2004-08-25 Sven Neumann <sven@gimp.org> * app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat(). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimperrordialog.[ch]: added new dialog that adds a new GimpMessageBox for each message added. Fixes bug #92604. * app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box() functionality. * app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: manage GimpErrorDialog as singleton. * app/gui/gui-vtable.c (gui_message): use the new error dialog. * app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL domain. * app/widgets/gimperrorconsole.c (gimp_error_console_add): fail when being called with a NULL domain.
301 lines
7.2 KiB
Makefile
301 lines
7.2 KiB
Makefile
## Process this file with automake to produce Makefile.in
|
|
|
|
AM_CPPFLAGS = \
|
|
-DG_LOG_DOMAIN=\"Gimp-Widgets\" \
|
|
@GIMP_THREAD_FLAGS@ \
|
|
@GIMP_MP_FLAGS@
|
|
|
|
INCLUDES = \
|
|
-I$(top_builddir) \
|
|
-I$(top_srcdir) \
|
|
-I$(top_builddir)/app \
|
|
-I$(top_srcdir)/app \
|
|
$(GTK_CFLAGS) \
|
|
$(PANGOFT2_CFLAGS) \
|
|
-I$(includedir)
|
|
|
|
noinst_LIBRARIES = libappwidgets.a
|
|
|
|
libappwidgets_a_sources = \
|
|
widgets-enums.h \
|
|
widgets-types.h \
|
|
gimpaction.c \
|
|
gimpaction.h \
|
|
gimpactionfactory.c \
|
|
gimpactionfactory.h \
|
|
gimpactiongroup.c \
|
|
gimpactiongroup.h \
|
|
gimpactionview.c \
|
|
gimpactionview.h \
|
|
gimpblobeditor.c \
|
|
gimpblobeditor.h \
|
|
gimpbrusheditor.c \
|
|
gimpbrusheditor.h \
|
|
gimpbrushfactoryview.c \
|
|
gimpbrushfactoryview.h \
|
|
gimpbrushselect.c \
|
|
gimpbrushselect.h \
|
|
gimpbufferview.c \
|
|
gimpbufferview.h \
|
|
gimpcellrendereraccel.c \
|
|
gimpcellrendereraccel.h \
|
|
gimpcellrendererviewable.c \
|
|
gimpcellrendererviewable.h \
|
|
gimpchanneltreeview.c \
|
|
gimpchanneltreeview.h \
|
|
gimpclipboard.c \
|
|
gimpclipboard.h \
|
|
gimpcolorbar.c \
|
|
gimpcolorbar.h \
|
|
gimpcolordisplayeditor.c \
|
|
gimpcolordisplayeditor.h \
|
|
gimpcoloreditor.c \
|
|
gimpcoloreditor.h \
|
|
gimpcolorframe.c \
|
|
gimpcolorframe.h \
|
|
gimpcolormapeditor.c \
|
|
gimpcolormapeditor.h \
|
|
gimpcolorpanel.c \
|
|
gimpcolorpanel.h \
|
|
gimpcomponenteditor.c \
|
|
gimpcomponenteditor.h \
|
|
gimpcontainerbox.c \
|
|
gimpcontainerbox.h \
|
|
gimpcontainercombobox.c \
|
|
gimpcontainercombobox.h \
|
|
gimpcontainereditor.c \
|
|
gimpcontainereditor.h \
|
|
gimpcontainerentry.c \
|
|
gimpcontainerentry.h \
|
|
gimpcontainergridview.c \
|
|
gimpcontainergridview.h \
|
|
gimpcontainerpopup.c \
|
|
gimpcontainerpopup.h \
|
|
gimpcontainertreeview.c \
|
|
gimpcontainertreeview.h \
|
|
gimpcontainertreeview-dnd.c \
|
|
gimpcontainertreeview-dnd.h \
|
|
gimpcontainerview.c \
|
|
gimpcontainerview.h \
|
|
gimpcontainerview-utils.c \
|
|
gimpcontainerview-utils.h \
|
|
gimpcontrollerinfo.c \
|
|
gimpcontrollerinfo.h \
|
|
gimpcontrollers.c \
|
|
gimpcontrollers.h \
|
|
gimpcontrollerkeyboard.c \
|
|
gimpcontrollerkeyboard.h \
|
|
gimpcontrollerwheel.c \
|
|
gimpcontrollerwheel.h \
|
|
gimpcursor.c \
|
|
gimpcursor.h \
|
|
gimpdasheditor.c \
|
|
gimpdasheditor.h \
|
|
gimpdataeditor.c \
|
|
gimpdataeditor.h \
|
|
gimpdatafactoryview.c \
|
|
gimpdatafactoryview.h \
|
|
gimpdataselect.c \
|
|
gimpdataselect.h \
|
|
gimpdeviceinfo.c \
|
|
gimpdeviceinfo.h \
|
|
gimpdevices.c \
|
|
gimpdevices.h \
|
|
gimpdevicestatus.c \
|
|
gimpdevicestatus.h \
|
|
gimpdialogfactory.c \
|
|
gimpdialogfactory.h \
|
|
gimpdnd.c \
|
|
gimpdnd.h \
|
|
gimpdock.c \
|
|
gimpdock.h \
|
|
gimpdockable.c \
|
|
gimpdockable.h \
|
|
gimpdockbook.c \
|
|
gimpdockbook.h \
|
|
gimpdocked.c \
|
|
gimpdocked.h \
|
|
gimpdocumentview.c \
|
|
gimpdocumentview.h \
|
|
gimpdrawabletreeview.c \
|
|
gimpdrawabletreeview.h \
|
|
gimpeditor.c \
|
|
gimpeditor.h \
|
|
gimpenumaction.c \
|
|
gimpenumaction.h \
|
|
gimpenumcombobox.c \
|
|
gimpenumcombobox.h \
|
|
gimpenumstore.c \
|
|
gimpenumstore.h \
|
|
gimpenumwidgets.c \
|
|
gimpenumwidgets.h \
|
|
gimperrorconsole.c \
|
|
gimperrorconsole.h \
|
|
gimperrordialog.c \
|
|
gimperrordialog.h \
|
|
gimpfgbgeditor.c \
|
|
gimpfgbgeditor.h \
|
|
gimpfiledialog.c \
|
|
gimpfiledialog.h \
|
|
gimpfileprocview.c \
|
|
gimpfileprocview.h \
|
|
gimpfontselect.c \
|
|
gimpfontselect.h \
|
|
gimpfontview.c \
|
|
gimpfontview.h \
|
|
gimpgradienteditor.c \
|
|
gimpgradienteditor.h \
|
|
gimpgradientselect.c \
|
|
gimpgradientselect.h \
|
|
gimpgrideditor.c \
|
|
gimpgrideditor.h \
|
|
gimphelp.c \
|
|
gimphelp.h \
|
|
gimphelp-ids.h \
|
|
gimphistogrambox.c \
|
|
gimphistogrambox.h \
|
|
gimphistogrameditor.c \
|
|
gimphistogrameditor.h \
|
|
gimphistogramview.c \
|
|
gimphistogramview.h \
|
|
gimpimagedock.c \
|
|
gimpimagedock.h \
|
|
gimpimageeditor.c \
|
|
gimpimageeditor.h \
|
|
gimpimageview.c \
|
|
gimpimageview.h \
|
|
gimpitemfactory.c \
|
|
gimpitemfactory.h \
|
|
gimpitemtreeview.c \
|
|
gimpitemtreeview.h \
|
|
gimplayertreeview.c \
|
|
gimplayertreeview.h \
|
|
gimpmenufactory.c \
|
|
gimpmenufactory.h \
|
|
gimpmessagebox.c \
|
|
gimpmessagebox.h \
|
|
gimpnavigationpreview.c \
|
|
gimpnavigationpreview.h \
|
|
gimppaletteeditor.c \
|
|
gimppaletteeditor.h \
|
|
gimppaletteselect.c \
|
|
gimppaletteselect.h \
|
|
gimppatternfactoryview.c \
|
|
gimppatternfactoryview.h \
|
|
gimppatternselect.c \
|
|
gimppatternselect.h \
|
|
gimppdbdialog.c \
|
|
gimppdbdialog.h \
|
|
gimppluginaction.c \
|
|
gimppluginaction.h \
|
|
gimppreview-popup.c \
|
|
gimppreview-popup.h \
|
|
gimppreviewrenderer.c \
|
|
gimppreviewrenderer.h \
|
|
gimppreviewrenderer-utils.c \
|
|
gimppreviewrenderer-utils.h \
|
|
gimppreviewrendererbrush.c \
|
|
gimppreviewrendererbrush.h \
|
|
gimppreviewrendererdrawable.c \
|
|
gimppreviewrendererdrawable.h \
|
|
gimppreviewrenderergradient.c \
|
|
gimppreviewrenderergradient.h \
|
|
gimppreviewrendererimage.c \
|
|
gimppreviewrendererimage.h \
|
|
gimppreviewrendererimagefile.c \
|
|
gimppreviewrendererimagefile.h \
|
|
gimppreviewrendererlayer.c \
|
|
gimppreviewrendererlayer.h \
|
|
gimppreviewrenderervectors.c \
|
|
gimppreviewrenderervectors.h \
|
|
gimpprogressbox.c \
|
|
gimpprogressbox.h \
|
|
gimpprogressdialog.c \
|
|
gimpprogressdialog.h \
|
|
gimppropwidgets.c \
|
|
gimppropwidgets.h \
|
|
gimpselectiondata.c \
|
|
gimpselectiondata.h \
|
|
gimpselectioneditor.c \
|
|
gimpselectioneditor.h \
|
|
gimpsessioninfo.c \
|
|
gimpsessioninfo.h \
|
|
gimpstringaction.c \
|
|
gimpstringaction.h \
|
|
gimpstrokeeditor.c \
|
|
gimpstrokeeditor.h \
|
|
gimptemplateeditor.c \
|
|
gimptemplateeditor.h \
|
|
gimptemplateview.c \
|
|
gimptemplateview.h \
|
|
gimptexteditor.c \
|
|
gimptexteditor.h \
|
|
gimpthumbbox.c \
|
|
gimpthumbbox.h \
|
|
gimptoolbox.c \
|
|
gimptoolbox.h \
|
|
gimptoolbox-color-area.c \
|
|
gimptoolbox-color-area.h \
|
|
gimptoolbox-dnd.c \
|
|
gimptoolbox-dnd.h \
|
|
gimptoolbox-image-area.c \
|
|
gimptoolbox-image-area.h \
|
|
gimptoolbox-indicator-area.c \
|
|
gimptoolbox-indicator-area.h \
|
|
gimptooldialog.c \
|
|
gimptooldialog.h \
|
|
gimptooloptionseditor.c \
|
|
gimptooloptionseditor.h \
|
|
gimptoolview.c \
|
|
gimptoolview.h \
|
|
gimpuimanager.c \
|
|
gimpuimanager.h \
|
|
gimpundoeditor.c \
|
|
gimpundoeditor.h \
|
|
gimpunitcombobox.c \
|
|
gimpunitcombobox.h \
|
|
gimpunitstore.c \
|
|
gimpunitstore.h \
|
|
gimpvectorstreeview.c \
|
|
gimpvectorstreeview.h \
|
|
gimpview.c \
|
|
gimpview.h \
|
|
gimpviewablebutton.c \
|
|
gimpviewablebutton.h \
|
|
gimpviewabledialog.c \
|
|
gimpviewabledialog.h \
|
|
gimpwidgets-constructors.c \
|
|
gimpwidgets-constructors.h \
|
|
gimpwidgets-utils.c \
|
|
gimpwidgets-utils.h \
|
|
gtkwrapbox.c \
|
|
gtkwrapbox.h \
|
|
gtkhwrapbox.c \
|
|
gtkhwrapbox.h \
|
|
gtkvwrapbox.c \
|
|
gtkvwrapbox.h
|
|
|
|
libappwidgets_a_built_sources = widgets-enums.c
|
|
|
|
libappwidgets_a_SOURCES = \
|
|
$(libappwidgets_a_built_sources) $(libappwidgets_a_sources)
|
|
|
|
EXTRA_DIST = makefile.msc
|
|
|
|
#
|
|
# rules to generate built sources
|
|
#
|
|
# setup autogeneration dependencies
|
|
gen_sources = xgen-wec
|
|
CLEANFILES = $(gen_sources)
|
|
|
|
$(srcdir)/widgets-enums.c: $(srcdir)/widgets-enums.h $(GIMP_MKENUMS)
|
|
$(GIMP_MKENUMS) \
|
|
--fhead "#include \"config.h\"\n#include <gtk/gtk.h>\n#include \"widgets-enums.h\"\n#include \"gimp-intl.h\"" \
|
|
--fprod "\n/* enumerations from \"@filename@\" */" \
|
|
--vhead "GType\n@enum_name@_get_type (void)\n{\n static const G@Type@Value values[] =\n {" \
|
|
--vprod " { @VALUENAME@, @valuedesc@, \"@valuenick@\" }," \
|
|
--vtail " { 0, NULL, NULL }\n };\n\n static GType type = 0;\n\n if (! type)\n type = g_@type@_register_static (\"@EnumName@\", values);\n\n return type;\n}\n" \
|
|
$(srcdir)/widgets-enums.h > xgen-wec \
|
|
&& cp xgen-wec $(@F) \
|
|
&& rm -f xgen-wec
|