
2005-02-19 00:50:36 +00:00
Sven Neumann
0b2fc841f6 don't attempt to read beyond the pre-calculated render buffers, even if
2005-02-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderergradient.c
	(gimp_view_renderer_gradient_render): don't attempt to read beyond
	the pre-calculated render buffers, even if the gradient somehow
	has out-of-bounds values. Fixes the crash reported in bug #167604.
2005-02-17 22:01:30 +00:00
Sven Neumann
d0e6a44640 app/widgets/gimpcontainercombobox.c set the "ellipsize" property on the
2005-02-17  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainercombobox.c
	* libgimpwidgets/gimpintcombobox.c: set the "ellipsize" property
	on the text cell-renderer. Not sure if it's a good idea to
	hardcode this for GimpIntComboBox, but let's give it a try. Fixes
	bug #136676.
2005-02-16 23:55:53 +00:00
Sven Neumann
02bc3c98c1 fixed gtk-doc comment.
2005-02-14  Sven Neumann  <neumann@jpk.com>

	* app/widgets/gimppropwidgets.c: fixed gtk-doc comment.
2005-02-14 13:26:32 +00:00
Sven Neumann
1cb9714f02 allocate temporary histogram slots on demand and provide an array with
2005-02-14  Sven Neumann  <sven@gimp.org>

	* app/base/gimphistogram.[ch]: allocate temporary histogram slots
	on demand and provide an array with enough slots for the maximum
	number of threads. gimp_histogram_new() doesn't need a
	GimpBaseConfig parameter any longer.

	* app/core/gimpdrawable-equalize.c
	* app/core/gimpdrawable-levels.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimphistogrameditor.c
	* tools/pdbgen/pdb/color.pdb: changed accordingly.

	* app/pdb/color_cmds.c: regenerated.
2005-02-14 01:05:34 +00:00
Sven Neumann
9511753a02 check for gthread-2.0 unless the --disable-mp option is given.
2005-02-13  Sven Neumann  <sven@gimp.org>

	* configure.in: check for gthread-2.0 unless the --disable-mp
	option is given.

	* app/app_procs.c (app_libs_init): call g_thread_init().

	* app/base/pixel-processor.c: ported to GThread.

	* app/Makefile.am
	* app/*/Makefile.am: use @GTHREAD_CFLAGS@.
2005-02-13 15:08:08 +00:00
Sven Neumann
7c19953c39 added GimpProgress::pulse.
2005-02-12  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added GimpProgress::pulse.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it in the classes that
	implement the GimpProgress interface.

	* app/plug-in/plug-in-progress.[ch]: allow plug-ins to pulse their
	progress.

	* tools/pdbgen/pdb/progress.pdb: added a procedure for the new
	functionality.

	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-02-12 14:18:12 +00:00
Sven Neumann
68ed0fc12c drop everything after the first newline and strip leading and trailing
2005-02-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolbox.c (toolbox_paste_received): drop
	everything after the first newline and strip leading and trailing
	whitespace from the pasted text.
2005-02-11 11:14:10 +00:00
Sven Neumann
eb8742cd62 allow to paste URLs and filenames to the toolbox using the middle mouse
2005-02-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptoolbox.c: allow to paste URLs and filenames to
	the toolbox using the middle mouse button.
2005-02-11 01:23:41 +00:00
Michael Natterer
10583dfe47 app/core/gimpimagefile.c enable explicit (not automatic while browsing the
2005-02-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimagefile.c
	* app/widgets/gimpthumbbox.c: enable explicit (not automatic while
	browsing the list of files) thumbnailing of remote files
2005-02-09 00:47:09 +00:00
Michael Natterer
3d69ff1108 app/actions/file-actions.c app/actions/image-actions.c
2005-02-08  Michael Natterer  <mitch@gimp.org>

	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/qmask-actions.c
	* app/actions/tools-actions.c: removed ugly accel_path hacks
	(don't g_object_set_data(action, "gimp-accel-path", "foo")).

	* app/widgets/gimpactionview.c (gimp_action_view_accel_edited):
	simply use gtk_action_get_accel_path() instead of doing even more
	ugly stuff than above.
2005-02-08 21:35:49 +00:00
Michael Natterer
cb7f1dbe56 removed gimp_ui_manager_ui_get() and implement the new virtual functions
2005-02-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: removed gimp_ui_manager_ui_get()
	and implement the new virtual functions GtkUIManager::get_widget()
	and ::get_action() instead. Menu loading happens transparently now.

	* app/display/gimpdisplayshell.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: use
	gtk_ui_manager_get_widget() instead of the removed
	gimp_ui_manager_ui_get().
2005-02-08 20:55:00 +00:00
Sven Neumann
3047b96adb use "single-line-mode" for the hint labels. Should fix bug #157570.
2005-02-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.c (gimp_gradient_editor_init):
	use "single-line-mode" for the hint labels. Should fix bug #157570.
2005-02-08 20:08:13 +00:00
Michael Natterer
86b62f7e1c undeprecated the paint mode menu (ported to GimpEnumComboBox with
2005-02-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-constructors.[ch]: undeprecated the
	paint mode menu (ported to GimpEnumComboBox with separators).
	The separator code is quite hackish and therefore still
	implemented privately here.

	* app/widgets/gimpbrushselect.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2005-02-08 20:07:08 +00:00
Sven Neumann
4fc86a043c gimp-mkenums doesn't seem to like newlines in enum definitions.
2005-02-08  Sven Neumann  <sven@gimp.org>

	* libgimpconfig/gimpcolorconfig-enums.[ch]: gimp-mkenums doesn't
	seem to like newlines in enum definitions.

	* libgimpconfig/gimpcolorconfig.[ch]: removed the "profile-path"
	property for now. It doesn't work too well with GimpFileEntry.
	We can add it back later if it turns out that we really need it.

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimphelp-ids.h: added a color management page to the
	preferences dialog.
2005-02-08 00:04:50 +00:00
Sven Neumann
d4535cc31f add an "All Images" filter and select it by default.
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): add
	an "All Images" filter and select it by default.
2005-02-07 18:46:03 +00:00
Sven Neumann
416033b623 app/widgets/gimpselectiondata.c plug-ins/help/domain.c fixed my latest
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.c
	* plug-ins/help/domain.c
	* plug-ins/helpbrowser/dialog.c: fixed my latest changes.
2005-02-07 18:30:13 +00:00
Sven Neumann
2f98bfd191 app/dialogs/file-open-dialog.c app/dialogs/file-save-dialog.c use
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/widgets/gimpthumbbox.c: use file_utils_filename_from_uri()
	in some more places.

	* app/dialogs/file-open-location-dialog.c
	* app/widgets/gimpselectiondata.c: deal with hostname in URIs.
2005-02-07 17:56:18 +00:00
Sven Neumann
747ffe8b6e ooops, didn't mean to commit that change 2005-02-07 17:31:40 +00:00
Sven Neumann
313f7835cb changed "Remote Image" to "Remote File". The state of the thumbnail
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c (gimp_imagefile_get_desc_string):
	changed "Remote Image" to "Remote File". The state of the
	thumbnail doesn't tell us if this is an image file at all.

	* app/widgets/gimpthumbbox.c: don't auto-thumbnail remote files.

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumbnail.c: do the same workaround for UNC
	paths as in file_utils_filename_from_uri().
2005-02-07 17:29:10 +00:00
Sven Neumann
47c35a6ebf app/config/gimpconfig-file.c app/file/file-utils.c app/gui/themes.c
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-file.c
	* app/file/file-utils.c
	* app/gui/themes.c
	* app/tools/gimpimagemaptool.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimpwidgets-utils.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/procedural_db.pdb: use gstdio wrappers.

	* app/pdb/procedural_db_cmds.c: regenerated.
2005-02-07 01:38:18 +00:00
Sven Neumann
648cccde5e app/base/base.c app/base/temp-buf.c app/base/tile-swap.c
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/base/base.c
	* app/base/temp-buf.c
	* app/base/tile-swap.c
	* app/config/gimpconfig-file.c
	* app/core/gimpbrush.c
	* app/core/gimpbrushgenerated.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpdata.c
	* app/core/gimpenvirontable.c
	* app/core/gimpgradient-load.c
	* app/core/gimpgradient-save.c
	* app/core/gimppalette-import.c
	* app/core/gimppalette.c
	* app/core/gimppattern.c
	* app/dialogs/user-install-dialog.c
	* app/gui/session.c
	* app/menus/menus.c
	* app/widgets/gimpdevices.c: use gstdio wrappers.
2005-02-07 01:24:22 +00:00
Sven Neumann
1a337ada72 unset the "focus-on-map" property for tool dialogs. Fixes bug #154651 (on
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptooldialog.c (gimp_tool_dialog_new): unset the
	"focus-on-map" property for tool dialogs. Fixes bug #154651 (on
	window managers supporting this hint).
2005-02-06 23:33:50 +00:00
Sven Neumann
4799a27ef8 removed some eeeky code that used to fiddle with the GimpController type.
2005-02-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollers.c (gimp_controllers_init): removed
	some eeeky code that used to fiddle with the GimpController type.

	* libgimpwidgets/gimpcontroller.c (gimp_controller_get_type): add
	the GimpConfig interface here, where it belongs.
2005-02-05 22:40:07 +00:00
Manish Singh
1169562545 readd declaration of gimp_prop_paint_mode_menu_new().
2005-02-04  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimppropwidgets.h: readd declaration of
        gimp_prop_paint_mode_menu_new().
2005-02-04 23:19:31 +00:00
William Skaggs
a395b02f6f Bill Skaggs <weskaggs@primate.ucdavis.edu>
* libgimpwidgets/gimppropwidgets.[ch]: magic-copied from app/widgets
	and un-movable things then removed.

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h: corresponding changes

	* app/widgets/gimppropwidgets.[ch]: remove functions that were
	moved.

	* app/dialogs/stroke-dialog.c
	* app/dialogs/tips-dialog.c
	* app/dialogs/user-install-dialog.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimphistogramoptions.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpinkoptions-gui.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmeasureoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontrollereditor.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpsizebox.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptooloptionseditor.c: fix includes.
2005-02-04 20:47:42 +00:00
William Skaggs
eb834ca3bf Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimppropwidgets.c:  add gtk-doc comments to
	public functions in prep for moving to libgimpwidgets.
2005-02-03 22:31:55 +00:00
Michael Natterer
f3e0792dcf Some cleanup to make plug-in menu creation less hackish and finally enable
2005-01-31  Michael Natterer  <mitch@gimp.org>

	Some cleanup to make plug-in menu creation less hackish and
	finally enable registering plug-in menu entries in much more UI
	managers (not only in the image and toolbox menus):

	* app/menus/menus.c: added a <Toolbox> UI manager instead of
	creating the toolbox menu from the <Image> UI manager.

	* app/widgets/gimpimagedock.[ch]: removed the ui_manager and the
	signal connections to update it...

	* app/widgets/gimpdock.[ch]: ...and added them here so all docks
	have their own UI manager. Determine which manager to create from
	looking at GimpDockClass::ui_manager_name (defaults to <Dock>).

	* app/widgets/gimptoolbox.c: set ui_manager_name to <Toolbox> and
	use the UI manager created by our parent class instead of using
	the <Image> one.

	(toolbox_create_tools): use gimp_action_get_accel_closure()
	instead of doing evil hacks.

	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c: removed lots of special casing of the
	<Image> UI manager. The code is almost ready for allowing plug-in
	menus under <Layers>, <Channels>, <Brushes> etc.
2005-01-31 16:09:52 +00:00
William Skaggs
6d74b06daf Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpenumwidgets.c
	* app/widgets/gimpenumwidgets.h: magic-moved from here...

	* libgimpwidgets/gimpenumwidgets.c
	* libgimpwidgets/gimpenumwidgets.h: ...to here.

	* app/dialogs/convert-dialog.c
	* app/dialogs/layer-add-mask-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/Makefile.am
	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h: all changed accordingly.
	Still need to do devel-docs.
2005-01-29 01:08:20 +00:00
Michael Natterer
1ba788fd82 app/actions/dockable-actions.c removed dock-related actions
2005-01-26  Michael Natterer  <mitch@gimp.org>

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]: removed dock-related
	actions (show-image-menu, auto-follow-active and move-to-screen).

	* app/actions/dock-actions.c
	* app/actions/dock-commands.[ch]: and added them here.

	* app/menus/menus.c: add the "dock" action group to the
	"<Dockable>" UI Manager.

	* app/widgets/gimphelp-ids.h: reordered to match the new grouping.

	* menus/dockable-menu.xml.in: changed accordingly.
2005-01-26 13:34:41 +00:00
Sven Neumann
4aa2bf9382 libgimpbase/Makefile.am removed these two files again.
2005-01-26  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimppath.[ch]: removed these two files again.

	* libgimpconfig/gimpconfig-path.[ch]: merged the path type and
	param spec here. Renamed to GimpConfigPath and GimpParamConfigPath.

	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbasetypes.[ch]
	* libgimpconfig/gimpconfig-deserialize.c
	* libgimpconfig/gimpconfig-params.h
	* app/config/gimpbaseconfig.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpcoreconfig.c
	* app/config/gimpguiconfig.c
	* app/config/gimppluginconfig.c
	* app/widgets/gimppropwidgets.c: changed accordingly.

	* libgimpbase/gimpbase.def: updated.
2005-01-25 23:44:05 +00:00
Michael Natterer
3592a58d96 new file holding the opaque typedefs for libgimpconfig. Includes
2005-01-25  Michael Natterer  <mitch@gimp.org>

	* libgimpconfig/gimpconfigtypes.h: new file holding the opaque
	typedefs for libgimpconfig. Includes "libgimpbase/gimpbasetypes.h"

	* libgimpconfig/Makefile.am: added the new file. Removed stuff
	that is not needed.

	* libgimpconfig/gimpconfigwriter.h
	* libgimpconfig/gimpconfig-iface.h: removed typedefs here.

	* libgimpconfig/gimpconfig-deserialize.c
	* libgimpconfig/gimpconfig-iface.c
	* libgimpconfig/gimpconfig-serialize.c
	* libgimpconfig/gimpconfig-utils.c
	* libgimpconfig/gimpconfig.h
	* libgimpconfig/gimpconfigwriter.c: include it before including
	any other libgimpconfig stuff.

	* app/config/config-types.h: #include "libgimpbase/gimpbasetypes.h"

	* app/config/gimpconfig-utils.h: changed include guards to
	__APP_GIMP_CONFIG_UTILS_H__.

	* app/dialogs/tips-parser.c: include <glib-object.h> instead of
	just <glib.h>.

	* app/tools/gimphistogramoptions.c
	* app/tools/gimptextoptions.c: include "config/gimpconfig-utils.h"

	* app/widgets/gimpdialogfactory.h
	* app/widgets/gimpsessioninfo.h: removed inclusion of
	"libgimpbase/gimpbasetypes.h".
2005-01-25 20:30:20 +00:00
William Skaggs
1cee9b7298 continuing commit after broken pipe 2005-01-25 19:11:26 +00:00
Michael Natterer
8d3c38c94b Enabled closing docks with Ctrl-W:
2005-01-24  Michael Natterer  <mitch@gimp.org>

	Enabled closing docks with Ctrl-W:

	* app/actions/Makefile.am
	* app/actions/dock-actions.[ch]
	* app/actions/dock-commands.[ch]: added new action group which
	holds a single action, "dock-close".

	* app/actions/actions.c: register the "dock" group.

	* app/menus/menus.c: add it to the "<Dock>" UI manager.

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_DOCK_CLOSE.
2005-01-23 23:00:21 +00:00
Sven Neumann
24786d2b73 added gimp_prop_expander_new().
2005-01-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added gimp_prop_expander_new().

	* app/paint/gimppaintoptions.[ch]: added a property to track the
	state of the "Pressure sensitivity" expander.

	* app/tools/gimppaintoptions-gui.c: use gimp_prop_expander_new()
	to create the "Pressure sensitivity" expander.
2005-01-22 20:32:34 +00:00
Sven Neumann
8b9a69255e include <stdio.h> for sscanf().
2005-01-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.c: include <stdio.h> for sscanf().
2005-01-22 20:20:21 +00:00
Sven Neumann
4eaddbc7d3 added more gtk-doc comments.
2005-01-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpenumwidgets.c: added more gtk-doc comments.
2005-01-22 01:50:15 +00:00
William Skaggs
36f062d1a0 broken pipe on previous commit, finishing 2005-01-22 00:43:31 +00:00
Sven Neumann
3069695265 app/widgets/Makefile.am app/widgets/widgets-types.h
2005-01-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenumcombobox.[ch]
	* app/widgets/gimpenumstore.[ch]: moved GimpEnumStore and
	GimpEnumComboBox from here ...

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpenumcombobox.[ch]
	* libgimpwidgets/gimpenumstore.[ch]: ... to libgimpwidgets.

	* app/dialogs/convert-dialog.c
	* app/dialogs/scale-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpstrokeeditor.c
	* data/images/gimp-splash.png: changed includes accordingly.
2005-01-21 22:59:51 +00:00
Michael Natterer
a17f8e56d0 new function as workaround for missing GTK+ API (see bug #141750).
2005-01-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch] (gimp_action_get_accel_closure):
	new function as workaround for missing GTK+ API	(see bug #141750).

	* app/widgets/gimpactionview.[ch]: use the function instead of
	having this ugly hack here. Store the accel_closure instead of the
	hackish menu_item in the tree store. Removed cruft and cleaned up
	a bit.
2005-01-21 14:58:03 +00:00
Sven Neumann
49be4f79fa call gimp_image_flush() after setting the active component since this
2005-01-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcomponenteditor.c
	(gimp_component_editor_button_press): call gimp_image_flush() after
	setting the active component since this might unselect the active
	channel. Fixes bug #164195.
2005-01-20 10:05:28 +00:00
Michael Natterer
5a2fb840a8 blink more correctly.
2005-01-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.c (gimp_dockable_expose_event): blink
	more correctly.
2005-01-18 20:03:11 +00:00
Michael Natterer
9f527b8255 added new function gimp_dockable_blink() which lets the dockable's
2005-01-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdockable.[ch]: added new function
	gimp_dockable_blink() which lets the dockable's title_area blink.

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factory_dialog_new_internal): let wilber blink at the
	user :) Fixes bug #164156.
2005-01-18 15:18:35 +00:00
Michael Natterer
0429d04908 Allow to drop stuff onto empty layers, channels and paths dialogs to
2005-01-17  Michael Natterer  <mitch@gimp.org>

	Allow to drop stuff onto empty layers, channels and paths dialogs
	to create new items:

	* app/widgets/gimpcontainertreeview.h (struct GimpContainerTreeView):
	added "gboolean dnd_drop_to_empty".

	* app/widgets/gimpcontainertreeview-dnd.c: if "dnd_drop_to_empty"
	is TRUE, dispatch drops to empty views and to the empty area below
	all items.

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_init): set
	"dnd_drop_to_empty" to TRUE.

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: made all drop functions work
	with "dest_viewable" being NULL and changed drop_possible()
	implementations accordingly. Cleaned up the whole DND code a bit.

	* app/widgets/gimplayertreeview.c: removed color and pattern
	drop code...

	* app/widgets/gimpdrawabletreeview.c: and added it here so colors
	and patterns can be dropped to the channels dialog too.
2005-01-17 15:28:08 +00:00
Michael Natterer
db89496a11 implement GimpItem::convert(). Handles any drawable, including conversion
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpchannel.c: implement GimpItem::convert(). Handles
	any drawable, including conversion to GRAY, flattening and
	resizing.

	* app/widgets/gimpchanneltreeview.c: implement dropping of all
	kinds of drawables as new channels. Fixes bug #158133.

	Simplified component dropping by removing stuff which is done by
	gimp_item_convert() now.
2005-01-15 21:15:43 +00:00
Michael Natterer
e5c0d8eb0e app/core/gimpitem.c app/core/gimpdrawable.c made GimpItem::scale() and
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.c
	* app/core/gimpdrawable.c
	* app/vectors/gimpvectors.c: made GimpItem::scale() and ::resize()
	work on unattached items.

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_drop_component): fix drop index.

	* app/widgets/gimpchanneltreeview.c: implement dropping of
	components as new channels. Fixes bug #158483.
2005-01-15 19:17:11 +00:00
Michael Natterer
63c933aef7 added virtual function GimpContainerTreeView::drop_component(). Added EEKy
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_component(). Added EEKy "dnd_gimp"
	needed for gimp_selection_data_get_component().

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_set_context):
	set the "dnd_gimp" pointer if it is NULL.

	* app/widgets/gimpcontainertreeview-dnd.c: handle component drops
	and dispatch ::drop_component() accordingly.

	* app/widgets/gimplayertreeview.c: implement dropping of
	components as new layers. Addresses bugs #158483 and #158133.
2005-01-15 17:57:32 +00:00
Michael Natterer
7f74bdc941 app/display/gimpdisplayshell.c app/display/gimpdisplayshell-dnd.[ch]
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-dnd.[ch]
	* app/widgets/gimptoolbox-dnd.c: enabled dropping of components
	to the display and the toolbox. Addresses bug #158483.
2005-01-15 17:17:33 +00:00
Michael Natterer
bfa7335635 added gimp_dnd_get_component_icon().
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c: added gimp_dnd_get_component_icon().

	* app/widgets/gimpcomponenteditor.c: allow to drag
	components. They can't be dropped anywhere yet.
2005-01-15 14:55:15 +00:00
Michael Natterer
bb3a6002cf handle drops of items of all types from all images and convert them if
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.c
	(gimp_item_tree_view_drop_viewable): handle drops of items of all
	types from all images and convert them if needed.

	* app/widgets/gimplayertreeview.c: enable dropping of all kinds of
	drawables. Addresses bug #158133.
2005-01-15 03:24:42 +00:00
Michael Natterer
6dda0d82a6 reordered so COMPONENT is after IMAGE.
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.h (enum GimpDndType): reordered so
	COMPONENT is after IMAGE.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpselectiondata.[ch]: added API for passing
	components around via DND. Speaks in terms of a
	(GimpImage,GimpChannelType) tuple.
2005-01-15 02:24:38 +00:00
Michael Natterer
0f4e21683e Allow to easily open brushes and patterns as images. Fixes bug #163059.
2005-01-13  Michael Natterer  <mitch@gimp.org>

	Allow to easily open brushes and patterns as images.
	Fixes bug #163059.

	* app/actions/brushes-actions.c
	* app/actions/patterns-actions.c: added "brushes-open-as-image"
	and "patterns-open-as-image" actions.

	* app/actions/data-commands.[ch]: added
	data_open_as_image_cmd_callback() which tries to load
	data->filename as image.

	* app/widgets/gimphelp-ids.h: added help IDs for the new actions.

	* app/widgets/gimpdatafactoryview.c: added buttons.

	* menus/brushes-menu.xml
	* menus/patterns-menu.xml: added them to the menus.
2005-01-13 20:22:53 +00:00
Michael Natterer
4f97f7a5f9 Made the file open and save dialogs use the last used folder instead of
2005-01-13  Michael Natterer  <mitch@gimp.org>

	Made the file open and save dialogs use the last used folder
	instead of defaulting to current directory. Fixes bug #162385.

	* app/widgets/gimpfiledialog.[ch] (gimp_file_dialog_set_uri):
	removed this function because it had no functionality except
	creating usability problems.

	* app/actions/file-commands.c: use gtk_file_chooser_set_uri()
	instead but *only* if we already have an uri from an alread open
	image or the document hinstory.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): set
	the file chooser's uri only if we have an uri from the image
	itself. Leave the current folder untouched otherwise and just set
	the current name (e.g. "Untitled").

	* app/dialogs/file-save-dialog.c (file_save_dialog_save_image): on
	successful save, remember the used uri by attaching it to the
	"gimp" instance.

	(file_save_dialog_new): set the last saved uri's folder on the
	newly created file save dialog.
2005-01-13 17:41:48 +00:00
Sven Neumann
fb73b3d786 changed "Key" to "Cursor".
2005-01-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerkeyboard.c: changed "Key" to "Cursor".
2005-01-09 02:07:31 +00:00
Sven Neumann
ae128ff635 connect to "button_press_event" and start editing immidiately instead of
2005-01-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactionview.c (gimp_action_view_new): connect to
	"button_press_event" and start editing immidiately instead of
	waiting for a second click. Fixes bug #163385.
2005-01-09 01:29:30 +00:00
Sven Neumann
f571ceebec if called with (ensure_visibility == TRUE), raise the toolbox. Fixes bug
2005-01-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c (gimp_dialog_factories_toggle):
	if called with (ensure_visibility == TRUE), raise the toolbox.
	Fixes bug #163381.
2005-01-09 00:08:42 +00:00
Sven Neumann
c9f83a1326 really fix handling of RTL layouts (bug #162663).
2005-01-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_find_click_cell): really fix handling of
	RTL layouts (bug #162663).
2005-01-08 16:52:44 +00:00
Sven Neumann
09bb9ebb1d fixed handling of clicks into a horizontally scrolled treeview.
2005-01-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): fixed handling of clicks
	into a horizontally scrolled treeview.
2005-01-08 16:35:39 +00:00
Sven Neumann
9167346a5c handle RTL layouts (fixes bug #162663).
2005-01-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): handle RTL layouts (fixes
	bug #162663).
2005-01-07 21:46:04 +00:00
Sven Neumann
a1818adf0f prepared code for fixing bug #162663.
2005-01-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c: prepared code for fixing
	bug #162663.
2005-01-03 23:47:26 +00:00
Michael Natterer
150bea1e80 Implemented "Snap to Canvas Edges" (fixes bug #152971) and "Snap to Active
2005-01-03  Michael Natterer  <mitch@gimp.org>

	Implemented "Snap to Canvas Edges" (fixes bug #152971) and
	"Snap to Active Path" (half way done):

	* app/core/gimpimage-snap.[ch]: added boolean snap_to_canvas and
	snap_to_vectors parameters (snap_to_vectors works fine when
	snapping to a point, but is unimplemented for snapping to a
	rectangle).

	* app/display/gimpdisplayshell.[ch] (struct GimpDisplayShell):
	added snap_to_canvas and snap_to_vectors booleans.

	* app/display/gimpdisplayshell-appearance.[ch]: added API to
	get/set them.

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* app/widgets/gimphelp-ids.h: added actions, callbacks and help IDs.

	* menus/image-menu.xml.in: added them to Image->View.
2005-01-03 16:19:10 +00:00
Sven Neumann
23a3bdf31e app/widgets/gimpsizebox.c round displayed resolution instead of just
2005-01-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.c
	* app/widgets/gimptemplateeditor.c: round displayed resolution
	instead of just casting to integer values. Use image size limits
	from libgimpbase/gimplimits.h instead of some arbitrary numbers.
2005-01-02 16:55:50 +00:00
Sven Neumann
8511b4c226 fixed position of pixel and resolution labels.
2005-01-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.c (gimp_size_box_constructor): fixed
	position of pixel and resolution labels.
2005-01-02 02:07:46 +00:00
Michael Natterer
e5feab6519 removed the just added gimp_palette_insert_entry() and added a "gint
2004-12-31  Michael Natterer  <mitch@gimp.org>

	* app/core/gimppalette.[ch]: removed the just added
	gimp_palette_insert_entry() and added a "gint position" parameter
	to gimp_palette_add_entry() instead (no need to have two almost
	identical functions).

	* app/actions/palette-editor-commands.c
	* app/core/gimppalette-import.c
	* app/widgets/gimppaletteeditor.c
	* tools/pdbgen/pdb/palette.pdb: changed accordingly.

	* app/pdb/palette_cmds.c: regenerated.
2004-12-31 17:27:57 +00:00
Michael Natterer
c1ddf3ea45 use the coordinates passed in the color drop callback instead of
2004-12-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfgbgeditor.[ch]: use the coordinates passed in
	the color drop callback instead of remembering them in the
	drag_motion handler.
2004-12-31 16:53:22 +00:00
Michael Natterer
e0f25134ca Applied modified patch from Ben Campbell which adds drop coordinates to
2004-12-31  Michael Natterer  <mitch@gimp.org>

	Applied modified patch from Ben Campbell which adds drop
	coordinates to the color drop callback and uses it to insert
	colors in the palette editor. Extended the patch to add drop
	coordinates to all drop callbacks.

	* app/core/gimppalette.[ch]: added gimp_palette_insert_entry().

	* app/display/gimpdisplayshell-dnd.[ch]: added drop coordinates
	to all drop callbacks.

	* app/dialogs/palette-import-dialog.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpfgbgeditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptooloptionseditor.c
	* libgimpwidgets/gimpcolorselect.c: changed accordingly. The passed
	drop coordiantes are so far unused.

	* app/widgets/gimppaletteeditor.c: use the drop coordinates to
	insert the new color into the palette at the right place instead
	of always appending. Fixes bug #150030.
2004-12-31 14:36:30 +00:00
Michael Natterer
8439ecb6da app/actions/tools-actions.c app/actions/tools-commands.[ch] applied a
2004-12-31  Michael Natterer  <mitch@gimp.org>

	* app/actions/tools-actions.c
	* app/actions/tools-commands.[ch]
	* app/widgets/gimptoolview.[ch]: applied a (modified) patch from
	Joao S. O. Bueno which adds "raise" and "lower" actions and
	their buttons in the tool dialog. Fixes bug #158666.
	Cleaned up the tool action callbacks.
2004-12-31 13:29:39 +00:00
William Skaggs
129c953b6f Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpsizebox.c: give correct arguments to
	gimp_coordinates_new().  Fixes problem described in
	comment 6 of bug #162387.
2004-12-31 00:27:35 +00:00
Sven Neumann
4d27239a9c renamed menu_path parameter to menu_label and added a pointer to
2004-12-28  Sven Neumann  <sven@gimp.org>

	* libgimp/gimp.[ch] (gimp_install_procedure, gimp_install_temp_proc):
	renamed menu_path parameter to menu_label and added a pointer to
	gimp_plugin_menu_register()

	* app/widgets/gimpsizebox.c (gimp_size_box_constructor): removed
	unused variables.
2004-12-28 15:21:16 +00:00
William Skaggs
b13aded024 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: undo changes of 12-24,
	in favor of a better fix.

	* app/widgets/gimperrordialog.c: fix bug #162147 properly,
	as suggested by mitch.
2004-12-26 17:11:31 +00:00
William Skaggs
59e86d02fb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: replace % with space
	in file name before showing error message,
	fixes bug #162147.

	* app/core/gimp-gui.c
	* app/widgets/gimpmessagebox.c: be a bit more paranoid
	about validating utf8 for messages.
2004-12-24 19:11:30 +00:00
William Skaggs
1380e5ea0b Bill Skaggs <weskaggs@primate.ucdavis.edu>
* gimp/app/widgets/gimpsizebox.c: fix incorrect Update
	Policy for size entry as pointed out by mitch.
2004-12-24 00:19:41 +00:00
William Skaggs
09951fcf99 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* gimp/app/widgets/gimpsizebox.c: use gimp_coordinates_new()
	instead of duplicating a lot of code.  Fixes bug #161756.

	* gimp/app/widgets/gimppropwidgets.c: small change in
	chainbutton handling to make above work.
2004-12-23 18:12:23 +00:00
Manish Singh
608efddb91 Cast result of g_value_dup_object() to GIMP_CONTEXT().
2004-12-16  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property): Cast
        result of g_value_dup_object() to GIMP_CONTEXT().
2004-12-16 22:52:32 +00:00
Michael Natterer
37226e50d6 added utility function gimp_drawable_preview_bytes() and use it. Some
2004-12-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable-preview.[ch]: added utility function
	gimp_drawable_preview_bytes() and use it. Some cleanup,
	untabified.

	* app/widgets/gimpviewrendererdrawable.c: use
	gimp_drawable_preview_bytes() instead of duplicating its code.
2004-12-15 14:40:52 +00:00
Michael Natterer
91d0794771 don't forget the context we were created with but rmember it as
2004-12-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppdbdialog.[ch]: don't forget the context we
	were created with but rmember it as pdb_dialog->caller_context.

	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: use the caller_context when
	calling the temp_proc so the temp_proc's stack frame doesn't
	contain the dialog's private context (which is just a scratch
	model for the container views) but the plug-in's real context
	which is fully initialized. Fixes bug #161114.
2004-12-13 14:45:55 +00:00
Michael Natterer
44a7132848 invert logic so everything except GTK_RESPONSE_OK keeps the dock open
2004-12-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdock.c (gimp_dock_delete_event): invert logic so
	everything except GTK_RESPONSE_OK keeps the dock open
	(e.g. hitting escape).
2004-12-12 23:13:19 +00:00
Michael Natterer
2e263a8cc0 added precondition check for the coords of the src area. Some cleanup and
2004-12-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable-preview.c (gimp_drawable_get_sub_preview):
	added precondition check for the coords of the src area. Some
	cleanup and simplification.

	* app/widgets/gimpviewrendererdrawable.c
	(gimp_view_renderer_drawable_render): don't request sub-previews
	of areas outside the drawable and don't reuqest previews of zero
	width or height. Fixes crashes with the new preview code.
2004-12-12 22:52:00 +00:00
William Skaggs
578c0c4f0a Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdataeditor.c: make Revert button insensitive
	because revert is not yet implemented (bug #152259).
2004-12-12 18:26:16 +00:00
Sven Neumann
734265ee59 show a confirmation dialog if a dock with multiple tabs is being closed.
2004-12-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdock.c: show a confirmation dialog if a dock
	with multiple tabs is being closed. Sorry for the new strings,
	they were carefully copied from gnome-terminal.
2004-12-12 18:02:00 +00:00
Michael Natterer
53c3ff1821 added new function copy_region_nocow() as a workaround for the fact that
2004-12-12  Michael Natterer  <mitch@gimp.org>

	* app/paint-funcs/paint-funcs.[ch]: added new function
	copy_region_nocow() as a workaround for the fact that sharing
	tiles with the projection is heavily broken.

	* app/base/tile-manager.c (tile_invalidate): added a warning when
	entering the code path that breaks badly.

	* app/core/gimp-edit.[ch]: added gimp_edit_copy_visible(), using
	the non-COW copying function above.

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_COPY_VISIBLE.

	* app/actions/edit-actions.c
	* app/actions/edit-commands.[ch]: added action & callback for
	"edit-copy-visible".

	* menus/image-menu.xml.in: added "edit-copy-visible" to the image
	menu.

	* tools/pdbgen/pdb/edit.pdb: added gimp_edit_copy_visible()
	PDB wrapper.

	* app/pdb/edit_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpedit_pdb.[ch]: regenerated.

	* plug-ins/script-fu/scripts/copy-visible.scm: removed all code
	and made it a backward compat wrapper around gimp-edit-copy-visible.
	Fixes bug #138662.
2004-12-12 14:01:08 +00:00
Michael Natterer
4714802aff added new function gimp_drawable_get_sub_preview() which returns a scaled
2004-12-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable-preview.[ch]: added new function
	gimp_drawable_get_sub_preview() which returns a scaled preview of
	a part of a drawable.

	(gimp_drawable_preview_scale): made it work with srcPR.x and
	srcPR.y being != 0.

	* app/core/gimpimage-preview.c (gimp_image_get_new_preview)
	* app/widgets/gimpviewrendererdrawable.c
	(gimp_view_renderer_drawable_render): if the area of the drawable
	preview is more than 4 times larger than the drawable itself (evil
	heuristic, but seems to work fine), use above function to get a
	sub-preview of the drawable instead of getting an insanely large
	preview of the whole drawable just to use a small part of it.
	Fixes bug #142074.

	* app/core/gimpimage-preview.c (gimp_image_get_new_preview):
	optimized by skipping layers which do not intersect with the
	canvas.
2004-12-11 01:22:58 +00:00
William Skaggs
791dc60f8f Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphistogrameditor.c: make histogram editor,
	and therefore histogram dialog, use the selection.  Should
	resolve bug #72959.

	* app/core/gimpdrawable-histogram.h: remove trailing
	whitespace.
2004-12-10 23:07:21 +00:00
Manish Singh
e7a82297ab app/widgets/gimpdatafactoryview.c #include <string.h> for strcmp()
2004-12-10  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpdatafactoryview.c
        * app/widgets/gimpitemtreeview.c: #include <string.h> for strcmp()
2004-12-10 22:11:29 +00:00
Michael Natterer
8c95eb1ae3 app/widgets/gimpdatafactoryview.c
2004-12-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdatafactoryview.c
	(gimp_data_factory_view_tree_name_edited)
	* app/widgets/gimpitemtreeview.c
	(gimp_item_tree_view_name_edited)
	* app/widgets/gimptemplateview.c
	(gimp_template_view_tree_name_edited): call gimp_object_set_name()
	or gimp_item_rename() only if the item's name has actually changed
	and restore the old text otherwise. Fixes one instance of "name is
	not updated correctly after editing" for which I blamed GTK+ in
	bug #145463 :-) The other instances should be fixed in GTK+ HEAD
	and are imho unfixable with GTK+ 2.4.
2004-12-10 21:07:28 +00:00
Michael Natterer
4ee9b210b5 clear all viewable cell renderers so they don't keep pointers to
2004-12-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_clear_items): clear all viewable cell
	renderers so they don't keep pointers to layers/masks which don't
	exist any more. Fixes the additional problem in bug #148852 but
	not the bug itself.
2004-12-10 17:56:13 +00:00
Michael Natterer
01e94fcb19 app/dialogs/print-size-dialog.c set a focus_chain on the size_entries so
2004-12-09  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/print-size-dialog.c
	* app/widgets/gimpsizebox.c: set a focus_chain on the size_entries
	so the focus order is width->height->chain->unitmenu and not
	width->chain->height->unitmenu.

	* app/widgets/gimptemplateeditor.c: changed focus_chain code to
	work like above (cosmetics).
2004-12-09 16:22:25 +00:00
Michael Natterer
cf4a649f38 renamed gimp_ui_manager_get_action() to gimp_ui_manager_find_action().
2004-12-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: renamed
	gimp_ui_manager_get_action() to gimp_ui_manager_find_action().

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/display/gimpdisplayshell-close.c: changed accordingly.

	(this change is quite useless as it stands, but will help keeping
	the diff between 2.2 and 2.3 small as soon as we're branched).

	* app/widgets/gimpcolormapeditor.c
	(gimp_colormap_preview_button_press): invoke the "edit-color", not
	"new-color" action upon double click.

	(palette_editor_select_entry): update the ui manager after
	selecting the entry so the entry-specific actions become sensitive
	if there was no entry selected before.
2004-12-08 13:52:28 +00:00
Michael Natterer
d90360e29f added new prop_widget gimp_prop_int_combo_box_new() which takes a
2004-12-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added new prop_widget
	gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore
	and allows to create views on int properties with arbitrary sets
	of values (not just enums).

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_constructor): added support for generic
	combo boxes controlled exclusively by controller properties: if an
	int property "foo" is followed by an object property "foo-values"
	and the contained object is a GimpIntStore, use that store as
	model for selecting "foo"'s values using
	gimp_prop_int_combo_box_new().

	(Allows for more flexible controller configuration, the actual use
	case in the midi controller is still work in progress).
2004-12-08 12:46:21 +00:00
Michael Natterer
d8337d6f24 improved error message about missing XML files.
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved
	error message about missing XML files.
2004-12-01 13:27:03 +00:00
Michael Natterer
841efd0e2e app/display/gimpdisplayshell-appearance.c app/display/gimpdisplayshell.c
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get()
	actually returns something. Prevents crashes caused by missing
	ui manager xml files. Fixes bug #159346.
2004-12-01 00:13:48 +00:00
Michael Natterer
495963276a no need to update the ui manager here, the parent class already does it.
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need
	to update the ui manager here, the parent class already does it.
2004-12-01 00:06:23 +00:00
Michael Natterer
d669e4a498 allow to set color and viewable to NULL, GimpAction handles this nicely.
2004-11-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_set_action_color)
	(gimp_action_group_set_action_color): allow to set color and
	viewable to NULL, GimpAction handles this nicely. Fixes warnings
	some foo_actions_update() functions were triggering.
2004-11-30 00:30:05 +00:00
Sven Neumann
eb7b317d36 app/main.c app/widgets/gimpenumstore.h app/widgets/gimpunitstore.c applied
2004-11-27  Sven Neumann  <sven@gimp.org>

	* app/main.c
	* app/widgets/gimpenumstore.h
	* app/widgets/gimpunitstore.c
	* plug-ins/common/retinex.c: applied patch by Tim Mooney that
	removes extraneous ;
2004-11-27 12:09:13 +00:00
Michael Natterer
6d63d50040 guarded the whole header with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION
2004-11-24  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.[ch]: guarded the whole header
	with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no
	fixed API yet. Added a "state" property bacause "name" was abused
	as the controller's state. Added "help_domain" to the controller
	class.

	* libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h

	* modules/controller_linux_input.c
	* modules/controller_midi.c: set the "name" property to the name
	retrieved from the device, or to a default string if no name is
	available. Store the status in the "state" property. Added and
	changed some strings, but it's better to have the controller
	strings untranslated than to have no tooltips at all or misleading
	labels.

	* app/widgets/gimpcontrollerkeyboard.c
	* app/widgets/gimpcontrollerwheel.c: set default strings for both.

	* app/widgets/gimpcontrollereditor.c: added a GUI for the "state"
	property.

	* app/widgets/gimpcontrollerkeyboard.h
	* app/widgets/gimpcontrollerwheel.h
	* app/widgets/gimpcontrollerinfo.c
	* app/widgets/gimpcontrollers.c: #define
	GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files
	above).

	* app/widgets/gimphelp-ids.h: added the IDs of all controller
	modules and also of all other modules. The defines are not
	actually used, but this file is the canonical place to collect all
	the core's help IDs.
2004-11-24 02:17:12 +00:00
Michael Natterer
d8a5ca6c1b added new function gimp_toggle_button_set_visible() which can be used as
2004-11-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_toggle_button_set_visible() which can be used as "toggled"
	callback on a GtkToggleButton and sets a widget (in)visible
	according to the toggle's "active" state.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c: use it to hide (rather than
	just insensitize) the seldomly used "Feather edges", "Autoshrink
	selection", "Adaptive supersampling", "Fade out" and "Use color
	from gradient" widgets when their enabling toggle is unchecked.
	Makes the affected tool options much less crowded and noisy in
	their default appearance. Fixes bug #159008.
2004-11-23 17:01:51 +00:00
Michael Natterer
69ead3955c always create the event mapping table. Fixes tons of warnings and
2004-11-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init):
	always create the event mapping table. Fixes tons of warnings and
	non-functional controller mapping dialog when an empty controller
	was deserialized from controllerrc. Spotted by drc.
2004-11-22 21:46:23 +00:00
Hans Breuer
696663a611 [new file] app/dialogs/Makefile.am : added to EXTRA_DIST
2004-09-21  Hans Breuer  <hans@breuer.org>

	* app/dialogs/makefile.msc : [new file]
	  app/dialogs/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc app/gimpcore.def : updated

	* app/gimp.rc : let wilber be first

	* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either

	* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib

	* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32

	* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h

	* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/scrip-fu.c : there
	is no script-fu-server on win32
2004-11-21 14:22:45 +00:00
Michael Natterer
567bb7b2db added boolean property "value-variable" which specifies if the
2004-11-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpenumaction.[ch]: added boolean property
	"value-variable" which specifies if the GimpEnumAction::selected()
	signal may be emitted with arbirtary values (value-variable = TRUE)
	or *only* with enum_action->value (value-variable = FALSE).

	* app/widgets/gimpactiongroup.[ch]: added "gboolean
	value_variable" to GimpEnumActionEntry and set it in
	gimp_action_group_add_enum_actions().

	* app/actions/channels-actions.c
	* app/actions/colormap-editor-actions.c
	* app/actions/context-actions.c
	* app/actions/drawable-actions.c
	* app/actions/edit-actions.c
	* app/actions/error-console-actions.c
	* app/actions/gradient-editor-actions.c
	* app/actions/image-actions.c
	* app/actions/layers-actions.c
	* app/actions/palette-editor-actions.c
	* app/actions/plug-in-actions.c
	* app/actions/vectors-actions.c
	* app/actions/view-actions.c: set "variable" to FALSE for all enum
	actions except those which are used with the GIMP_ACTION_SELECT_SET
	voodoo.

	* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
	fall back to gtk_action_activate() if the action specified in a
	GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables
	triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events
	(like midi note-on and note-off).
2004-11-18 16:04:41 +00:00
Michael Natterer
30164f1be2 added back the .xcf.gz and .xcf.bz2 extensions because they are the only
2004-11-18  Michael Natterer  <mitch@gimp.org>

	* plug-ins/common/compressor.c (compressors): added back the
	.xcf.gz and .xcf.bz2 extensions because they are the only way
	to figure the special nature of this plug-in's extensions.

	* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
	extensions" (extensions which have a '.' themselves).

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	try to replace the whole extension if the last extension is one of
	the meta extensions kept by GimpFileProcView. Fixes bug #158377.
2004-11-18 11:50:25 +00:00
Manish Singh
f12184a72e Hide SVG drop g_print under be_verbose.
2004-11-16  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under
        be_verbose.
2004-11-17 03:42:47 +00:00
Michael Natterer
fb87f44701 get rid of the gimp_fg_bg_editor_context_changed() callback and
2004-11-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfgbgeditor.c: get rid of the
	gimp_fg_bg_editor_context_changed() callback and
	g_signal_connect_swapped() gtk_widget_queue_draw() directly.
2004-11-16 18:53:54 +00:00
Michael Natterer
1e4dc95ec2 implement GimpDockedInterface::set_context() and set the context of the
2004-11-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpchanneltreeview.c: implement
	GimpDockedInterface::set_context() and set the context of the
	embedded GimpComponentEditor. Fixes NULL-context crashes in
	action callbacks when invoked from the component editor.
	Spotted by Jimmac.

	Unrelated:

	* app/widgets/gimpitemtreeview.c: get rid of the
	gimp_item_tree_view_context_changed() callback and
	g_signal_connect_swapped() gimp_item_tree_view_set_image()
	directly.
2004-11-16 18:36:48 +00:00
Sven Neumann
d4bf381c20 app/actions/file-commands.c app/dialogs/file-save-dialog.c
2004-11-16  Sven Neumann  <sven@gimp.org>

	* app/actions/file-commands.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-save.[ch]
	* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
	"set_image_clean" parameters into a single "save_a_copy"
	parameter.  When saving a copy, attach the used URI to the image and
	let the "Save a Copy" file chooser default to the last used value.
2004-11-16 13:37:36 +00:00
Sven Neumann
c286aece5d limit the number of file extensions that are added to the file filter menu
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	limit the number of file extensions that are added to the file
	filter menu to keep the file dialog from growing too wide.
2004-11-15 19:33:24 +00:00
Sven Neumann
fb0985a1c3 app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc) better fix
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	better fix for bug #158369.
2004-11-15 13:50:02 +00:00
Sven Neumann
562b1595f2 better fix for bug #158369.
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	better fix for bug #158369.
2004-11-15 13:42:22 +00:00
Sven Neumann
e196a77246 return early if gimp_file_proc_view_get_proc() didn't return a file
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	return early if gimp_file_proc_view_get_proc() didn't return a file
	procedure. Should fix bug #158369.
2004-11-15 13:38:00 +00:00
Sven Neumann
869a1b680d started to redo this dialog without using a GimpSizeBox. The widgets
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/dialogs/print-size-dialog.c: started to redo this dialog
	without using a GimpSizeBox. The widgets aren't connected, so it
	isn't usable yet.

	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpsizebox.c: trivial cleanups.

	* data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac.
2004-11-14 23:51:46 +00:00
Manish Singh
5d01581069 Fix a bunch of warnings from Sparse:
2004-11-13  Manish Singh  <yosh@gimp.org>

        Fix a bunch of warnings from Sparse:

        * app/actions/dockable-commands.c
        * app/actions/layers-actions.c
        * app/actions/view-commands.c
        * app/base/pixel-surround.c
        * app/config/gimpconfig-utils.c
        * app/config/gimpscanner.c
        * app/core/gimpbrushgenerated.c
        * app/core/gimpcontainer.c
        * app/core/gimpimage.c
        * app/dialogs/palette-import-dialog.c
        * app/file/gimprecentlist.c
        * app/plug-in/plug-in-params.c
        * app/text/gimptext-compat.c
        * app/text/gimptext-parasite.c
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpstroke.c
        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimpselectiondata.c
        * app/xcf/xcf.c
        * libgimp/gimp.c
        * libgimpthumb/gimpthumb-utils.c
        * libgimpthumb/gimpthumbnail.c
        * modules/cdisplay_proof.c
        * plug-ins/Lighting/lighting_ui.c
        * plug-ins/common/csource.c
        * plug-ins/common/glasstile.c
        * plug-ins/common/nova.c
        * plug-ins/common/pcx.c
        * plug-ins/common/pnm.c
        * plug-ins/common/randomize.c
        * plug-ins/common/screenshot.c
        * plug-ins/common/sel_gauss.c
        * plug-ins/common/spheredesigner.c
        * plug-ins/common/wind.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gimpressionist/gimpressionist.c
        * plug-ins/ifscompose/ifscompose.c
        * plug-ins/print/gimp_main_window.c
        * plug-ins/print/print.c: Cleanup integer vs. pointer confusion.

        * app/base/temp-buf.c
        * app/dialogs/about-dialog.c
        * plug-ins/common/bumpmap.c
        * plug-ins/common/jigsaw.c
        * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.

        * app/config/gimpconfig-deserialize.c
        * app/config/gimpconfig-path.c
        * app/config/gimpconfigwriter.c
        * app/core/gimpgradient.c
        * app/tools/gimpdrawtool.c
        * plug-ins/common/nlfilt.c
        * plug-ins/common/unsharp.c
        * plug-ins/common/zealouscrop.c: Define inline functions before they
        are used.

        * app/core/gimpdrawable-blend.c: PixelRegion definition was changed
        some time ago, but the initialization here didn't change. Fix it.

        * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
        assign token twice in a row.

        * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
        need to initialize file_data, since the code fills out all the fields.

        * plug-ins/common/CML_explorer.c
        * plug-ins/common/vpropagate.c: Declare function pointers fully.

        * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
        we assume we can use the "inline" keyword always.

        * plug-ins/common/psd_save.c
        * plug-ins/common/vinvert.c
        * plug-ins/gfig/gfig-arc.c
        * plug-ins/gfig/gfig-bezier.c
        * plug-ins/gfig/gfig-circle.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gfig/gfig-ellipse.c
        * plug-ins/gfig/gfig-line.c
        * plug-ins/gfig/gfig-poly.c
        * plug-ins/gfig/gfig-spiral.c
        * plug-ins/gfig/gfig-star.c
        * plug-ins/gfig/gfig.c
        * plug-ins/gimpressionist/orientmap.c
        * plug-ins/gimpressionist/placement.c
        * plug-ins/gimpressionist/sizemap.c
        * plug-ins/imagemap/imap_grid.c
        * plug-ins/imagemap/imap_main.c
        * plug-ins/imagemap/imap_preferences.c
        * plug-ins/imagemap/imap_settings.c
        * plug-ins/maze/maze.c
        * plug-ins/sel2path/curve.c
        * plug-ins/sel2path/fit.c
        * plug-ins/sel2path/pxl-outline.c
        * plug-ins/sel2path/spline.c
        * plug-ins/xjt/xjt.c: Functions with no args should be declared
        with (void).

        * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
        the compiler.
2004-11-14 02:50:33 +00:00
Sven Neumann
9ac6ecef0a app/dialogs/Makefile.am new files for the Print Size dialog that is still
2004-11-13  Sven Neumann  <sven@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/print-size-dialog.[ch]: new files for the Print Size
	dialog that is still missing. Still work in progress...

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: integrate the new dialog.
2004-11-13 22:27:39 +00:00
Sven Neumann
1fdcd8bee8 allow a smaller brush radius to be set in the brush editor. Fixes bug
2004-11-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpbrusheditor.c: allow a smaller brush radius to
	be set in the brush editor. Fixes bug #157508.
2004-11-06 18:55:06 +00:00
Sven Neumann
ce7f034638 fixed most of the Reset functionality (bug #157495). The offset box is
2004-11-06  Sven Neumann  <sven@gimp.org>

	* app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of
	the Reset functionality (bug #157495). The offset box is still not
	working correctly.

	* app/widgets/gimpsizebox.c (gimp_size_box_update_resolution):
	check for availability of the size entry before accessing it.
2004-11-06 12:30:38 +00:00
Sven Neumann
a24047788c be more tolerant and silently skip entries that the dialog factory doesn't
2004-11-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c: be more tolerant and silently
	skip entries that the dialog factory doesn't recognize.

	* app/widgets/gimpdialogfactory.c: minor cleanup.
2004-11-04 21:02:34 +00:00
Michael Natterer
5d7b121fd7 Don't use deprecated GtkToolbar API in GimpTextEditor:
2004-11-04  Michael Natterer  <mitch@gimp.org>

	Don't use deprecated GtkToolbar API in GimpTextEditor:

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/text-editor-actions.[ch]
	* app/actions/text-editor-commands.[ch]: added acions and
	callbacks for the new "text-editor" action group.

	* app/menus/menus.c: register a "<TextEditor>" UI manager.

	* menus/Makefile.am
	* menus/text-editor-toolbar.xml: new file for the toolbar.

	* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
	UI manager instead of constructing it using deprecated API.

	* app/tools/gimptextoptions.c: changed accordingly.

	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
	(used by text-editor-commands.c).
2004-11-04 14:24:32 +00:00
Michael Natterer
40928bb578 use a GtkUIManager instead of a GtkItemFactory. Added virtual function
2004-11-04  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
	of a GtkItemFactory. Added virtual function ::get_action_type()
	and create the manager's actions manually using that action type
	instead of using gtk_action_group_add_actions().

	* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
	creates GimpActions (which can have a color attached) instead of
	GtkActions. Changed the menu item visibility and color preview
	code accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpitemfactory.[ch]: finally removed.

	* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
2004-11-04 12:15:49 +00:00
Michael Natterer
29de307128 don't forget to g_free(editor->segments).
2004-11-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't
	forget to g_free(editor->segments).
2004-11-03 14:31:51 +00:00
Michael Natterer
c568322c43 app/display/gimpscalecombobox.c (gimp_scale_combo_box_mru_remove_last)
2004-11-03  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpscalecombobox.c
	(gimp_scale_combo_box_mru_remove_last)
	* app/widgets/gimpeditor.c (gimp_editor_add_action_button)
	* app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.
2004-11-03 11:50:37 +00:00
Sven Neumann
c70b12137b plugged a mem-leak.
2004-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	plugged a mem-leak.

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_render): don't leak the pixbuf.

	* app/widgets/gimpviewrenderer-frame.c: added a comment.
2004-11-03 00:48:06 +00:00
Sven Neumann
caac418cb2 don't check for file_proc->menu_paths. Our load and save procedure don't
2004-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	don't check for file_proc->menu_paths. Our load and save procedure
	don't necessarily register a menu path any longer.

	* app/plug-in/plug-ins.c: minor cleanup.

	* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
	XCF load and save procedures.

	* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.

	* app/pdb/fileops_cmds.c
	* libgimp/gimpfileops_pdb.c: regenerated.
2004-11-01 15:44:57 +00:00
Sven Neumann
d254eaf3d5 set the active image. Fixes bug #156942.
2004-10-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimageeditor.c (gimp_image_editor_set_context):
	set the active image. Fixes bug #156942.
2004-10-31 11:46:00 +00:00
Sven Neumann
fcbe26d888 added a size entry to edit the resolution. This should close bug #151022.
2004-10-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.c: added a size entry to edit the
	resolution. This should close bug #151022.
2004-10-30 23:55:34 +00:00
Øyvind Kolås
ae30cacd28 addition of white balance in menus, and related code reorganization 2004-10-29 22:18:49 +00:00
Sven Neumann
a27b0bff1c app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load) only be verbose
2004-10-29  Sven Neumann  <sven@gimp.org>

        * app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load)
        * app/widgets/gimpclipboard.c (gimp_clipboard_init): only be
        verbose on request.

        * app/plug-in/plug-in.c (plug_in_close): turned warnings into
        messages and respect gimp->be_verbose.
2004-10-29 21:54:32 +00:00
Michael Natterer
4a4a1096d5 added foreign entries for the keyboard shortcut and the controller action
2004-10-29  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/dialogs.c (toplevel_entries): added foreign entries
	for the keyboard shortcut and the controller action dialogs.

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimpcontrollereditor.c: register the dialogs with
	the "toplevel" dialog factory so they remember their size and
	position.
2004-10-29 10:58:16 +00:00
Michael Schumacher
e718a6817c fixed a typo in #include "libgimpbase/gimpwin32-io.h"
2004-10-27  Michael Schumacher <schumaml@gmx.de>

	* app/widgets/gimpwidgets-utils.c: fixed a typo in
	#include "libgimpbase/gimpwin32-io.h"
2004-10-27 19:02:04 +00:00
Sven Neumann
4349469e3c changed menu label from "Show Image Menu" to "Show Image Selection".
2004-10-27  Sven Neumann  <sven@gimp.org>

	* app/actions/dockable-actions.c (dockable_toggle_actions): changed
	menu label from "Show Image Menu" to "Show Image Selection".

	* app/widgets/gimpsizebox.c: unmarked a string for translation.

	* app/dialogs/scale-dialog.c: added back the message when scaling
	an indexed image.
2004-10-27 15:59:52 +00:00
Sven Neumann
fffebe8ec2 app/dialogs/Makefile.am a wrapper around the scale dialog that takes care
2004-10-27  Sven Neumann  <sven@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale
	dialog that takes care verifying the user input and optionally
	asking for confirmation. Most of this moved out of image-commands.c.

	* app/actions/image-commands.c: use the new image scale dialog
	even though it doesn't allow to edit the resolution yet. That's a
	temporary regression that will get fixed soon.

	* app/actions/layers-commands.c: cosmetics.

	* app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the
	resolution.

	* app/widgets/gimpsizebox.c: fixed cut'n'paste error.
2004-10-27 01:20:07 +00:00
Sven Neumann
b0330f95d4 added a resolution label similar to one in the template editor. Prepared
2004-10-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.[ch]: added a resolution label similar
	to one in the template editor. Prepared for editable resolution,
	work in progress...

	* app/dialogs/scale-dialog.[ch]: added resolution and resolution
	unit parameters to ScaleDialogCallback.

	* app/actions/layers-commands.c: changed accordingly.
2004-10-26 23:31:34 +00:00
Sven Neumann
664b5a0a09 commented out the memory size label. The visual clutter of it's bold
2004-10-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: commented out the memory size
	label. The visual clutter of it's bold appearance was IMO not
	appropriate. I think the dialog is better without it.

	* app/widgets/gimpsizebox.c: added a pixel size label as in the
	Image New dialog.
2004-10-26 21:18:20 +00:00
Michael Natterer
2075f1e742 added parameter "const gchar *select_action" and preselect the passed
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.[ch] (gimp_action_view_new): added
	parameter "const gchar *select_action" and preselect the passed
	action if non-NULL. Made the column enum public to users of this
	widget can get data from its tree store.

	* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
	pass NULL because we don't want a preselected action here.

	* app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete"
	buttons to change the event -> action mapping. Implement a action
	chooser dialog using GimpActionView. Fixes bug #106920.
2004-10-26 15:10:00 +00:00
Sven Neumann
1ee62f771e app/actions/channels-commands.c app/core/gimpchannel-select.c
2004-10-26  Sven Neumann  <sven@gimp.org>

	* app/actions/channels-commands.c
	* app/core/gimpchannel-select.c
	* app/core/gimpimagefile.c
	* app/core/gimpundo.c
	* app/widgets/gimpcomponenteditor.c: use the new enum utility
	functions from libgimpbase instead of accessing enum_value->value_name.
2004-10-26 14:45:25 +00:00
Michael Natterer
ea1b88f580 app/widgets/Makefile.am app/widgets/widgets-types.h new widget built from
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollereditor.[ch]: new widget built from
	preliminary code from the prefs dialog. Prerequisite for finally
	fixing bug #106920.

	* app/dialogs/preferences-dialog.c: use the new widget.
2004-10-26 12:26:47 +00:00
Michael Natterer
6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Michael Natterer
e88a663631 app/actions/gradient-editor-commands.c irrelevant coding style and spacing
2004-10-25  Michael Natterer  <mitch@gimp.org>

	* app/actions/gradient-editor-commands.c
	* app/display/gimpdisplayshell-preview.c: irrelevant coding style
	and spacing cleanups.

	* app/widgets/gimpimageeditor.c: removed utility function
	gimp_image_editor_context_changed() and connect
	gimp_image_editor_set_image() directly using
	g_signal_connect_swapped().
2004-10-25 12:42:23 +00:00
Michael Natterer
df34354784 added gimp_text_buffer_save() which saves a GtkTextBuffer's contents to a
2004-10-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save()
	which saves a GtkTextBuffer's contents to a file.

	* app/widgets/gimperrorconsole.c: use
	gimp_editor_add_action_button() and removed all "clicked"
	callbacks, including all file saving code.

	* app/actions/error-console-actions.c
	* app/actions/error-console-commands.[ch]: added the code removed
	above to the action callbacks. Use gimp_text_buffer_save().
2004-10-24 22:26:11 +00:00
Michael Natterer
714771d450 app/widgets/gimpgradienteditor.[ch] added public APIs for zooming the
2004-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: added public APIs for
	zooming the editors. Use gimp_editor_add_action_button() to create
	all buttons. Removed all button callbacks and all duplicated
	button sensitivity logic.

	* app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update
	the editor's UI manager if it exists.

	* app/actions/gradient-editor-actions.c
	* app/actions/gradient-editor-commands.[ch]: added zoom actions
	and callback and call gimp_gradient_editor_zoom(). Fixed
	gradient_editor_actions_update() to actually set all items'
	sensitivity (it was possible to modify read-only gradients and
	even to crash GIMP).

	* app/actions/palette-editor-actions.c
	* app/actions/palette-editor-commands.[ch]: changed "new" and
	"zoom" actions to actually do their job instead of calling
	gtk_button_clicked(editor->foo_button).
2004-10-24 20:38:35 +00:00
Michael Natterer
8afbb733c7 removed the "Edit Color" dialog callbacks and use
2004-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.c: removed the "Edit Color"
	dialog callbacks and use gimp_editor_add_action_button() for
	the edit button. Removed button sensitivity logic. Hide the
	color dialog when the image's mode changes.

	* app/actions/colormap-editor-actions.c: added missing tooltip
	for the edit action.

	* app/actions/colormap-editor-commands.c: implement the dialog
	here.
2004-10-24 18:32:24 +00:00
Sven Neumann
ea273aadb9 libgimpthumb/gimpthumb-utils.[ch] libgimpthumb/gimpthumbnail.[ch] added
2004-10-23  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumbnail.[ch]
	* libgimpthumb/gimpthumb.def: added missing API, mainly for deleting
	thumbnails.

	* app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a
	failure thumbnail if one exists. Unless the thumbnail was created
	explicitely, remove all other thumbnails for this image.

	* app/actions/documents-commands.c: changed accordingly.

	* app/file/file-open.c: only save a thumbnail if there isn't a
	valid thumbnail already.

	* app/widgets/gimpthumbbox.c: before attempting to create a new
	thumbnail, check if there's an uptodate failure thumbnail.
2004-10-23 15:30:39 +00:00
Michael Natterer
6e9d0cfa5d added labels ("_Stroke") to the SLEECTION_STROKE and PATH_STROKE stock
2004-10-23  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
	SLEECTION_STROKE and PATH_STROKE stock items so they can be used
	in action areas.

	* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
	with "_Stroke" and reordered some code.

	* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
	of GTK_STOCK_OK. Added parameters to specify the dialog's title
	so it doesn't say "Stroke Options".

	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
	Path" as dialog titles.
2004-10-23 10:28:56 +00:00
Michael Natterer
fd6d30fd30 When there are variants of actions with and without dialog, let the
2004-10-23  Michael Natterer  <mitch@gimp.org>

	When there are variants of actions with and without dialog, let
	the dialog-less actions try to use the values from the last dialog
	invocation:

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
	actions to foo-new-last-values and use the last values entered in
	the dialogs.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
	the dialog on clicking "New" and call the last-values action on
	<shift>+click.

	* app/actions/select-actions.c
	* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
	to -last-values.

	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpvectorstreeview.c: stroke with last values on
	<shift> clicking the stroke buttons.
2004-10-23 00:53:48 +00:00
Michael Natterer
59bd430526 make sure the button_box is always interted at the very bottom of the
2004-10-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make
	sure the button_box is always interted at the very bottom of the
	editor.

	* app/widgets/gimpviewabledialog.c: changed the "description"
	property from CONSTRUCT_ONLY to CONSTRUCT.

	* app/widgets/gimpcolormapeditor.c: show the index of the edited
	color in the color dialog and use the correct icon. Replaced label
	"Hex triplet" by "HTML notation" to be consistent with the color
	dialog. Removed wrong 2 pixel border around the table below the
	preview.
2004-10-22 15:41:03 +00:00
Sven Neumann
341b6da981 app/actions/colormap-editor-actions.c app/actions/dialogs-actions.c
2004-10-22  Sven Neumann  <sven@gimp.org>

	* app/actions/colormap-editor-actions.c
	* app/actions/dialogs-actions.c
	* app/core/gimpimage-colormap.c
	* app/dialogs/convert-dialog.c
	* app/dialogs/dialogs.c
	* app/widgets/gimpcolormapeditor.c: use the term "Colormap"
	instead of "Indexed Palette". Fixes bug #155829.
2004-10-22 14:43:43 +00:00
Michael Natterer
14a2a2aa09 remember the param_spec with each radio button instead of with the
2004-10-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c: remember the param_spec with each
	radio button instead of with the box/frame around them.
2004-10-22 02:15:14 +00:00
Michael Natterer
c84475c989 moved "item_type" and "signal_name" from GimpItemTreeView to
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
	"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
	Removed them from gimp_item_tree_view_new(). Require the view_type
	instead of item_type in gimp_item_tree_view_new().

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpdrawabletreeview.c (get_type): made them
	abstract base classes.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c (class_init): set the
	item_type and signal_name members if GimpItemTreeViewClass.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2004-10-16 20:17:30 +00:00
Michael Natterer
ea1dc9ab9f added utility function gimp_ui_manager_get_action() which takes
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: added utility function
	gimp_ui_manager_get_action() which takes "group_name" and
	"action_name".

	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: use it.
2004-10-16 17:29:42 +00:00
Michael Natterer
f4d7260c64 app/actions/channels-actions.c app/actions/colormap-editor-actions.c
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/actions/channels-actions.c
	* app/actions/colormap-editor-actions.c
	* app/actions/documents-actions.c
	* app/actions/tool-options-actions.c
	* app/actions/vectors-actions.c: added more tooltips for actions
	which are used as extended dialog button callbacks.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
	the list of extended actions in reverse order.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: don't set the tooltips
	manually. Removes another bunch of insane translatable multiline
	format strings. Pass the extended actions in the right order
	to gimp_editor_add_action_button().
2004-10-16 17:10:04 +00:00
Michael Natterer
8effb0cfaf Ported the layers, channels and paths dialogs from
2004-10-16  Michael Natterer  <mitch@gimp.org>

	Ported the layers, channels and paths dialogs from
	gimp_editor_add_button() to gimp_editor_add_action_button(),
	removing a massive amount of duplicated code, sensitivity logic
	and confusing utility functions.

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: added "foo-new-default"
	actions and callbacks which create items without a dialog,
	optionally using default values from a passed template. Removed
	all public utility function that were passed as function pointers
	to widget construtors. Added tooltips to all actions which are now
	used for dialog buttons.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
	automatically create multi-line tooltips showing the modifiers for
	extended action buttons. Removes the need for lots of insane
	format strings that need to be translated correctly.

	* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
	replaced tooltip and help_id strings by action names.

	(struct GimpItemTreeView)
	(gimp_item_tree_view_new): removed "edit", "new" and "activate"
	function pointers.

	(gimp_item_tree_view_constructor): create all buttons
	with gimp_editor_add_action_button(), using the action names
	from GimpItemTreeViewClass.

	Removed tons of "clicked" callbacks and all code which sets the
	buttons' sensitivity. They are not needed any longer.

	Require all subclasses to implement GimpItemTreeView::new_item(),
	a new virtual function which creates a plain new item without
	showing a dialog.

	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: fill in the action names and
	implement GimpItemTreeView::new_item(). Removed all button
	sensitivity logic.

	* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
	include anything from actions/ any more.
2004-10-16 15:48:23 +00:00
Michael Natterer
e2fd8ab534 Fixed bug #155328:
2004-10-15  Michael Natterer  <mitch@gimp.org>

	Fixed bug #155328:

	* app/actions/vectors-actions.c (vectors_actions_update): don't
	set the "selection to path" actions sensitive if there is no
	image.

	* app/widgets/gimpitemtreeview.c: update the UI manager after
	setting the view's image. Connect to GimpImage::flush() and
	update the UI manager in the callback, too.
2004-10-15 12:27:07 +00:00
Sven Neumann
428a80a1ee removed the "Density" label. It wasn't helpful and caused the transform
2004-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c: removed the "Density" label.
	It wasn't helpful and caused the transform options to be wider than
	necessary.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptransformoptions.c: let combo boxes expand
	horizontally like we do in other (all ?) dialogs.

	* app/widgets/gimptemplateeditor.c
	(gimp_template_editor_aspect_callback): update the pixel size label.
2004-10-14 22:55:18 +00:00
Michael Natterer
27c2be7cea libgimpwidgets/gimpwidgets.c app/widgets/gimpenumwidgets.[ch]
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.c
	* app/widgets/gimpenumwidgets.[ch]
	* app/widgets/gimppropwidgets.c
	* app/actions/layers-commands.c
	* app/dialogs/convert-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinkoptions-gui.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: the child of a GimpFrame must
	not have any border width. Fixes many subtle misalignments.
2004-10-14 15:44:13 +00:00
Sven Neumann
0b6f4114d8 added "message" function to the GimpProgress interface. Call
2004-10-14  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added "message" function to the
	GimpProgress interface. Call gimp_message() if it is unimplemented.

	* app/plug-in/plug-in-progress.[ch]: added new function
	plug_in_progress_message() that passes the message to the current
	proc_frame's progress.

	* app/widgets/gimpthumbbox.c: implement GimpProgress::message.
	Just do nothing in the implementation. We don't want to see
	messages from file plug-ins that we use to create the thumbnails.

	* tools/pdbgen/pdb/message.pdb
	* app/pdb/message_cmds.c: if there's a current plug-in, dispatch
	the message by calling plug_in_progress_message().

	* app/display/gimpdisplayshell-close.c: fixed wrong types in
	function calls.
2004-10-14 15:15:03 +00:00
Michael Natterer
6030036fe2 use GIMP_HELP_COLOR_DIALOG as help_id.
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use
	GIMP_HELP_COLOR_DIALOG as help_id.
2004-10-14 14:34:01 +00:00
Michael Natterer
1e4203e665 register GimpConvertPaletteType with the type system.
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch]: register GimpConvertPaletteType with
	the type system.

	* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
	fixed to insert the widget at the right place in the radio box.

	* app/dialogs/convert-dialog.c: use enum widgets and
	gimp_enum_radio_frame_add(), resulting in a much better looking
	dialog with much less lines of code.
2004-10-14 13:44:06 +00:00
Kevin Cozens
f92848d2ef Fixed a spelling error.
2004-10-13  Kevin Cozens  <kcozens@cvs.gimp.org>

    * app/widgets/gimpactionview.c: Fixed a spelling error.
2004-10-13 21:51:40 +00:00
Sven Neumann
479e65e388 improved handling of parent widget; probably just being paranoid here.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagedialog.c: improved handling of parent
	widget; probably just being paranoid here.

	* app/actions/image-commands.c
	* app/dialogs/image-new-dialog.c: ported memory size confirmation
	dialogs to GimpMessageDialog.
2004-10-13 19:02:37 +00:00
Sven Neumann
2b2737f2ad handle parent widget not being a GtkWindow by calling
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagedialog.c: handle parent widget not being
	a GtkWindow by calling gtk_widget_get_toplevel().

	* app/actions/data-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c: ported more boolean queries to
	GimpMessageDialog.
2004-10-13 15:27:00 +00:00
Sven Neumann
8300c550e3 app/widgets/Makefile.am app/widgets/widgets-types.h added a simple message
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagedialog.[ch]: added a simple message
	dialog to avoid code duplication.

	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

	* app/dialogs/file-save-dialog.c
	* app/dialogs/quit-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 14:35:28 +00:00
Sven Neumann
8a5502f89e changed the description for GIMP_HELP_BROWSER_GIMP.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-enums.[ch]: changed the description for
	GIMP_HELP_BROWSER_GIMP.

	* app/dialogs/file-save-dialog.c:
	* app/widgets/gimphelp.c: use a GimpDialog embedding a
	GimpMessageBox instead of gimp_query_boolean_box which looks
	somewhat old fashioned.
2004-10-13 11:57:07 +00:00
Sven Neumann
6b489baaeb improved error messages on missing help browser plug-in.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: improved error messages on missing help
	browser plug-in.

	* libgimpthumb/gimpthumb-utils.c
	* libgimpthumb/gimpthumbnail.c: improved documentation.
2004-10-13 10:34:02 +00:00
Sven Neumann
280a497f48 ref the imagefile while creating the thumbnail.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref
	the imagefile while creating the thumbnail.

	* app/core/gimpimagefile.[ch]
	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved
	the tricky part about thumbnail creation into the new function
	gimp_imagefile_create_thumbnail_weak().
2004-10-12 23:25:19 +00:00
Sven Neumann
ab6c609ce1 renamed struct member "unit" to "resolution_unit".
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: renamed struct member "unit" to
	"resolution_unit".

	* app/actions/image-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-undo-push.c
	* app/dialogs/info-window.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimptoolbox-dnd.c:
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit()
	where appropriate.

	* app/core/gimptemplate.c (gimp_template_set_from_image): fixed
	unit handling. Don't touch the template unit, it is used as the
	initial display unit. This will need further changes...
2004-10-12 21:28:53 +00:00
Michael Natterer
fcc342b00b need to pack the widget expanding. Fixes pattern container entries.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
	need to pack the widget expanding. Fixes pattern container
	entries.
2004-10-12 20:37:50 +00:00
Sven Neumann
22a1384b5a app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.

	* app/widgets/gimppropwidgets.c: the order of setting the X and Y
	properties does matter.

	* app/dialogs/Makefile.am
	* app/dialogs/scale-dialog.[ch]: added first version of a new
	Scale dialog in an attempt to address bug #151022.

	* app/actions/layers-commands.c: use the new scale dialog.
2004-10-12 14:59:14 +00:00
Sven Neumann
5ae3d5952b added mnemonics for the size entries.
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: added mnemonics for the size
	entries.
2004-10-12 14:14:16 +00:00
Michael Natterer
eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Sven Neumann
b09225b1a1 use a larger icon size for GimpImagefile views.
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger
	icon size for GimpImagefile views.

	* themes/Default/images/stock-frame-64.png: removed the 1 pixel
	wide empty border around the frame.

	* app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values.
2004-10-12 10:37:11 +00:00
Sven Neumann
9adf514e7d tweaked table spacings to get the Height label aligned with the entry
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: tweaked table spacings to get
	the Height label aligned with the entry again.
2004-10-12 00:12:31 +00:00
Sven Neumann
3a81bf7314 set the "skip_taskbar_hint" and "skip_pager_hint" properties on the
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set
	the "skip_taskbar_hint" and "skip_pager_hint" properties on the
	progress window.
2004-10-11 23:29:32 +00:00
Sven Neumann
5460383b57 construct a case-insensitive glob pattern to use when filtering for file
2004-10-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
	pattern to use when filtering for file extensions.
2004-10-11 11:57:32 +00:00
Michael Natterer
1db1a19574 user-visible counting starts at 1, not 0.
2004-10-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
	user-visible counting starts at 1, not 0.
2004-10-11 11:27:26 +00:00
Sven Neumann
9203906065 libgimpthumb/gimpthumb-utils.[ch] added an API to delete thumbnails.
2004-10-11  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumb.def: added an API to delete thumbnails.

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail):
	when recreating a thumbnail on user request, delete all existing
	thumbnails for it.

	* plug-ins/common/AlienMap2.c: removed unused variable.
2004-10-10 23:02:34 +00:00
Sven Neumann
bfeb12d2bb handle NULL as viewable parameter as a workaround for bug #149906.
2004-10-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c (gimp_container_view_lookup):
	handle NULL as viewable parameter as a workaround for bug #149906.

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made
	the code more robust.

	* app/xcf/xcf-private.h
	* app/xcf/xcf.c: added a const qualifier.
2004-10-10 14:33:01 +00:00
Sven Neumann
dc539fda18 tweaked the text shown while updating the preview so that the dialog
2004-10-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.c: tweaked the text shown while
	updating the preview so that the dialog doesn't need to resize.
2004-10-08 22:33:07 +00:00
Sven Neumann
ec693d7b09 app/config/gimpcoreconfig.[ch] added new gimprc option
2004-10-08  Sven Neumann  <sven@gimp.org>

	* app/config/gimpcoreconfig.[ch]
	* app/config/gimprc-blurbs.h: added new gimprc option
	"thumbnail-filesize-limit" that allows to control the maximum
	filesize for automatic thumbnail creation.

	* app/dialogs/preferences-dialog.c: added a GUI for it, needs
	review.

	* app/core/gimpimagefile.[ch]: minor cleanups. Moved call to
	gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to
	 gimp_imagefile_save_thumbnail() to avoid it being called twice.

	* app/file/file-utils.[ch]: export utility function
	file_utils_find_proc_by_extension() that allows to check for a
	file plug-in by looking at the filename extension only.

	* app/widgets/gimpthumbbox.[ch]: automatically create or update
	thumbnails for image files with a known extension that are smaller
	than "thumbnail-filesize-limit".  Fixes bug #137176.
2004-10-08 19:29:33 +00:00
Sven Neumann
299dad1de3 invalidate the preview when the toggle buttons are used. Reported by
2004-10-08  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/apply_lens.c (lens_dialog): invalidate the
	preview when the toggle buttons are used. Reported by Olivier.

	* app/widgets/gimpview.c: minor cleanup.
2004-10-08 18:09:41 +00:00
Michael Natterer
57f9d32e56 Made the text options about two toolbox grid columns smaller. Addresses
2004-10-08  Michael Natterer  <mitch@gimp.org>

	Made the text options about two toolbox grid columns smaller.
	Addresses bug #122862.

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
	the number of digits of the property's max_val plus two as number
	of chars for the sizeentry'y spinbutton (instead of always 10 as
	before).

	* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
	has a minimal width of 150 pixels (eek). Set a silly small minimal
	width instead (the entry expands to the available width anyway).
2004-10-08 14:00:41 +00:00
Sven Neumann
de68f16e72 added some (disabled) debug output.
2004-10-07  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumbnail.c: added some (disabled) debug output.

	* app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve
	the size of the frame borders.

	* app/widgets/gimpthumbbox.c: don't set an arbitrary padding but
	exactly the size of the frame borders. Otherwise we get large
	thumbnails (scaled down) if we request normal sized ones.
2004-10-07 21:38:35 +00:00
Michael Natterer
da1a2de846 remember for which GdkDragContext the icon_widget was made.
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for
	which GdkDragContext the icon_widget was made.

	(gimp_dnd_data_drag_end): destroy the icon_widget only if it was
	created for this GdkDragContext. Fixes broken DND icon_widgets
	when dragging the same source again while the old icon_widget is
	still floating back from an unsuccessful drop. Fixes bug #139337.
2004-10-06 18:55:24 +00:00
Sven Neumann
94b427de98 added a help button.
2004-10-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: added a help button.
2004-10-04 22:25:04 +00:00
Sven Neumann
62b5c77c76 app/config/gimpguiconfig.[ch] added gimprc option "show-help-button".
2004-10-04  Sven Neumann  <sven@gimp.org>

        * app/config/gimpguiconfig.[ch]
        * app/config/gimprc-blurbs.h: added gimprc option "show-help-button".

        * app/dialogs/preferences-dialog.c: added a GUI for it.

        * app/dialogs/file-save-dialog.c
        * app/dialogs/image-new-dialog.c
        * app/dialogs/quit-dialog.c
        * app/display/gimpdisplayshell-close.c
        * app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
        dialogs.

        * libgimpbase/gimpprotocol.[ch]
        * libgimp/gimp.[ch]: added boolean "show_help_button" to the
        config message.

        * app/plug-in/plug-in-run.c: pass the new preference to the plug-in.

        * libgimpwidgets/gimpdialog.[ch]: added new function that allows to
        set whether new dialogs should get a help button added.

        * app/gui/gui.c
        * libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
        to the gimprc settings.
2004-10-04 16:21:52 +00:00
Sven Neumann
65f0c88485 replaced the obtrusive drop-shadow by a thin white frame with a subtle
2004-10-01  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/stock-frame-64.png: replaced the obtrusive
	drop-shadow by a thin white frame with a subtle shadow. Taken from
	a mockup done by Jimmac.

	* app/widgets/gimpviewrenderer-frame.c: changed the hardcoded
	offsets for the new frame image :(
2004-10-01 11:17:46 +00:00
Sven Neumann
872c5a83ae fixed brokeness I introduced with my last cleanup.
2004-09-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness
	I introduced with my last cleanup.
2004-09-29 23:31:05 +00:00
Michael Natterer
2c74680ef6 code review / cleanup.
2004-09-28  Michael Natterer  <mitch@gimp.org>

	* app/core/gimppalette.c: code review / cleanup.

	(gimp_palette_delete_entry): don't add "Black" when the last color
	gets removed, a palette can easily live with zero colors.

	* app/widgets/gimppaletteeditor.c
	(palette_editor_invalidate_preview): also update the entry which
	shows the palette_entry's name.
2004-09-28 14:59:55 +00:00
Michael Natterer
2b45c7a302 removed hack which strcmp()s the property name to figure the preview's
2004-09-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview):
	removed hack which strcmp()s the property name to figure the
	preview's border_width and use the container view's
	preview_border_width instead.
2004-09-28 11:24:48 +00:00
Sven Neumann
cfd2c9c367 added a hack to get rid of the border drawn around thumbnails in the "Open
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack
	to get rid of the border drawn around thumbnails in the "Open Recent"
	menu.
2004-09-27 23:31:46 +00:00
Sven Neumann
fadd9ca045 added some padding for the shadow frame to avoid scaling the thumbnail.
2004-09-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some
	padding for the shadow frame to avoid scaling the thumbnail.
2004-09-27 20:50:04 +00:00
Sven Neumann
e29c3cd230 quick fix for large previews 2004-09-27 19:51:28 +00:00
Sven Neumann
0527d02329 themes/Default/images/Makefile.am added a stock icon that shows a simple
2004-09-27  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-frame-64.png: added a stock icon
	that shows a simple drop shadow but could be exchanged for other
	image decorations.

	* libgimpwidgets/gimpstock.[ch]: register the new icon.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
	ugly code to draw a frame around a preview pixbuf.

	* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
	to the GimpViewRenderer class so it can be shared by all renderers.

	* app/widgets/gimpviewrendererimagefile.c: use the new functionality
	to draw a nice frame around imagefile previews.

	* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
2004-09-27 19:40:12 +00:00
Michael Natterer
24f8d7e7c2 cleanup.
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c: cleanup.

	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell.c
	* tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.

	* app/text/gimptext-bitmap.c
	* app/text/gimptext-parasite.c
	* app/text/gimptext-vectors.c
	* app/text/gimptext-xlfd.c
	* app/text/gimptext.c
	* app/text/gimptextlayer-xcf.c: include "text-types.h" instead
	of "text/text-types.h".

	* app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
	instead of GimpDataFactoryView.

	* app/pdb/paint_tools_cmds.c: regenerated.
2004-09-27 12:30:04 +00:00
Michael Natterer
96a27b59cf app/actions/brushes-actions.c app/actions/gradients-actions.c
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/brushes-actions.c
	* app/actions/gradients-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c: made the "foo-edit" actions
	GimpStringActions and pass the identifier of the editor dialog
	to the callback.

	* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
	show the editor dialog here instead of calling view->edit_func().

	* app/dialogs/dialogs-constructors.[ch]: removed the brush,
	gradient and palette edit_funcs.

	* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.

	* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
	member and parameters and create the edit button unconditionally.

	* app/widgets/gimpbrushfactoryview.[ch]
	* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpdataselect.[ch]: removed this class, it's not
	needed any longer.

	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
	and follow the edit_func removal.

	* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
	stuff.

	* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
2004-09-27 10:45:49 +00:00
Sven Neumann
ab269fc645 removed conversion to TempBuf. Instead implement
2004-09-27  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c: removed conversion to TempBuf.
	Instead implement GimpViewable::get_new_pixbuf by compositing the
	thumbnail on a checkerboard.

	* app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf
	struct member to pixbuf.
	(gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf()
	and render the pixbuf before falling back to the TempBuf preview.
	(gimp_view_renderer_render_pixbuf): new function that sets a
	pixbuf for the renderer and flushes the render_buffer.

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_render): render the pixbuf.

	* app/dialogs/dialogs-constructors.c: create the document history
	dockable with a zero borderwidth.
2004-09-26 23:44:24 +00:00
Sven Neumann
75a59c682d use the GIMP_CHECK_SIZE_SM define, not the enum value
2004-09-27  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use
	the GIMP_CHECK_SIZE_SM define, not the enum value
	GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!).

	* app/pdb/fileops_cmds.c: regenerated.

	* app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup.
2004-09-26 23:26:25 +00:00
Michael Natterer
692863b31c added "data" property.
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.[ch]: added "data" property.

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimppaletteeditor.c: pass the current data to
	g_object_new() so we never end up with initially empty editors.
2004-09-26 19:41:56 +00:00
Michael Natterer
db85b16927 added CONSTRUCT_ONLY "data-factory" property. Removed
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY
	"data-factory" property. Removed gimp_data_editor_construct().

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimppaletteeditor.c: pass the construct parameters
	to g_object_new().
2004-09-26 19:26:37 +00:00
Sven Neumann
07e65b01cd changed label alignment to be more HIG conformant and consistent with the
2004-09-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c: changed label alignment to be more
	HIG conformant and consistent with the rest of the user interface.
2004-09-26 19:15:51 +00:00
Michael Natterer
6a50c27047 added "name", "blurb", "stock_id" and "help_id" to struct
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added "name", "blurb",
	"stock_id" and "help_id" to struct GimpDialogFactoryEntry and to
	gimp_dialog_factory_dialog_register(). Added typedef
	GimpDialogConstructor which takes a GimpDialogFactoryEntry in
	addition to the parameters GimpDialogNewFunc takes. Added a
	constructor function pointer to GimpDialogFactory which defaults
	to a function that just returns entry->new_func(). Use that
	constructor instead of entry->new_func() for creating
	dialogs. Added public API gimp_dialog_factory_set_constructor().

	* app/dialogs/dialogs.c: register name, blurb, stock_id and
	help_id for all dockables so all the dialog info lives in one huge
	ugly table now. For the global_toolbox_factory and the
	global_dock_factory, set a constructor which creates a dockable
	around the widget returned by entry->new_func().

	* app/dialogs/dialogs-constructors.[ch]: don't create the dockable
	in each dialog constructor. Removes tons of code and reduces most
	constructors to a "return gimp_foo_new(...)" one-liner. Got rid of
	all static variables, they were from a time when GimpDialogFactory
	was unable to manage singletons.

	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not
	GimpDataEditor from gimp_foo_editor_new().

	* app/widgets/gimpdataeditor.c: minor cleanups.
2004-09-26 18:41:29 +00:00
Michael Natterer
f6a205f83f moved stuff from new() to init().
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolordialog.c: moved stuff from new() to init().
2004-09-26 18:22:29 +00:00
Michael Natterer
b4ea222c23 Ported GimpNavigationView to use actions for its buttons:
2004-09-26  Michael Natterer  <mitch@gimp.org>

	Ported GimpNavigationView to use actions for its buttons:

	* app/menus/menus.c (menus_init): register a <GimpNaviagaionEditor>
	UI manager containing the "view" action group.

	* app/actions/actions.c (action_data_get_foo): handle "data" being
	a GimpNavigationEditor.

	* app/actions/view-actions.c (view_actions): added tooltips for
	the actions used in the editor.

	(view_actions_update): use action_data_get_display() instead of
	checking the type of "data" manually.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
	a GtkToggleButton instead of GimpButton for GtkToggleActions.

	* app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
	parameter to the public constructor and removed all other
	parameters. Simplified gimp_navigation_editor_new_private() and
	use gimp_editor_add_action_button() instead of just add_button()
	for creating the buttons. Made gimp_navigation_view_set_shell()
	private. Update the UI manager when the shell zooms or scrolls.

	* app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
	pass the menu_factory to gimp_navigation_editor_new().

	Removed #includes which are not needed any more.
2004-09-26 15:21:44 +00:00
Sven Neumann
1b58ab567a removed trailing whitespace.
2004-09-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.h: removed trailing whitespace.
2004-09-25 20:59:36 +00:00
Michael Natterer
28f7c94dbf app/widgets/gimpcolormapeditor.[ch] app/widgets/gimphistogrameditor.[ch]
2004-09-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimphistogrameditor.[ch]
	* app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage"
	parameters from public constructors. They are all GimpImageEditor
	widgets which get their image via gimp_docked_set_context() and
	gimp_image_editor_set_image() later anyway. Fixes uglyness as well
	as problems where the editors had an image but no context, causing
	strange behavior in their foo_actions_update() functions.

	* app/dialogs/dialogs-constructors.c: changed accordingly. Removed
	redundant calls to gimp_dockable_set_context() on newly created
	dockables because they will get a context when added to their
	containers.
2004-09-25 12:48:41 +00:00
Michael Natterer
ed35eedb9f moved stuff from gimp_colormap_editor_new() to
2004-09-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.c: moved stuff from
	gimp_colormap_editor_new() to
	gimp_colormap_editor_init(). Untabified.
2004-09-25 11:25:49 +00:00
Sven Neumann
c58b176784 added resolution and image type information which is usually hidden in the
2004-09-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.[ch]: added resolution and image
	type information which is usually hidden in the Advanced Options.
2004-09-25 01:47:01 +00:00
Sven Neumann
f4b3d0918e added a label that shows the pixel size (as in the initial mockup done by
2004-09-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.[ch]: added a label that shows
	the pixel size (as in the initial mockup done by Jimmac).
2004-09-24 14:43:32 +00:00
Michael Natterer
ee5354e4b7 app/dialogs/Makefile.am removed...
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/color-dialog.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.

	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* app/actions/gradient-editor-commands.c
	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 20:41:40 +00:00
Michael Natterer
9ffc00be80 app/plug-in/Makefile.am removed... ...and added with a new name.
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-proc.[ch]: removed...
	* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.

	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.[ch]
	* app/plug-in/plug-in-progress.[ch]
	* app/plug-in/plug-in-rc.[ch]
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.[ch]
	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
	minor cosmetic cleanups.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2004-09-22 15:12:24 +00:00
Michael Natterer
10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
Sven Neumann
e0d0d7cff1 removed the prelit event box from the header frame, use a smaller font for
2004-09-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: removed the prelit event box
	from the header frame, use a smaller font for the subtitle,
	removed the separator.

	* app/dialogs/preferences-dialog.c: removed the prelit event box
	from the header frame. Perhaps we should have subtitles here with
	a more verbose description of the settings page?
2004-09-21 22:31:20 +00:00
Michael Natterer
37912655f2 For the sake of completeness, added a GUI for the hidden "Open as Layer"
2004-09-21  Michael Natterer  <mitch@gimp.org>

	For the sake of completeness, added a GUI for the hidden
	"Open as Layer" feature:

	* app/actions/file-actions.c
	* app/actions/file-commands.[ch]: added "file-open-as-layer"
	action and callback. Abuse the "gimage" field of GimpFileDialog to
	indicate layer opening (it's otherwise unused for file-open).

	* app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
	open the selected files as layers for that image.

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.

	* menus/image-menu.xml.in: added it to the menu.
2004-09-21 12:08:30 +00:00
Sven Neumann
69c5ce557d fixed handling of too many error messages.
2004-09-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
	handling of too many error messages.
2004-09-19 17:10:53 +00:00
Sven Neumann
c3ef897b10 Try to make floating selections more obvious:
2004-09-19  Sven Neumann  <sven@gimp.org>

	Try to make floating selections more obvious:

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): always display
	"Floating Selection" as the name for a floating selection.

	* app/core/gimpselection.c (gimp_selection_float): call the new
	layer "Selection" instead of "Floating Selection". This is what
	will be displayed if the FS is turned into a layer.

	* app/actions/layers-commands.c (layers_edit_layer_query): don't
	special case floating selections here.

	* app/core/gimplayer-floating-sel.c: cosmetics.
2004-09-19 16:56:03 +00:00
Michael Natterer
c9cac47fbe use gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.c
	(gimp_component_editor_renderer_update): use
	gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17 11:20:30 +00:00
Simon Budig
430c5f8170 Added a slider for the brush spacing to the brush editor. Should make it
2004-09-17  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.[ch]: Added a slider for the
	brush spacing to the brush editor. Should make it more obvious
	how to change it.
2004-09-17 10:31:34 +00:00
Michael Natterer
357dc2d777 depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.

	* app/gui/gui.c: changed accordingly.

	* app/sanity.c: ditto. Added check for GLib and put each check
	into its own utility function. Enabled #if 0'ed check for
	FreeType >= 6.2.7.

	* app/widgets/gimpactiongroup.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpselectiondata.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpwidgets-utils.c: removed workarounds for library
	versions we refuse to start with.
2004-09-16 14:31:39 +00:00
Michael Natterer
f338d93835 reverse order of DND dests so "text/uri-list" is preferred again after my
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
	order of DND dests so "text/uri-list" is preferred again after my
	DND change of 2004-06-29. Fixes dropping of multiple files.
2004-09-16 14:28:10 +00:00
Michael Natterer
0514ee4ba2 set the viewable renderer's "renderer" property to NULL when clearing the
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.[ch]: set the viewable
	renderer's "renderer" property to NULL when clearing the
	view to work around bug #149906.
2004-09-16 14:00:02 +00:00
Michael Natterer
186b590844 added help IDs for the drawable- and vectors-visible and -liked actions as
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
	vectors-visible and -liked actions as well as for the layer mask
	property action.

	* app/actions/drawable-actions.c
	* app/actions/vectors-actions.c: use them.

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: ditto. Use
	GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
	"paint_mode" by "mode" in all action and function/variable names
	because this is the layer mode, not a paint mode.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c: set the "activates-default"
	property on the name entry in all "New Foo" and "Edit Foo
	Attributes" dialogs except in the "New Layer" dialog.
	Addresses bug #148026.

	* menus/image-menu.xml.in: added a (commented out) layer
	properties menu containing all the new actions.
2004-09-15 15:06:08 +00:00
Michael Natterer
6a723efc4b app/actions/layers-actions.c added actions and callbacks
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: added actions and callbacks
	"layers-preserve-transparency" and
	"layers-paint-mode-first,last,previous,next". Update the "active"
	state of the recently added layer mask property actions in
	layers_actions_update().

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.[ch]: added actions and callbacks
	for "drawable-visible" and "drawable-linked". Fixes bug #152597.

	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
	and "vectors-linked").

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_preserve_button_toggled): flush the image
	so the new actions are updated. Compress preserve_trans undos.

	* menus/image-menu.xml.in: added the layer mask property actions
	to the Layers/Mask submenu.

	* menus/layers-menu.xml: reordered the mask property actions
	to have the same order as in the image menu.
2004-09-15 13:24:45 +00:00
Sven Neumann
b5f8fa24d8 improved the fix for bug #152662 and removed trailing whitespace.
2004-09-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_menu_position): improved the fix for bug
	#152662 and removed trailing whitespace.
2004-09-15 09:34:02 +00:00
Nathan Summers
8c4062f2b2 clamp the popup menu's Y position to the visible area of the GtkTreeView.
2004-09-15  Nathan Summers  <rock@gimp.org>

        * app/widgets/gimpcontainertreeview.c
        (gimp_container_tree_view_menu_position): clamp the popup menu's Y
        position to the visible area of the GtkTreeView.  Fixes #152662.
2004-09-15 05:55:56 +00:00
Michael Natterer
d62a3f0487 simplified the code which deals with the global_buffer's preview. The new
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbufferview.c: simplified the code which deals
	with the global_buffer's preview. The new buffer view renderer
	does the aspect ratio magic all by itself now.

	* app/actions/image-commands.h: removed trailing whitespace.
2004-09-14 12:19:16 +00:00
Michael Natterer
c450ca1858 app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
	which knows how to preserve a GimpBuffer's aspect ratio if the
	view's aspect ratio is different.

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_from_viewable_type): use it for viewables
	of type GimpBuffer. Fixes bug #152531
2004-09-14 12:06:28 +00:00
Michael Natterer
7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Sven Neumann
952cd37e00 simulate the behaviour of GNU gettext and look at the LANGUAGE environment
2004-09-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
	look at the LANGUAGE environment variable if the locale is not "C".
2004-09-13 12:19:34 +00:00
Simon Budig
4a75d7271e Added boolean parameter to gimp_dialog_factories_toggle to make it
2004-09-11  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
	gimp_dialog_factories_toggle to make it possible to ensure a visible
	toolbox.

	* app/actions/dialogs-commands.c: Use the new parameter to ensure
	toolbox visibility after the last image window closes.

	* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.

	Fixes bug #137057 (the discussion is in bug #152285)
2004-09-11 19:19:26 +00:00
William Skaggs
fe876df0ed Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimperrorconsole.c: fix typo
2004-09-10 15:38:17 +00:00
Michael Natterer
4b553f186c always call gdk_drag_status() before returning FALSE.
2004-09-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c
	(gimp_container_tree_view_drop_status): always call
	gdk_drag_status() before returning FALSE.

	(gimp_container_tree_view_drag_motion): never return FALSE, an
	impossible drop location is now reported by calling
	gdk_drag_status() above. Always returning TRUE makes sure
	gimp_container_tree_view_drag_leave() is called unconditionally
	and can remove the scroll_timeout set in drag_motion().

	Fixes bug #152193 and many other obscure DND crashes caused by the
	scroll_timeout being invoked after the widget is destroyed.
2004-09-10 12:20:16 +00:00
Michael Natterer
fa3f37e96e app/widgets/gimpviewrendererbrush.c app/widgets/gimpviewrendererdrawable.c
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimage.c
	* app/widgets/gimpviewrendererimagefile.c
	* app/widgets/gimpviewrendererlayer.c
	* app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.
2004-09-09 11:58:49 +00:00
Michael Natterer
d7fc14fbc8 use g_type_name(dialog_type) instead of just "pdb dialog" as name for the
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
	g_type_name(dialog_type) instead of just "pdb dialog" as name for
	the dialog's private context.
2004-09-09 11:48:45 +00:00
Michael Natterer
abf395c0cd renamed parameter "gboolean raise_if_found" to "return_existing" and added
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factory_dialog_new_internal): renamed parameter
	"gboolean raise_if_found" to "return_existing" and added
	additional parameter "gboolean present".

	(gimp_dialog_factory_dialog_new)
	(gimp_dialog_factory_dialog_raise)
	(gimp_dialog_factory_dockable_new): pass both parameters (passing
	"present" as "raise_if_found" was not quite correct).
2004-09-09 09:02:26 +00:00
Michael Natterer
d8a3c0c08c simplified the code that selects an image file by its URI.
2004-09-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
	simplified the code that selects an image file by its URI.
2004-09-07 10:45:36 +00:00
Simon Budig
20504d16a9 Added an indicator for generated brushes. Pretty straightforward,
2004-09-07  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpviewrendererbrush.c: Added an indicator for
	generated brushes. Pretty straightforward, suggestions for
	improvements are welcome.
2004-09-06 23:55:24 +00:00
Sven Neumann
4bfbd2c5c3 bumped version number to 2.1.5.
2004-09-05  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 2.1.5.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
	the image file, not only the folder it lives in. Fixes bug #151638.
2004-09-05 20:17:53 +00:00
Simon Budig
fe7eb34e6e Implement function to resize the image to contain all layers completely.
2004-09-05  Simon Budig  <simon@gimp.org>

	* app/core/gimpimage-resize.[ch]: Implement function to resize
	the image to contain all layers completely. Untabified.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: Make it available in the GUI.

	* tools/pdbgen/pdb/image.pdb: Make it available in the PDB.

	* app/pdb/image_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpimage_pdb.[ch]: regenerated.
2004-09-04 22:08:43 +00:00
Michael Natterer
1c045ca77e removed "Configure input devices" button. Fixes bug #150177.
2004-09-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdevicestatus.c: removed "Configure input
	devices" button. Fixes bug #150177.
2004-09-03 14:26:50 +00:00
Michael Natterer
2a67415c51 app/display/gimpdisplay.c gracefully handle progress calls after the
2004-09-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.c
	* app/widgets/gimpprogressdialog.c: gracefully handle progress
	calls after the widget is destroyed. Re-fixes bug #150194.
2004-09-01 15:26:48 +00:00
Sven Neumann
ce1370bb2e added a boolean parameter to gimp_dialog_factory_dialog_new() to let the
2004-09-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
	gimp_dialog_factory_dialog_new() to let the caller decide whether
	the window should be presented or not.

	* app/actions/dialogs-commands.c
	* app/actions/image-commands.c
	* app/actions/templates-commands.c
	* app/gui/gui-vtable.c
	* app/gui/gui.c
	* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
	gimp_dialog_factory_dialog_new() present the dialog if we need to
	change it after creation. This avoids annoying resizes, noticeable
	especially with the error dialog.
2004-08-31 22:41:15 +00:00
Sven Neumann
cd4154e142 app/widgets/gimpdockable.c converted tabs to spaces.
2004-08-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c
	* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
2004-08-31 21:29:30 +00:00
Michael Natterer
a3bb332214 emit "clicked" on the edit_button only if it exists and is sensitive.
2004-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdatafactoryview.c
	(gimp_data_factory_view_activate_item): emit "clicked" on the
	edit_button only if it exists and is sensitive. Fixes bug #151343.
2004-08-31 21:07:35 +00:00
David Odin
b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
Sven Neumann
7e9f0d4a71 applied a patch from Joao S. O. Bueno which adds an API that allows to
2004-08-28  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
	S. O. Bueno which adds an API that allows to make the scale widget
	of a GimpScaleEntry behave logarithmic. Fixes bug #149420.

	* app/widgets/gimpbrusheditor.c: use the new functionality for the
	radius control.
2004-08-28 16:57:37 +00:00
Sven Neumann
52bf83ee69 app/widgets/gimphelp-ids.h added a help-id for the image area.
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h
	* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
	help-id for the image area.
2004-08-28 10:57:24 +00:00
Michael Natterer
28e1f2a9da call gimp_container_editor_select_item() manually at construction time so
2004-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainereditor.c
	(gimp_container_editor_construct): call
	gimp_container_editor_select_item() manually at construction time
	so views show the initially selected object's state correctly
	(e.g. the brush spacing). Fixes bug #151227.
2004-08-27 17:38:57 +00:00
David Odin
ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin
5af63086ba GimpViewRendererVector is really derived from GimpViewRenderer and not
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
  really derived from GimpViewRenderer and not from GimpViewRendererDrawable.
2004-08-26 14:59:31 +00:00
David Odin
1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin
d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
David Odin
e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann
8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
Sven Neumann
80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
Sven Neumann
d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
Sven Neumann
6939d7ab90 added API to change the labels. Modeled after the proposed new API for
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
	Modeled after the proposed new API for GtkMessageDialog.

	* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 20:08:33 +00:00
David Odin
cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann
578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Sven Neumann
509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
Sven Neumann
c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
Manish Singh
83a94230ed app/widgets/gimpcellrendereraccel.c app/widgets/gimphistogrambox.c Get rid
2004-08-18  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimphistogrambox.c
        * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
2004-08-19 00:21:55 +00:00
Sven Neumann
0620ee069e no need to set a size_request here.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/gui/color-notebook.c: no need to set a size_request here.

	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.

	* libgimpwidgets/gimpcolorscales.c
	* modules/colorsel_cmyk.c: don't set a minimum width on the color
	scales. Improves behaviour for narrow color dockables.
2004-08-18 21:50:26 +00:00
Sven Neumann
2d5ee4485d define GIMP_HELP_DOCK_SEPARATOR.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.

	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: help-ids are never used directly,
	use the defines from app/widgets/gimphelp-ids.h instead.
2004-08-18 09:53:38 +00:00
William Skaggs
8e36dd8ffb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: add help-ids.
2004-08-17 17:46:48 +00:00
Sven Neumann
6543cfde20 fixed labels in CMYK mode. Fixes bug #150213.
2004-08-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
	labels in CMYK mode. Fixes bug #150213.
2004-08-16 07:24:42 +00:00
Michael Natterer
1437f52d63 make sure that all actions, even if they have no menu proxy, can be
2004-08-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
	make sure that all actions, even if they have no menu proxy, can
	be invoked by their accelerators. Fixes bug #149938.

	* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
	removed the same code here.

	* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
	function which disconnects from "accel_changed" of the accel_group
	before upchaining (== before emitting "destroy").

	The above changes make this one redundant, but since the crash in
	bug #149938 was triggered by "accel_changed" emitted in the middle
	of g_object_unref(tree_model), it feels better to be paranoic here
	(fiddling with objects in destruction is no fun).

	(gimp_action_view_accel_edited): don't warn if assigning the same
	accel to the same action again.

	(gimp_action_view_new): don't leak all accel_closures.
2004-08-12 20:04:19 +00:00
Michael Natterer
a8e599ebbf app/widgets/gimpcontainercombobox.[ch] when removing the last item from
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainertreeview.c: when removing the last item
	from the view, manually clear all GimpCellRendererViewables'
	"renderer" properties; otherwise we have stale GimpPreviewRenderers
	with still-refed viewables hanging around in the cells.
	Works around GTK+ bug #149906.
2004-08-11 14:07:35 +00:00
Michael Natterer
57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
Sven Neumann
846bacd905 app/gui/file-open-location-dialog.c increased horizontal size request to
2004-08-11  Sven Neumann  <sven@gimp.org>

	* app/gui/file-open-location-dialog.c
	* app/widgets/gimpprogressbox.c: increased horizontal size request
	to reduce resizing.
2004-08-10 23:37:06 +00:00
Michael Natterer
828b852e06 fixed annoying resizing when thumbnailing exactly one image.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
	fixed annoying resizing when thumbnailing exactly one image.
2004-08-10 22:34:45 +00:00
Michael Natterer
06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer
95607cce19 new function which works on all widgets in the dialog except the cancel
2004-08-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]
	(gimp_file_dialog_set_sensitive): new function which works on all
	widgets in the dialog except the cancel button.

	Remember if the active progress is cancelable and added two
	booleans "busy" and "canceled". Added GtkDialog::response()
	implementation which, if the dialog is busy, cancels the active
	progress and sets the dialog's "canceled" state.

	Moved the progress bar right above the action area so it is next
	to the cancel button and in the same place for both open and save
	dialogs.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: use the new API to make image loading
	and saving cancelable again.

	* app/widgets/gimpthumbbox.c: use the same stuff to make
	thumbnailing cancelable. Increased the minimum height a bit so it
	doesn't resize when the progress bars are shown.
2004-08-10 21:20:38 +00:00
Michael Natterer
02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Hans Breuer
eafd79de87 gimp_create_display() with the right parameters order
2004-08-09  Hans Breuer  <hans@breuer.org>

	* app/core/gimp-edit.c(gimp_edit_paste_as_new) :
	gimp_create_display() with the right parameters order

	* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
	handle gtk_style_lookup_icon_set() returnig NULL

	* app/gimpcore.def app/widgets/makefile.msc
	  themes/default/images/makefile.msc : updated
2004-08-08 22:47:23 +00:00
Michael Natterer
60fd11d79b Enabled previewing items without selecting them in all list and grid views
2004-08-05  Michael Natterer  <mitch@gimp.org>

	Enabled previewing items without selecting them in all list and
	grid views using mouse button 2. Implicitly enables previewing of
	items in container popups and thus fixes bug #121011:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event)
	* app/widgets/gimpcellrendererviewable.c
	(gimp_cell_renderer_viewable_clicked): show the preview also on
	mouse button 2 click.

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): dispatch mouse button 2
	clicks to GimpCellRendererViewable, but don't select or change
	anything in the tree_view.

	Unrelated cleanup:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event):
	don't offset bevent->x,y by widget->allocation.x,y before calling
	gimp_preview_popup_show() ...

	* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
	... instead, do it here generically (check if the parent widget is
	GTK_WIDGET_NO_WINDOW()).
2004-08-05 13:43:38 +00:00
Sven Neumann
50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer
fd1a0e142c Allow URI drops from apps linked against GLib < 2.4.4 to GIMP linked
2004-08-04  Michael Natterer  <mitch@gimp.org>

	Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
	linked against GLib >= 2.4.5. Fixes bug #148140.

	* app/core/gimp-utils.[ch]: added gimp_check_glib_version().

	* app/widgets/gimpselectiondata.c: added runtime check for GLib
	versions that encode file:// URIs correctly (>= 2.4.5). For older
	(broken) GLibs, leave the code path as is, for newer (fixed) ones,
	perform an additional check if the dropped URI is in the (broken)
	escaped-UTF-8 format and convert it to local filename encoding.

	* app/gui/gui.c: warn the user that non-ASCII filenames can't
	be used when linked against GLib 2.4.4.
2004-08-04 17:11:39 +00:00
Michael Natterer
0dabeab6cb #include "core/gimpimage-undo.h"
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 10:15:49 +00:00
Michael Natterer
8260cd69ce ref/unref the view around the calls to gimp_container_view_item_selected()
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c
	(gimp_container_grid_view_item_context): ref/unref the view around
	the calls to gimp_container_view_item_selected() and _item_context()
	because the former may destroy the view which leads to a crash
	when trying the latter. Fixes bug #148955.
2004-08-03 14:55:31 +00:00
Michael Natterer
b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Hans Breuer
3b3039148c build but *dont link* display-enums.obj, widget-enums.obj and
2004-07-31  Hans Breuer  <hans@breuer.org>

	* app/display/makefile.msc app/widgets/makefile.msc : build
	but *dont link* display-enums.obj, widget-enums.obj and
	gimpdisplayoptions.obj. They must be in the dll
	* app/makefile.msc : build gimp.exe and gimp-console.exe both
	using the same gimp-core.dll
	* app/gimpcore.def : new file, exports for gimp-core.dll
	* app/Makefile.am : added to EXTRA_DIST

	* cursors/makefile.msc : new file to create gimp-tool-cursors.h
	* cursors/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc : updated

	* app/main.c app/app_procs.c : moved code to close the console
	from the former to the later. It only is to be used if The Gimp
	is not build as console app.

	* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
	drawable twice
	* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
	crashing on File/Import
2004-08-01 20:51:12 +00:00
Simon Budig
b05f9f4b60 Fixed oversight that accidentially reset the number of spikes to 2.
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
	reset the number of spikes to 2.
2004-08-01 18:09:41 +00:00
Simon Budig
1eb3009f1a Added optional spikes for the generated brushes, enabling star shaped
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
	the generated brushes, enabling star shaped generated brushes.

	* app/widgets/gimpbrusheditor.[ch]: GUI for this.

	* app/core/gimpbrush.c: changed accordingly.
2004-08-01 17:20:00 +00:00
Simon Budig
c40e29399d app/core/core-enums.h Implement three different brush shapes for generated
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/core-enums.h
	* app/core/gimpbrushgenerated.[ch]: Implement three different
	brush shapes for generated brushes.

	* app/core/gimpbrush.c: changed accordingly.
	* app/core/core-enums.c: regenerated.

	* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
	* themes/Default/images/stock-brush-generated-*-16.png: New stock
	icons for the brush shapes.

	* themes/Default/images/Makefile.am
	* libgimpwidgets/gimpstock.[ch]: changed accordingly

	untabified the files touched.
2004-08-01 03:06:58 +00:00
Sven Neumann
26a4b20dfe always do the check for perl and use the substituted perl executable name
2004-07-30  Sven Neumann  <sven@gimp.org>

	* configure.in: always do the check for perl and use the
	substituted perl executable name in the call for gimp-mkenums.
	Fixes the build on platforms where perl is not available as
	/usr/bin/perl. Closes bug #148813.

	* app/widgets/gimpenumstore.c: added missing include.
2004-07-30 20:42:53 +00:00
Sven Neumann
c6cbd6d335 Applied a bunch of AIX portability fixes (bug #148813):
2004-07-30  Sven Neumann  <sven@gimp.org>

	Applied a bunch of AIX portability fixes (bug #148813):

	* configure.in: when testing for Xmu library, link with -lXt -lX11.

	* app/gui/tips-parser.c
	* app/gui/user-install-dialog.c
	* app/tools/tools-enums.h
	* app/widgets/gimpdasheditor.c
	* app/widgets/widgets-enums.h
	* libgimpthumb/gimpthumb-error.h
	* libgimpwidgets/gimpcolorbutton.c
	* plug-ins/common/edge.c: removed trailing commas from enums.

	* plug-ins/common/snoise.c

	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 00:57:22 +00:00
Sven Neumann
e10ebe1805 removed enums GimpImageType and GimpImageBaseType ...
2004-07-29  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h: removed enums GimpImageType and
	GimpImageBaseType ...

	* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
	all enums from gimpbasetypes.h to this new file.

	* libgimpbase/Makefile.am
	* tools/pdbgen/Makefile.am: changed accordingly.

	* app/core/core-enums.c
	* libgimp/gimpenums.h
	* libgimpbase/gimpbaseenums.c
	* tools/pdbgen/enums.pl: regenerated.

	* libgimpbase/gimpparasite.c
	* libgimpbase/gimpprotocol.c
	* libgimp/gimp.c: include <glib-object.h>

	* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
	translation domain on a GType. This is used for translatable enum
	values.

	* libgimpbase/gimputils.[ch]: added API to retrieve the translated
	name for an enum value.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
2004-07-29 12:33:15 +00:00
Michael Natterer
ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Michael Natterer
9a153f6e58 forgot to strip mnemonics here.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_set_action_label): forgot to strip mnemonics
	here.
2004-07-27 22:38:40 +00:00
Michael Natterer
210ef45abb Enabled disabling all menu mnemonics. Addresses bug #120034:
2004-07-28  Michael Natterer  <mitch@gimp.org>

	Enabled disabling all menu mnemonics. Addresses bug #120034:

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added boolean RESTART property
	"menu-menonics".

	* app/gui/preferences-dialog.c: added a GUI for it.

	* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
	property "mnemonics".

	(gimp_action_group_add_*_actions): call gimp_strip_uline() on
	the actions' labels if mnemonics is FALSE.

	* app/widgets/gimpactionfactory.[ch]
	* app/actions/actions.c: pass gui_config->menu_menmonics to
	all action groups.
2004-07-27 22:17:30 +00:00
Sven Neumann
bd427b2e4d libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def
2004-07-27  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbase.def
	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
	related functions (moved here from gimputil.c) and
	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
	app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimpbase-private.c
	* libgimp/gimptile.c
	* libgimp/gimpunitcache.c
	* plug-ins/help/domain.c
	* app/xcf/xcf-read.c: need to include glib-object.h.

	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

	* app/config/gimpconfig-types.[ch]: removed code that lives in
	libgimpbase now.

	* app/config/gimpconfig-deserialize.c: changed accordingly.

	* app/config/gimpbaseconfig.c
	* app/config/gimpdisplayconfig.c
	* app/core/gimpcontext.c
	* app/gui/grid-dialog.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
	any longer.
2004-07-27 16:39:00 +00:00
Sven Neumann
7e3e851c63 string change.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
2004-07-27 12:41:44 +00:00
Michael Natterer
a66a3b47c9 make sure we always set a non-null URI.
2004-07-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
	sure we always set a non-null URI.
2004-07-27 12:39:56 +00:00
Sven Neumann
67ff4473a2 app/widgets/gimphelp-ids.h removed unused help IDs GIMP_HELP_FILE_OPEN_XCF
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h removed unused help IDs
	GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
	for these entries are generated from the procedure names.
2004-07-27 12:28:30 +00:00
Sven Neumann
228aadc25c print the help-id and help-domain to stdout if gimp was started with the
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help): print the help-id and
	help-domain to stdout if gimp was started with the --verbose
	command-line option.
2004-07-27 11:19:33 +00:00
Sven Neumann
a1ac37ed19 show extensions in the filters menu.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	show extensions in the filters menu.
2004-07-27 00:26:14 +00:00
Sven Neumann
744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00
Michael Natterer
a2b85a62b0 new function which clears the whole list of data set by plug-ins.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
	function which clears the whole list of data set by plug-ins.

	(procedural_db_free): use it.

	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.[ch]: added action, callback and
	confirmation dialog for "Reset all filters to default values".
	Somehow addresses bug #81015.

	* app/widgets/gimphelp-ids.h: added a help ID for the new action.

	* menus/image-menu.xml.in: added it to the "Filters" submenu.
2004-07-26 21:07:15 +00:00
Michael Natterer
caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00
Sven Neumann
b50ea15b26 rephrased the text for the dialog that appears if a new shortcut collides
2004-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactionview.c: rephrased the text for the dialog
	that appears if a new shortcut collides with an existing one.

	* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
	which accepts RGB colors in hexadezimal notation or as SVG color
	keywords.
2004-07-22 12:42:57 +00:00
Michael Natterer
a5760e33fe connect to "accel-changed" of the accel_group using connect_object(), not
2004-07-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
	"accel-changed" of the accel_group using connect_object(), not
	just connect() so we don't crash when it's emitted after the
	toolbox is destroyed.
2004-07-22 11:18:52 +00:00
Michael Natterer
a80977b0bc app/widgets/gimptemplateeditor.c plug-ins/common/gif.c set GTK_SHADOW_IN
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptemplateeditor.c
	* plug-ins/common/gif.c
	* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
	text views. Fixes bug #148025.
2004-07-21 16:29:29 +00:00
Michael Natterer
cc6288a4fb Enabled the various "Clear saved foobar now" buttons in prefs:
2004-07-21  Michael Natterer  <mitch@gimp.org>

	Enabled the various "Clear saved foobar now" buttons in prefs:

	* app/gui/session.[ch]
	* app/menus/menus.[ch]
	* app/widgets/gimpdevices.[ch]: implemented the _clear()
	functions: unlink() the rc file and set an internal flag that it
	has been deleted. Added "gboolean always_save" parameter to the
	_save() functions and don't save anything if it is FALSE and the
	internal deletion flag has been set.

	* app/gui/gui.c
	* app/widgets/gimpdevicestatus.c: changed accordingly.

	* app/gui/preferences-dialog.c: added callbacks for all "Save now"
	and "Clear now" buttons and show error messages if clearing fails.
	Inform the user that she has to restart GIMP to see the effect of
	the clearing.
2004-07-21 16:11:31 +00:00
Michael Natterer
e7479951b5 app/core/gimpmarshal.list added "gboolean delete" parameter to the
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
	parameter to the GimpCellRendererAccel::accel_edited() signal.

	* app/widgets/gimpactionview.c: distinguish between deletion of an
	accelerator and the user entering an invalid accelerator.
2004-07-21 14:09:36 +00:00
Michael Natterer
b241a40b43 remember the keyboard shortcut dialog and show it only once.
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/gui/preferences-dialog.c: remember the keyboard shortcut
	dialog and show it only once.

	* app/widgets/gimpactionview.c
	* app/widgets/gimpcellrendereraccel.c: minor cleanups.

	Seems to work pretty well now and thus fixes bug #142922.
2004-07-21 11:28:31 +00:00
Michael Natterer
62bf62a151 app/core/gimpmarshal.list app/widgets/Makefile.am
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
	which displays an accelerator and allows to edit it (ripped
	out of libegg and modified).

	* app/widgets/gimpactionview.c: use the new renderer and connect
	to its "accel-edited" signal (its callback is one huge mess that
	needs to be cleaned up). Added ugly hack to work around GTK+ API
	limitation that seems to prevent implementing a shortcut editor in
	a sane way.

	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/tools-actions.c: added ugly hacks here, too.

	* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
	editor by Close.
2004-07-21 00:39:46 +00:00
Michael Natterer
94fc8f15a1 app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties
2004-07-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionfactory.[ch]
	* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
	properties to GtkActionGroup and allow to register them in the
	GimpActionFactory.

	* app/actions/actions.c: register user visible labels and icons
	with all action groups.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactionview.[ch]: new widget which shows a
	treeview of action groups and their actions & shortcuts.

	* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
	utility function.

	* app/widgets/gimpwidgets-utils.[ch]: added
	gimp_get_accel_string() utility function.

	* app/widgets/gimpcontrollers.[ch]: added
	gimp_controllers_get_ui_manager() which will be used for setting
	up the controller mapping dialog.

	* app/gui/preferences-dialog.c: added a "Configure Keyboard
	Shortcuts" button which pops up a GimpControllerView. Work in
	progress...
2004-07-20 18:50:20 +00:00
Michael Natterer
28b3fd4a74 reordered and commented to match API docs.
2004-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h: reordered and commented to match
	API docs.
2004-07-19 12:08:37 +00:00
Michael Natterer
09c6ee7363 added the removed help IDs back.
2004-07-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added the removed help IDs back.

	* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
	IDs and added gimp_file_proc_view_get_help_id() which returns the
	selected item's help ID.

	* app/widgets/gimpfiledialog.c: added a custom help func which
	shows the help for the selected file_proc if the proc_view has the
	focus.
2004-07-17 19:53:05 +00:00
Sven Neumann
d95059db48 use GIMP_STOCK_WEB for "file-open-location".
2004-07-17  Sven Neumann  <sven@gimp.org>

	* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
	for "file-open-location".

	* app/widgets/gimpfiledialog.c: create the scrolled window with
	shadow_type GTK_SHADOW_IN.

	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
	procedures that register a prefix (the URL loader).

	* app/widgets/gimphelp-ids.h: removed help IDs that used to be
	used from the file-open and file-save menus.

	* plug-ins/common/xwd.c (query): "X window dump" seems to be more
	appropriate than "X window image".
2004-07-17 13:06:59 +00:00
Sven Neumann
5222925694 sort the file procedures by their menu labels.
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
	by their menu labels.

	* app/widgets/gimpfileprocview.c: removed the sort function here.
2004-07-16 21:47:06 +00:00
Sven Neumann
ccf8ed69e7 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfileprocview.[ch]: added new widget that offers
	a treeview on file procedures.

	* app/widgets/gimpfiledialog.[ch]: replaced the file type option
	menu with the new GimpFileProcView widget.
	(gimp_file_dialog_set_image): reset the file type to Automatic
	(fixes bug #141535).

	* app/actions/file-commands.c
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]: changed accordingly.

	* plug-ins/common/bz2.c
	* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
	extension. It's redundant and breaks the code that sets the
	extension from the selected file-type.

	* plug-ins/common/dicom.c: register a shorter menu label.

	* plug-ins/common/gbr.c
	* plug-ins/common/gih.c
	* plug-ins/common/pat.c
	* plug-ins/common/url.c: register stock icons.
2004-07-16 21:24:39 +00:00
Michael Natterer
fe9d9be66b Code review & cleanup:
2004-07-14  Michael Natterer  <mitch@gimp.org>

	Code review & cleanup:

	* app/config/gimpguiconfig.[ch]: removed transparency-size,
	transparency-type and snap-distance properties...

	* app/config/gimpdisplayconfig.[ch]: ...and added them here.

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
	"max_memsize" parameter instead of looking it up in GimpGuiConfig.

	* app/actions/image-commands.c: changed accordingly.

	* app/core/gimparea.c
	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
	GimpProjectionIdleRender, reordered functions, cleanup.

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.c: removed unused #includes.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-close.c: renamed
	shell->warning_dialog to shell->close_dialog, some random
	cleanups.

	* app/display/gimpdisplayshell-handlers.c
	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-14 10:31:59 +00:00
Michael Natterer
54cc251b08 app/core/Makefile.am app/core/core-types.h new interface which has
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppickable.[ch]: new interface which has
	get_image_type(), get_tiles() and get_color_at() methods.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimagemap.[ch]
	* app/core/gimpprojection.[ch]: implement GimpPickableInterface
	and removed public get_colot_at() functions.

	* app/core/gimpimage-pick-color.[ch]: removed typedef
	GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
	gimp_pickable_pick_color() instead.

	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-crop.c
	* app/gui/info-window.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpselectioneditor.c: use GimpPickable functions
	instead of the various get_color_at() functions. Simplifies code
	which has a "sample_merged" boolean. Various cleanups.
2004-07-13 23:04:05 +00:00
Michael Natterer
c5ec0d4f70 *** empty log message *** 2004-07-13 16:36:29 +00:00
Michael Natterer
d41e45b1f4 added a preview of the global buffer.
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbufferview.[ch]: added a preview of the global
	buffer.
2004-07-12 20:25:05 +00:00
Michael Natterer
da74f1269e app/core/gimpundo.[ch] app/core/gimpitemundo.[ch] removed all _new()
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpundo.[ch]
	* app/core/gimpitemundo.[ch]
	* app/text/gimptextundo.[ch]: removed all _new() functions and
	added properties and GObject::constructor() implementations
	instead.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
	"GType undo_gtype" parameter and allow to pass name-value pairs as
	"...". Une the new GParameter utility functions to construct the
	appropriate undo step with g_object_newv().

	(gimp_image_undo_push_item): removed.

	(gimp_image_undo_push_undo): removed. Merged its code back into
	gimp_image_undo_push(), where it originally came from.

	* app/core/gimpimage-undo-push.c
	* app/core/gimpundostack.c
	* app/paint/gimppaintcore-undo.c
	* app/tools/gimptransformtool-undo.c
	* app/widgets/gimpundoeditor.c: changed accordingly.
2004-07-12 16:59:36 +00:00
Michael Natterer
5b83b759d7 set/unset the busy cursor on all windows which have widget->window, not
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factories_set_busy_foreach)
	(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
	cursor on all windows which have widget->window, not only for
	those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
	dialogs are hidden while the busy cursor is active and later shown
	again.
2004-07-12 11:47:54 +00:00
Hans Breuer
b56eb39ead updated app/actions/makefile.msc app/menus/makefile.msc : (new files)
2004-07-11  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated
	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
	  app/widgets/gimppropwidgets.c : bumped compiler version check,
	msvc6 still can't cast from unsigned __int64 to double

	* app/actions/debug-actions.c : only use debug_*_callback
	and thus debug_action if ENABLE_DEBUG_MENU

	* app/core/gimpalette-import.c : added gimpwin32-io.h

	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

	* plug-ins/common/screenshot.c : make it compile with msvc,
	but still no win32 specific implementation ...
2004-07-11 21:53:17 +00:00
Philip Lafleur
3a5019b270 Applied a patch from Robert Robert Ögren, moved here from
2004-07-11  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied
	a patch from Robert Robert Ögren, moved here from
	toolbox_check_device() - Only change devices if the event came from
	a widget that accepts extension events. Fixes bug #115774.
2004-07-11 03:01:05 +00:00
Michael Natterer
2176afbbbb Removed any remaining GUI dependency from the PDB wrappers:
2004-07-10  Michael Natterer  <mitch@gimp.org>

	Removed any remaining GUI dependency from the PDB wrappers:

	* app/core/gimp.[ch]: added vtable entries for the display and
	help stuff.

	* app/widgets/gimphelp.[ch]: renamed gimp_help() to
	gimp_help_show().

	* app/gui/gui-vtable.c: implement the new display and help vtable
	entries.

	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/display.pdb
	* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
	object instead of using stuff from display/ and widgets/.

	* tools/pdbgen/app.pl: removed bad hacks which enabled including
	stuff from gui/, display/ and widgets/.

	* app/Makefile.am: link widgets-enums.o, display-enums.o and
	gimpdisplayoptions.o into the gimp-console binary because they are
	needed for the config system and don't depend on any GUI stuff.

	* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/

	* app/pdb/display_cmds.c
	* app/pdb/help_cmds.c: regenerated.
2004-07-10 20:29:11 +00:00
Michael Natterer
8d9e362249 app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch]
2004-07-09  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/brush-select.[ch]
	* app/gui/font-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppdbdialog.[ch]
	* app/widgets/gimpdataselect.[ch]
	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]
	* app/widgets/gimpfontselect.[ch]: ...and added here as a
	hierarchy of widgets.

	* app/widgets/gimpdatafactoryview.h: removed typdef
	GimpDataEditFunc, it's in widgets-types.h now.

	* app/gui/convert-dialog.c: changed accordingly.

	* app/core/gimp.[ch]: added vtable entries for creating, closing
	and setting PDB dialogs.

	* app/gui/gui-vtable.c: implement the vtable entries using the new
	widgets.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
	the Gimp object to create / manage the selection dialogs. The
	generated files don't depend on GUI stuff any longer.

	* app/pdb/brush_select_cmds.c
	* app/pdb/font_select_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/palette_select_cmds.c
	* app/pdb/pattern_select_cmds.c: regenerated.
2004-07-09 19:14:59 +00:00
Sven Neumann
458ea9a50e reverted my last change. (gimp_histogram_editor_item_visible): fix the
2004-07-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_menu_update): reverted my last change.
	(gimp_histogram_editor_item_visible): fix the problem here instead.
2004-07-08 22:45:36 +00:00
Michael Natterer
788ae2fd5f removed "role" property because GtkWindow has an equivalent property now.
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpdialog.c: removed "role" property because
	GtkWindow has an equivalent property now. Added "help-func" and
	"help-id" construct properties.

	* app/widgets/gimptexteditor.c
	* app/widgets/gimptooldialog.c
	* app/widgets/gimpviewabledialog.c: removed calls to
	gimp_help_connect() and pass help_func and help_id to
	g_object_new().
2004-07-08 21:57:05 +00:00
Sven Neumann
1746c311e7 set the active item of the combo-box after changing the visibility filter.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_menu_update): set the active item of the
	combo-box after changing the visibility filter.
2004-07-08 13:23:27 +00:00
Michael Natterer
c8d9457f07 same fix as below.
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
	same fix as below.
2004-07-08 13:17:06 +00:00
Sven Neumann
822db32134 block gimp_prop_enum_combo_box_callback() before changing the combo-box.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
	block gimp_prop_enum_combo_box_callback() before changing the
	combo-box.
2004-07-08 12:50:15 +00:00
Sven Neumann
8bc46f69f3 only write aux-info for properties that have been changed from their
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c: only write aux-info for properties
	that have been changed from their default values.

	* app/widgets/gimphistogrameditor.c: some code cleanup.
2004-07-08 12:04:15 +00:00
Michael Natterer
d18097028e added a "const gchar *format" parameter to
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
	parameter to gimp_selection_data_set_pixbuf() which selects the
	format in which to encode the pixbuf (was defaulting to "png"
	before).

	* app/widgets/gimpclipboard.c: when copying, offer all formats which
	are savable with GdkPixbuf. Added a GimpClipboard struct which is
	attached to the Gimp and which stores all the persistent data
	needed by the clipboard. Renamed some private functions.

	(unfortunately this change breaks pasting to AbiWord:
	 http://bugzilla.abisource.com/show_bug.cgi?id=7068)
2004-07-08 11:27:48 +00:00
Sven Neumann
a4ac4de072 app/config/gimpconfig-deserialize.c removed redundant casts.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-serialize.c: removed redundant casts.

	* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
	get and set aux-info based on object properties.

	* app/widgets/gimphistogrameditor.c: use the new functions to save
	a histogram's channel and scale in the sessionrc.
2004-07-08 00:09:41 +00:00
Sven Neumann
73b1182c80 sort the list of pixbuf formats so that PNG is the preferred format and
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
	that PNG is the preferred format and GIF and JPEG come last.
2004-07-07 18:09:14 +00:00
Michael Natterer
94163a8beb changed to allow pasting any GdkPixbuf supported format (makes pasting
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
	GdkPixbuf supported format (makes pasting from OpenOffice
	work). Cleaned up a bit to perpare pasting of SVG data.
2004-07-07 16:02:23 +00:00
Michael Natterer
8fc8cb487c app/gui/Makefile.am removed...
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/clipboard.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/gimpclipboard.[ch]: ...and added here.

	* app/actions/edit-commands.c
	* app/gui/gui.c: changed accordingly.
2004-07-07 14:38:23 +00:00
Sven Neumann
2d412472c2 fixed a drawing bug I introduced earlier today.
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
	fixed a drawing bug I introduced earlier today.
2004-07-07 01:59:33 +00:00
Sven Neumann
ef885f7691 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes bug
2004-07-06  Sven Neumann  <sven@gimp.org>

	Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
	bug #145401.

	* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
	it to the PDB.

	* app/base/gimphistogram.c: implemented histogram functions for
	the RGB mode.

	* app/base/levels.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimphistogrameditor.c: handle the new enum value.

	* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
	draw a histogram that shows the RGB channels simultaneously
2004-07-06 16:33:30 +00:00
Michael Natterer
fa668df1ee call gtk_menu_set_monitor() only for GTK+ < 2.4.4 and added a #warning
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
	(gimp_button_menu_position): call gtk_menu_set_monitor() only
	for GTK+ < 2.4.4 and added a #warning about it.
2004-07-06 15:05:47 +00:00
Michael Natterer
3b7fc27b5e queue an idle update when setting the viewable to NULL so the view gets
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppreviewrenderer.c
	(gimp_preview_renderer_set_viewable): queue an idle update when
	setting the viewable to NULL so the view gets cleared correctly.

	(gimp_preview_renderer_idle_update): call
	gimp_preview_renderer_update() even if renderer->viewable is NULL
	so clearing the viewable gets propagated to the GUI.

	Moved clearing the viewable and removing the idle from
	GObject::finalize() to GObject::dispose() because calling
	set_viewable() with a NULL viewable triggers typechecking casts
	and queuing idle functions, which is not nice in finalize().
2004-07-06 13:18:42 +00:00
Sven Neumann
d5724ff596 return the proper type.
2004-07-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
	return the proper type.
2004-07-06 10:54:46 +00:00
Michael Natterer
960c32e94a connect to "editing-canceled" of the name cell renderer and restore the
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.c: connect to
	"editing-canceled" of the name cell renderer and restore the
	original text in the callback. Doesn't work reliably until GTK+
	bug #145463 is fixed.
2004-07-05 22:50:38 +00:00
Michael Natterer
49a46c76a0 removed unused local variables.
2004-07-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptemplateview.c
	(gimp_template_view_tree_name_edited): removed unused local variables.
2004-07-05 14:57:22 +00:00
Simon Budig
e7af53b0d3 app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c
2004-07-04  Simon Budig  <simon@gimp.org>

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/preferences-dialog.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdeviceinfo.c
	* app/widgets/gimpitemtreeview.c
	* plug-ins/imagemap/imap_selection.c
	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
	CVS compile with gcc 2.95 again. Mostly double semicolons and
	variable declarations after other stuff. Spotted by Martin
	Renold.

	* app/pdb/gradients_cmds.c: regenerated.

	(there is one issue left, see his patch at
	http://old.homeip.net/martin/gcc-2.95.diff, I did not
	copy the #define va_copy __va_copy, since I don't know
	what happens here.)
2004-07-04 21:27:09 +00:00
Sven Neumann
21fea37da7 modules/cdisplay_gamma.c added object properties for configurable values.
2004-07-04  Sven Neumann  <sven@gimp.org>

	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c: added object properties for
	configurable values.

	* app/widgets/gimpcolordisplayeditor.c
	* libgimpwidgets/gimpcolordisplaystack.c
	* modules/cdisplay_colorblind.c
	* modules/cdisplay_proof.c: cosmetic changes.
2004-07-04 00:21:03 +00:00
Michael Natterer
23f6a194ac added context->serialize_props mask which enables specifying exactly which
2004-07-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.[ch]: added context->serialize_props mask
	which enables specifying exactly which properties will be
	serialized. Also fixes a bug that prevented undefined properties
	from being serialized, breaking tool_options and device status
	serialization.

	* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
	properties in the tool_info->context_props mask serializable, also
	configure/initialize tool_info->tool_options.

	* app/tools/gimp-tools.c (gimp_tools_register): removed
	tool_options initialization that is now done in
	gimp_tool_info_new().

	* app/widgets/gimpdeviceinfo.c: make only the properties in
	GIMP_DEVICE_INFO_CONTEXT_MASK serializable.

	* app/widgets/gimpdevicestatus.c: add the device table to its
	parent container again. Fixes "missing" devices.

	* app/core/gimptooloptions.c
	* app/widgets/gimpdevices.c: cleanup / code review.
2004-07-03 20:27:28 +00:00
Sven Neumann
6423529b86 app/gui/Makefile.am new files implementing a clipboard for image data
2004-07-02  Sven Neumann  <sven@gimp.org>

	* app/gui/Makefile.am
	* app/gui/clipboard.[ch]: new files implementing a clipboard for
	image data based on GDK_SELECTION_CLIPBOARD (bug #133247).

	* app/actions/edit-actions.c
	* app/actions/edit-commands.c: use the new clipboard API.

	* app/gui/gui.c: initialize and shutdown the clipboard.

	* app/core/gimpbuffer.c: cosmetics.

	* app/actions/actions.c
	* app/menus/menus.c: added sanity checks to exit functions.

	* app/display/gimpdisplayshell-dnd.[ch]: let
	gimp_display_shell_drop_svg() take a guchar * buffer.

	* app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
	fixed the implementation.
2004-07-02 14:08:15 +00:00
Sven Neumann
931110de27 added (yet unused) functions gimp_selection_data_[get|set]_pixbuf().
2004-07-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
	gimp_selection_data_[get|set]_pixbuf().
2004-07-01 15:46:25 +00:00
Michael Natterer
6679dc7183 implement GtkWidget::drag_motion() and set the FG/BG depending on where
2004-07-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
	and set the FG/BG depending on where the color was dropped. Also
	set the drag status accordingly so the cursor indicates whether
	dropping will have an effect or not. Fixes bug #145219.
2004-07-01 10:42:00 +00:00
Sven Neumann
bec9f9a670 app/core/core-enums.c app/display/display-enums.c app/paint/paint-enums.c
2004-06-30  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-06-30 16:05:24 +00:00
William Skaggs
8d4bdf5d60 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/*/*-enums.h: did HIG-compliant capitalization in the right
	place, instead of the auto-generated *-enums.c files.
2004-06-30 15:47:32 +00:00
Michael Natterer
cc6aa18619 app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpselectiondata.[ch]
	* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
	to "uri_list" in all function names, parameters and typedefs.

	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/display/gimpdisplayshell-dnd.[ch]
	* app/display/gimpdisplayshell.c: changed accordingly.
2004-06-30 14:47:23 +00:00
Michael Natterer
4022980314 Fixed a 1.2 -> 2.0 regression that was forgotten:
2004-06-30  Michael Natterer  <mitch@gimp.org>

	Fixed a 1.2 -> 2.0 regression that was forgotten:

	* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
	which can be one of { NEW, UPDATE }.

	* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
	gimp_palette_editor_update_color() to
	gimp_palette_editor_pick_color() and restored the functionality of
	creating/updating colors via this API

	Changed button_press handler to only edit the color on double
	click if it's really a double click on the same color.
	Fixes bug #141381.

	* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
	"add-to-palette" and a GUI for it.

	* app/core/gimpmarshal.list
	* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
	parameter to the "color_picked" signal. Pass NEW on button_press
	and UPDATE on motion.

	* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
	* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
	* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
	changed accordingly

	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
	If "add-to-palette" is TRUE, get the palette editor and call
	gimp_palette_editor_pick_color().
2004-06-30 12:10:08 +00:00
Sven Neumann
114f747f4c renamed the SVG related functions so that they deal with an anonymous data
2004-06-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: renamed the SVG related
	functions so that they deal with an anonymous data stream that
	could as well be a PNG image.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.

	* app/display/gimpdisplayshell-dnd.[ch]
	* app/vectors/gimpvectors-import.[ch]
	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpvectorstreeview.c: use gsize for the length of
	the buffer.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
	used yet.
2004-06-30 11:57:17 +00:00
Michael Natterer
425fd699e3 changed return value from gchar* to const gchar*. Renamed parameters to be
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
	changed return value from gchar* to const gchar*. Renamed
	parameters to be consistent with other SVG functions.

	* widgets/gimpcontainertreeview-dnd.c
	* widgets/gimpdnd.c: changed accordingly.
2004-06-29 23:18:18 +00:00
Michael Natterer
3cec641627 do like GtkAccelLabel does and turn underscores in accels into spaces so
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
	do like GtkAccelLabel does and turn underscores in accels into
	spaces so e.g. "Page_Up" becomes "Page Up".
2004-06-29 22:35:04 +00:00
Michael Natterer
4685112cff reordered drop destinations so vectors are preferred over SVG.
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c: reordered drop destinations
	so vectors are preferred over SVG.

	* app/vectors/gimpvectors-import.[ch]: added "gint position"
	parameter to all import functions so the imported vectors can be
	added at any position in the vectors stack.

	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
	position).

	* app/pdb/paths_cmds.c: regenerated.

	* app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
	to the paths dialog.
2004-06-29 13:34:16 +00:00
Michael Natterer
03b4c71d69 don't free the SVG data after dropping, it's owned by GtkSelectionData.
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
	after dropping, it's owned by GtkSelectionData.
2004-06-29 13:28:26 +00:00
Michael Natterer
3f5e10c1d6 use gtk_target_list_add() instead of gtk_target_list_add_table() because
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
	gtk_target_list_add_table() because the latter prepends the
	targets to the internal list which screws the order (== priority)
	of DND targets.

	* app/widgets/gimpselectiondata.c: added some more checks for
	failed drops (selection_data->length < 0).
2004-06-29 13:20:30 +00:00
Michael Natterer
6cd5737257 added new function gimp_get_mod_string() which takes a GdkModifierType and
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_get_mod_string() which takes a GdkModifierType and returns
	correctly formated strings for all shift,control,alt combinations.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: use the new function instead
	of gimp_get_mod_name_shift(),control(),alt(),separator(). This
	kindof addresses the issue of configurable modifier keys but is
	actually indended to ease translation of format strings ("%s" is
	easier to get right than "%s%s%s").
2004-06-28 23:30:57 +00:00
Michael Natterer
6a5e68c9e2 Allow all sorts of things to be dropped on or in between the items of a
2004-06-28  Michael Natterer  <mitch@gimp.org>

	Allow all sorts of things to be dropped on or in between the
	items of a GimpContainerTreeView:

	* app/widgets/gimpcontainertreeview.[ch]: added more parameters to
	GimpContainerTreeView::drop_possible() to specify where ecactly
	the drop should take place (between or into items) and to support
	dropping all sorts of things.

	Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
	::drop_files() and ::drop_svg(), which cover all possible drop
	types.

	* app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
	Dispatch all kinds of drops to the resp. virtual functions.

	* app/widgets/gimpitemtreeview.c: changed accordingly.

	* app/widgets/gimplayertreeview.c: allow to drop URIs, colors
	and patterns to the layers dialog. Fixes bugs #119506 and #139246.
2004-06-28 22:07:12 +00:00
Michael Natterer
667de3c9f4 app/widgets/Makefile.am new files containing the code which
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpselectiondata.[ch]: new files containing the
	code which encodes/decodes all sorts of stuff to/from its
	GtkSelectionData representation. Used to live in gimpdnd.c

	* app/widgets/gimpdnd.c: use the new functions (unclutters the
	file quite a bit), converted tabs to spaces.
2004-06-28 20:39:54 +00:00
Michael Natterer
d45a6b230f #include "libgimpwidgets/gimpwidgets.h"
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c:
	#include "libgimpwidgets/gimpwidgets.h"
2004-06-28 17:06:38 +00:00
Michael Natterer
23c068bc75 added properties for all brush parameters.
2004-06-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpbrushgenerated.c: added properties for all brush
	parameters.

	* app/widgets/gimpbrusheditor.c: listen to property changes of the
	edited brush and update the scales accordingly.
2004-06-25 00:58:43 +00:00
Michael Natterer
488ac69d02 added a boolean property "debug-events" and honor it when printing
2004-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerinfo.[ch]: added a boolean property
	"debug-events" and honor it when printing debugging output.
	Should add an event console window so the user doesn't need to
	have a terminal to inspect input module output.

	* app/gui/prefereces-dialog.c: HIGified some forgotten labels.
	Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors".
	Replaced some forgotten "Dir" with "Folder".
	Made more GimpControllerInfo and GimpController properties
	editable and cleaned up the controller page.
2004-06-24 22:35:00 +00:00
Michael Natterer
f0fcfaabb2 added gimp_prop_label_new().
2004-06-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new().

	* app/widgets/gimpgrideditor.c: HIGified capitalization.
2004-06-24 22:23:05 +00:00
Michael Natterer
11dfbae2f6 renamed function gimp_controller_wheel_scrolled() to
2004-06-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerwheel.[ch]: renamed function
	gimp_controller_wheel_scrolled() to
	gimp_controller_wheel_scroll().

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): changed accordingly.
2004-06-24 15:29:19 +00:00
Michael Natterer
02b91f6628 app/tools/gimptool.[ch] added boolean return value to
2004-06-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: added boolean return value to
	GimpTool::key_press() which indicates if the event was handled.

	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.[ch]
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: return TRUE if the key event was handled.

	* app/tools/gimppainttool.c: removed key_press() implementation.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
	which takes GdkEventKey and emits controller events for all
	combinations of modifiers and cursor keys.

	* app/widgets/gimpcontrollers.[ch]: added new function
	gimp_controllers_get_keyboard().

	* app/display/gimpdisplayshell-callbacks.c: if a key event was not
	handled by the active tool, dispatch it to the keyboard controller.

	* etc/controllerrc: add a keyboard controller which is configured
	to do the same as the removed gimp_paint_tool_key_press().
2004-06-24 10:16:08 +00:00
William Skaggs
63a4a72f79 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/gui/*.c:
	* app/widgets/*.c:
	* etc/templaterc: HIGify capitalization.  Should finish bug #123699
	except for everything I missed or got wrong.
2004-06-23 22:44:04 +00:00
Michael Natterer
1ce16fefd7 app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added
2004-06-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpenumaction.[ch]
	* app/widgets/gimppluginaction.[ch]
	* app/widgets/gimpstringaction.[ch]: added parameters to the
	gimp_*_action_selected() function so the "selected" signal can be
	emitted with value != action->value. Changed GtkAction::activate()
	implementations accordingly (pass action->value).

	* app/widgets/gimpcontrollers.c: call gimp_enum_action_selected()
	and pass the value of the GimpControllerEventValue instead of
	temporarily replacing action->value and calling
	gtk_action_activate().

	* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
2004-06-23 14:39:48 +00:00
Michael Natterer
9fe8e84963 app/actions/view-actions.c added actions & callbacks to configure the
2004-06-22  Michael Natterer  <mitch@gimp.org>

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]: added actions & callbacks to
	configure the canvas padding color.

	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: added the actions' help IDs and menu entries.

	* app/display/display-enums.h: added /*< skip >*/'ed enum value
	GIMP_CANVAS_PADDING_MODE_RESET.

	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-callbacks.[ch]
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell.[ch]: removed the canvas padding
	button and its popup menu (fixes bug #142996). Instead, added a
	toggle button which allows to zoom the image when the window is
	resized (as known from sodipodi, except it doesn't work as nice
	yet :-) improvements to the algorithm are welcome).
	Cleaned up the GimpDisplayShell struct a bit and renamed some
	of its members.

	* libgimpwidgets/gimpstock.[ch]
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-zoom-follow-window-12.png: added new
	icon for the new display toggle button.
2004-06-22 16:31:27 +00:00
Sven Neumann
a5fcdf28c7 unset the filename if the image is unnamed.
2004-06-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if the image is unnamed.

	* configure.in
	* app/sanity.c: depend on gtk+ >= 2.4.1.

	* app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
	to gimp_thumb_box_take_uris() since the function takes ownership
	of the list,

	* app/widgets/gimpfiledialog.c: changed accordingly. Removed code
	that worked around a problem in gtk+ < 2.4.1.
2004-06-22 15:11:35 +00:00
Michael Natterer
5e2c4257bb removed value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
2004-06-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed
	value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
	of GDK to do that (it was GDK that was broken, not some of the X
	servers).

	* app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the
	cursor's pixels for GTK+ < 2.4.4.
2004-06-21 16:17:16 +00:00
Sven Neumann
2670ce0bf8 libgimpwidgets/gimpwidgets.[ch] added new utility function
2004-06-21  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]
	* libgimpwidgets/gimpwidgets.def: added new utility function
	gimp_label_set_attributes().

	* app/display/gimpdisplayshell.c
	* app/gui/preferences-dialog.c
	* app/gui/resolution-calibrate-dialog.c
	* app/widgets/gimpviewabledialog.c
	* app/widgets/gimpwidgets-utils.c: use the new function.

	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimphistogrameditor.c: display the name in italic.

	* plug-ins/common/jpeg.c: display the file size in italic.
2004-06-21 13:18:50 +00:00
Sven Neumann
d97fb0a287 removed the label between the spinbuttons, it looks silly. Converted tabs
2004-06-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrambox.[ch]: removed the label between the
	spinbuttons, it looks silly. Converted tabs to spaces, removed
	trailing whitespace.

	* app/widgets/gimphistogrameditor.c
	* app/tools/gimpthresholdtool.c: changed accordingly.
2004-06-20 22:04:10 +00:00
William Skaggs
ca7aac79d1 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphistogrambox.[ch]:
	* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
	so that it uses a two-triangle-slider scale of the sort used in the
	levels tool.  Almost all of the changes are actually in the
	histogram-box widget code, which is only used by the threshold
	tool.  Fixes bug #137521.
2004-06-20 20:51:23 +00:00
Philip Lafleur
c7364a64aa Changed "Zoom to Fit Window" command to "Fit Image in Window" and added
2004-06-20  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-scale.[ch]:
	* app/display/gimpnavigationview.[ch]:
	* app/actions/view-actions.c:
	* app/actions/view-commands.[ch]:
	* app/widgets/gimphelp-ids.h:
	* menus/image-menu.xml.in: Changed "Zoom to Fit Window" command
	to "Fit Image in Window" and added another command, "Fit Image
	to Window", that zooms according to the opposite dimension. Fixes
	bug #144597.
2004-06-20 12:09:03 +00:00
Michael Natterer
3720ce2ef7 start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble. Assume the
2004-06-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
	start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble.
	Assume the double value is in a [0.0..1.0] range and temporarily
	change the value of the called GimpEnumAction to a range of
	[0..1000] when invoking it. All still very hackish...
2004-06-19 00:31:08 +00:00
Michael Natterer
98e5e6939d more debugging output.
2004-06-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event):
	more debugging output.
2004-06-19 00:05:48 +00:00
Michael Natterer
2a69c419f1 added gimp_boolean_handled_accum().
2004-06-17  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum().

	* app/core/gimp.c
	* app/widgets/gimpcontrollerinfo.c: use it.
2004-06-17 16:32:30 +00:00
Michael Natterer
75e6fc560b add newly created children to the container *after* deserializing them so
2004-06-17  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontainer.c (gimp_container_deserialize): add newly
	created children to the container *after* deserializing them so
	GimpContainer::add() callbacks get the already deserialized
	object.

	* app/widgets/gimpcontrollers.c: connect to "add" and "remove" of
	the controller list and remember / clear the wheel controller when
	it appears / disappears.
2004-06-17 16:25:36 +00:00
Michael Natterer
5f4eabdbcb removed "enabled" property. Removed GIMP_CONTROLLER_PARAM_RERIALIZE from
2004-06-17  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.[ch]: removed "enabled"
	property. Removed GIMP_CONTROLLER_PARAM_RERIALIZE from the "name"
	property because it's the hardware-determined name of this
	controller instance.

	* app/widgets/gimpcontrollerwheel.c
	* modules/controller_linux_input.c: set the name.

	* libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h.

	* app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here
	instead.  Don't dispatch events if the controller is
	disabled. Made everything work (not crash) with info->mapping
	being NULL.

	* etc/controllerrc: updated again with the changed format.

	* app/widgets/gimpcontrollers.[ch]: added
	gimp_controllers_get_list() which returns the container of
	controllers.

	* app/widgets/gimphelp-ids.h
	* app/gui/preferences-dialog.c: added controller configuration
	(can't change anything yet, just view the current settings).
	Resurrected the "Input Devices" page and removed the "Session"
	page by moving its widgets to other pages. Pack the various
	"Save now"/"Clear now" buttons vertically, not horizontally.
	Fixes bug #139069.

	* themes/Default/images/preferences/Makefile.am
	* themes/Default/images/preferences/controllers.png
	* themes/Default/images/preferences/theme.png: new icons for new
	prefs pages. Someone needs to make them nice...
2004-06-17 14:07:05 +00:00
Michael Natterer
004a9572cf always return a non-NULL string (return "<invalid event id>" as fallback).
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name)
	(gimp_controller_get_event_blurb): always return a non-NULL
	string (return "<invalid event id>" as fallback).

	* modules/controller_linux_input.c: reenabled button event
	dispatching.

	* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
2004-06-16 19:51:33 +00:00
Michael Natterer
3a7f7d54e7 added #define GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.[ch]: added #define
	GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable.

	* modules/controller_linux_input.c: made "device-name"
	serializable.

	* app/config/gimpconfig-params.h: added macro
	GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled
	by custom (de)serialize_property() implementations.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-serialize.c: made object (de)serialization
	work for object properties which are *not* GIMP_PARAM_AGGREGATE.
	Write/parse the exact type of the object to create to enable this.

	* app/core/gimpmarshal.list: new marshaller for GimpControllerInfo.

	* app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface
	and add "controller" and "mapping" properties. Add "event-mapped"
	signal which carries the action_name.

	* app/widgets/gimpcontrollers.c: removed all deserialization code
	and simply (de)serialize the controller container. Install a
	container handler for "event-mapped" and do the action_name ->
	action mapping in the callback.

	* etc/controllerrc: regenerated with new syntax. Delete your old one!
2004-06-16 18:14:44 +00:00
Sven Neumann
429b090fd4 don't use gettext() here.
2004-06-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollerwheel.c
	(gimp_controller_wheel_get_event_name): don't use gettext() here.

	* modules/controller_linux_input.c: added more button events, set
	the device name, some cleanup.
2004-06-16 17:22:19 +00:00
Michael Natterer
569af0ac93 added GimpController::get_event_blurb() which returns the strings that
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.[ch]: added
	GimpController::get_event_blurb() which returns the strings that
	were returned by get_event_name(). The latter returns
	untranslatable event identifiers now.

	* app/widgets/gimpcontrollerwheel.c
	* modules/controller_linux_input.c: changed accordingly.

	* app/widgets/gimpcontrollerinfo.c
	* app/widgets/gimpcontrollers.c: changed the event mapping from
	event-id -> action-name to event-name -> action-name.

	* etc/controllerrc: changed accordingly (finally readable now).
2004-06-16 11:53:37 +00:00
Michael Natterer
ba2e6c675f app/widgets/Makefile.am app/widgets/widgets-types.h made an object out of
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerinfo.[ch]: made an object out of
	the GimpControllerInfo struct.

	* app/widgets/gimpcontrollers.c: changed accordingly.
2004-06-16 11:11:32 +00:00
Michael Natterer
3474308cfe better debugging output.
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollers.c: better debugging output.
2004-06-16 02:23:42 +00:00
Sven Neumann
f4208e33ba bug fix.
2004-06-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontrollers.c: bug fix.

	* configure.in: check for linux/input.h.

	* modules/Makefile.am
	* modules/controller_linux_input.c: added a prototype controller
	module using the linux input event interface.

	* etc/controllerrc: added example config for linux input device.
2004-06-16 02:18:17 +00:00
Michael Natterer
1713ef21a5 load the controller's properties from the controllerrc file.
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollers.c: load the controller's
	properties from the controllerrc file.

	* etc/controllerrc: set the wheel's properties.
2004-06-16 01:59:50 +00:00
Michael Natterer
aa96898f45 ref the actions when putting them in the mapping table.
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollers.c: ref the actions when putting
	them in the mapping table.

	* app/actions/context-actions.c: added actions to change the
	opacity in 10% steps.
2004-06-16 01:16:52 +00:00
Michael Natterer
f3b7f4161c added a "name" property. Dispatch events only if the controller is
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.[ch]: added a "name" property.
	Dispatch events only if the controller is enabled.

	* app/widgets/gimpcontrollerwheel.c: added controller events for
	all possible modifier combinations.

	* etc/Makefile.am
	* etc/controllerrc: default controllerrc which maps all unused
	wheel+modifier combinations to more-or-less usefull stuff.
2004-06-16 00:52:28 +00:00
Michael Natterer
d0117ef5b9 Started to fix bug #106920 in a more genreral way:
2004-06-16  Michael Natterer  <mitch@gimp.org>

	Started to fix bug #106920 in a more genreral way:

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpcontroller.[ch]: new abstract base class
	which provides an API for pluggable input controller modules
	(mouse wheel, usb/midi stuff etc.).

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
	which maps wheel mouse scroll events to controller events.

	* app/widgets/gimpcontrollers.[ch]: manager for controllers.
	reads $(gimpdir)/controllerrc and keeps a mapping of controller
	events to GtkActions.

	* app/gui/gui.c: initialize and shut down the controller stuff.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): if a wheel controller
	exists, dispatch GdkEventScroll to it first and return if it was
	handled.
2004-06-15 22:59:26 +00:00
Michael Natterer
8988b85ba3 fixed typo in last commit. 2004-06-14 14:41:45 +00:00
Michael Natterer
179c709509 do the workaround for "" accelerators only if the GTK+ version is smaller
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
	do the workaround for "" accelerators only if the GTK+ version
	is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3.
2004-06-14 14:38:59 +00:00
Michael Natterer
2498adc5f6 added enum GimpCursorFormat which can be one of { BITMAP, PIXBUF,
2004-06-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
	which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
	work around broken X servers.

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.

	* app/gui/preferences-dialog.c: added a GUI for the new option.

	* app/widgets/gimpcursor.[ch]: added cursor_format parameter
	to gimp_cursor_new() and _set().

	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimpcurvestool.c
	* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
2004-06-13 02:08:54 +00:00
Michael Natterer
b490b26283 added "gint freeze_count" and gimp_data_freeze()/thaw() functions. Emit
2004-06-13  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdata.[ch]: added "gint freeze_count" and
	gimp_data_freeze()/thaw() functions. Emit "dirty" only if
	freeze_count either is 0 or drops to 0.

	* app/core/gimpbrushgenerated.[ch]
	* app/core/gimpgradient.[ch]: removed freeze/thaw stuff that
	was duplicated in these two subclasses and use the new
	GimpData API instead.

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpgradienteditor.c: changed accordingly.
2004-06-12 22:13:31 +00:00
Sven Neumann
2fd178c624 don't copy the first row onto itself.
2004-06-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy
	the first row onto itself.
2004-06-12 20:26:16 +00:00
Sven Neumann
fc03867f4c set the initially selected channel on the histogram combobox. Fixes bug
2004-06-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init):
	set the initially selected channel on the histogram combobox.
	Fixes bug #144225.
2004-06-12 17:30:28 +00:00
Michael Natterer
33f43497f0 line-wrap the filename label if it's too long instead of cutting it off.
2004-06-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the
	filename label if it's too long instead of cutting it off.
2004-06-10 16:00:53 +00:00
Michael Natterer
65995ec6f8 s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.
2004-06-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.h (enum GimpCursorModifier):
	s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.

	* app/widgets/gimpcursor.c: changed accordingly. Renamed struct
	GimpBitmapCursor to GimpCursor. More cleanup.
2004-06-10 14:43:08 +00:00
Sven Neumann
38b78ce9d2 added an API to expand/collapse the "Advanced Options" frame.
2004-06-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.[ch]: added an API to
	expand/collapse the "Advanced Options" frame.

	* app/gui/preferences-dialog.c
	* app/widgets/gimphelp-ids.h: applied a patch done by William
	Skaggs that cleans up and reorganizes the Preferences dialog
	(bug #144060).
2004-06-09 22:37:49 +00:00
Sven Neumann
ae24e1fab2 applied a patch from David Gowers that makes the gradient editor display
2004-06-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpgradienteditor.c: applied a patch from David
	Gowers that makes the gradient editor display the perceptual
	intensity of the color under the cursor (bug #135037).
2004-06-05 11:14:38 +00:00
Michael Natterer
714d63fcda cursors/Makefile.am cursors/cursor-none.png new empty cursor images.
2004-06-05  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/cursor-none.png
	* cursors/xbm/cursor-none.xbm: new empty cursor images.

	* app/config/gimpdisplayconfig.[ch]
	* app/config/gimprc-blurbs.h
	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c
	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimppainttool.[ch]
	* app/tools/gimpinktool.c
	* app/gui/preferences-dialog.c: applied patches from Philip
	Lafleur which implement hiding the cursor completely for paint
	tools. Changed the name of the config option from
	"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
	to TRUE because this needs the brush outline being visible while
	painting to be really usable. Fixes bug #132163.

	* app/widgets/widgets-enums.h: renamed all GimpCursorType and
	GimpToolCursorType enum values to GIMP_CURSOR_* and
	GIMP_TOOL_CURSOR_*.

	* app/widgets/gimpcursor.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimp*tool.c; changed accordingly.
2004-06-04 23:08:29 +00:00
Michael Natterer
d0f9de48d0 changed create_cursor_foo() utility functions to get_cursor_foo() and use
2004-06-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcursor.c: changed create_cursor_foo() utility
	functions to get_cursor_foo() and use them as accessors instead of
	using cursor->member. Use gdk_pixbuf_copy() instead of compositing
	the initial image onto an empty pixbuf.
2004-06-04 19:03:49 +00:00
Sven Neumann
aadd9e03aa set the focus on the text area.
2004-06-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptexteditor.c (gimp_text_editor_new): set the
	focus on the text area.
2004-06-04 18:17:50 +00:00