Gimp/app/widgets/Makefile.am
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00

301 lines
7.2 KiB
Makefile

## Process this file with automake to produce Makefile.in
AM_CPPFLAGS = \
-DG_LOG_DOMAIN=\"Gimp-Widgets\" \
@GIMP_THREAD_FLAGS@ \
@GIMP_MP_FLAGS@
INCLUDES = \
-I$(top_builddir) \
-I$(top_srcdir) \
-I$(top_builddir)/app \
-I$(top_srcdir)/app \
$(GTK_CFLAGS) \
$(PANGOFT2_CFLAGS) \
-I$(includedir)
noinst_LIBRARIES = libappwidgets.a
libappwidgets_a_sources = \
widgets-enums.h \
widgets-types.h \
gimpaction.c \
gimpaction.h \
gimpactionfactory.c \
gimpactionfactory.h \
gimpactiongroup.c \
gimpactiongroup.h \
gimpactionview.c \
gimpactionview.h \
gimpblobeditor.c \
gimpblobeditor.h \
gimpbrusheditor.c \
gimpbrusheditor.h \
gimpbrushfactoryview.c \
gimpbrushfactoryview.h \
gimpbrushselect.c \
gimpbrushselect.h \
gimpbufferview.c \
gimpbufferview.h \
gimpcellrendereraccel.c \
gimpcellrendereraccel.h \
gimpcellrendererviewable.c \
gimpcellrendererviewable.h \
gimpchanneltreeview.c \
gimpchanneltreeview.h \
gimpclipboard.c \
gimpclipboard.h \
gimpcolorbar.c \
gimpcolorbar.h \
gimpcolordisplayeditor.c \
gimpcolordisplayeditor.h \
gimpcoloreditor.c \
gimpcoloreditor.h \
gimpcolorframe.c \
gimpcolorframe.h \
gimpcolormapeditor.c \
gimpcolormapeditor.h \
gimpcolorpanel.c \
gimpcolorpanel.h \
gimpcomponenteditor.c \
gimpcomponenteditor.h \
gimpcontainerbox.c \
gimpcontainerbox.h \
gimpcontainercombobox.c \
gimpcontainercombobox.h \
gimpcontainereditor.c \
gimpcontainereditor.h \
gimpcontainerentry.c \
gimpcontainerentry.h \
gimpcontainergridview.c \
gimpcontainergridview.h \
gimpcontainerpopup.c \
gimpcontainerpopup.h \
gimpcontainertreeview.c \
gimpcontainertreeview.h \
gimpcontainertreeview-dnd.c \
gimpcontainertreeview-dnd.h \
gimpcontainerview.c \
gimpcontainerview.h \
gimpcontainerview-utils.c \
gimpcontainerview-utils.h \
gimpcontrollerinfo.c \
gimpcontrollerinfo.h \
gimpcontrollers.c \
gimpcontrollers.h \
gimpcontrollerkeyboard.c \
gimpcontrollerkeyboard.h \
gimpcontrollerwheel.c \
gimpcontrollerwheel.h \
gimpcursor.c \
gimpcursor.h \
gimpdasheditor.c \
gimpdasheditor.h \
gimpdataeditor.c \
gimpdataeditor.h \
gimpdatafactoryview.c \
gimpdatafactoryview.h \
gimpdataselect.c \
gimpdataselect.h \
gimpdeviceinfo.c \
gimpdeviceinfo.h \
gimpdevices.c \
gimpdevices.h \
gimpdevicestatus.c \
gimpdevicestatus.h \
gimpdialogfactory.c \
gimpdialogfactory.h \
gimpdnd.c \
gimpdnd.h \
gimpdock.c \
gimpdock.h \
gimpdockable.c \
gimpdockable.h \
gimpdockbook.c \
gimpdockbook.h \
gimpdocked.c \
gimpdocked.h \
gimpdocumentview.c \
gimpdocumentview.h \
gimpdrawabletreeview.c \
gimpdrawabletreeview.h \
gimpeditor.c \
gimpeditor.h \
gimpenumaction.c \
gimpenumaction.h \
gimpenumcombobox.c \
gimpenumcombobox.h \
gimpenumstore.c \
gimpenumstore.h \
gimpenumwidgets.c \
gimpenumwidgets.h \
gimperrorconsole.c \
gimperrorconsole.h \
gimperrordialog.c \
gimperrordialog.h \
gimpfgbgeditor.c \
gimpfgbgeditor.h \
gimpfiledialog.c \
gimpfiledialog.h \
gimpfileprocview.c \
gimpfileprocview.h \
gimpfontselect.c \
gimpfontselect.h \
gimpfontview.c \
gimpfontview.h \
gimpgradienteditor.c \
gimpgradienteditor.h \
gimpgradientselect.c \
gimpgradientselect.h \
gimpgrideditor.c \
gimpgrideditor.h \
gimphelp.c \
gimphelp.h \
gimphelp-ids.h \
gimphistogrambox.c \
gimphistogrambox.h \
gimphistogrameditor.c \
gimphistogrameditor.h \
gimphistogramview.c \
gimphistogramview.h \
gimpimagedock.c \
gimpimagedock.h \
gimpimageeditor.c \
gimpimageeditor.h \
gimpimageview.c \
gimpimageview.h \
gimpitemfactory.c \
gimpitemfactory.h \
gimpitemtreeview.c \
gimpitemtreeview.h \
gimplayertreeview.c \
gimplayertreeview.h \
gimpmenufactory.c \
gimpmenufactory.h \
gimpmessagebox.c \
gimpmessagebox.h \
gimpnavigationpreview.c \
gimpnavigationpreview.h \
gimppaletteeditor.c \
gimppaletteeditor.h \
gimppaletteselect.c \
gimppaletteselect.h \
gimppatternfactoryview.c \
gimppatternfactoryview.h \
gimppatternselect.c \
gimppatternselect.h \
gimppdbdialog.c \
gimppdbdialog.h \
gimppluginaction.c \
gimppluginaction.h \
gimppreview-popup.c \
gimppreview-popup.h \
gimppreviewrenderer.c \
gimppreviewrenderer.h \
gimppreviewrenderer-utils.c \
gimppreviewrenderer-utils.h \
gimppreviewrendererbrush.c \
gimppreviewrendererbrush.h \
gimppreviewrendererdrawable.c \
gimppreviewrendererdrawable.h \
gimppreviewrenderergradient.c \
gimppreviewrenderergradient.h \
gimppreviewrendererimage.c \
gimppreviewrendererimage.h \
gimppreviewrendererimagefile.c \
gimppreviewrendererimagefile.h \
gimppreviewrendererlayer.c \
gimppreviewrendererlayer.h \
gimppreviewrenderervectors.c \
gimppreviewrenderervectors.h \
gimpprogressbox.c \
gimpprogressbox.h \
gimpprogressdialog.c \
gimpprogressdialog.h \
gimppropwidgets.c \
gimppropwidgets.h \
gimpselectiondata.c \
gimpselectiondata.h \
gimpselectioneditor.c \
gimpselectioneditor.h \
gimpsessioninfo.c \
gimpsessioninfo.h \
gimpstringaction.c \
gimpstringaction.h \
gimpstrokeeditor.c \
gimpstrokeeditor.h \
gimptemplateeditor.c \
gimptemplateeditor.h \
gimptemplateview.c \
gimptemplateview.h \
gimptexteditor.c \
gimptexteditor.h \
gimpthumbbox.c \
gimpthumbbox.h \
gimptoolbox.c \
gimptoolbox.h \
gimptoolbox-color-area.c \
gimptoolbox-color-area.h \
gimptoolbox-dnd.c \
gimptoolbox-dnd.h \
gimptoolbox-image-area.c \
gimptoolbox-image-area.h \
gimptoolbox-indicator-area.c \
gimptoolbox-indicator-area.h \
gimptooldialog.c \
gimptooldialog.h \
gimptooloptionseditor.c \
gimptooloptionseditor.h \
gimptoolview.c \
gimptoolview.h \
gimpuimanager.c \
gimpuimanager.h \
gimpundoeditor.c \
gimpundoeditor.h \
gimpunitcombobox.c \
gimpunitcombobox.h \
gimpunitstore.c \
gimpunitstore.h \
gimpvectorstreeview.c \
gimpvectorstreeview.h \
gimpview.c \
gimpview.h \
gimpviewablebutton.c \
gimpviewablebutton.h \
gimpviewabledialog.c \
gimpviewabledialog.h \
gimpwidgets-constructors.c \
gimpwidgets-constructors.h \
gimpwidgets-utils.c \
gimpwidgets-utils.h \
gtkwrapbox.c \
gtkwrapbox.h \
gtkhwrapbox.c \
gtkhwrapbox.h \
gtkvwrapbox.c \
gtkvwrapbox.h
libappwidgets_a_built_sources = widgets-enums.c
libappwidgets_a_SOURCES = \
$(libappwidgets_a_built_sources) $(libappwidgets_a_sources)
EXTRA_DIST = makefile.msc
#
# rules to generate built sources
#
# setup autogeneration dependencies
gen_sources = xgen-wec
CLEANFILES = $(gen_sources)
$(srcdir)/widgets-enums.c: $(srcdir)/widgets-enums.h $(GIMP_MKENUMS)
$(GIMP_MKENUMS) \
--fhead "#include \"config.h\"\n#include <gtk/gtk.h>\n#include \"widgets-enums.h\"\n#include \"gimp-intl.h\"" \
--fprod "\n/* enumerations from \"@filename@\" */" \
--vhead "GType\n@enum_name@_get_type (void)\n{\n static const G@Type@Value values[] =\n {" \
--vprod " { @VALUENAME@, @valuedesc@, \"@valuenick@\" }," \
--vtail " { 0, NULL, NULL }\n };\n\n static GType type = 0;\n\n if (! type)\n type = g_@type@_register_static (\"@EnumName@\", values);\n\n return type;\n}\n" \
$(srcdir)/widgets-enums.h > xgen-wec \
&& cp xgen-wec $(@F) \
&& rm -f xgen-wec