Commit graph

2157 commits

Author SHA1 Message Date
Michael Natterer
cf4a649f38 renamed gimp_ui_manager_get_action() to gimp_ui_manager_find_action().
2004-12-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: renamed
	gimp_ui_manager_get_action() to gimp_ui_manager_find_action().

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/display/gimpdisplayshell-close.c: changed accordingly.

	(this change is quite useless as it stands, but will help keeping
	the diff between 2.2 and 2.3 small as soon as we're branched).

	* app/widgets/gimpcolormapeditor.c
	(gimp_colormap_preview_button_press): invoke the "edit-color", not
	"new-color" action upon double click.

	(palette_editor_select_entry): update the ui manager after
	selecting the entry so the entry-specific actions become sensitive
	if there was no entry selected before.
2004-12-08 13:52:28 +00:00
Michael Natterer
d90360e29f added new prop_widget gimp_prop_int_combo_box_new() which takes a
2004-12-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added new prop_widget
	gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore
	and allows to create views on int properties with arbitrary sets
	of values (not just enums).

	* app/widgets/gimpcontrollereditor.c
	(gimp_controller_editor_constructor): added support for generic
	combo boxes controlled exclusively by controller properties: if an
	int property "foo" is followed by an object property "foo-values"
	and the contained object is a GimpIntStore, use that store as
	model for selecting "foo"'s values using
	gimp_prop_int_combo_box_new().

	(Allows for more flexible controller configuration, the actual use
	case in the midi controller is still work in progress).
2004-12-08 12:46:21 +00:00
Michael Natterer
d8337d6f24 improved error message about missing XML files.
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved
	error message about missing XML files.
2004-12-01 13:27:03 +00:00
Michael Natterer
841efd0e2e app/display/gimpdisplayshell-appearance.c app/display/gimpdisplayshell.c
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get()
	actually returns something. Prevents crashes caused by missing
	ui manager xml files. Fixes bug #159346.
2004-12-01 00:13:48 +00:00
Michael Natterer
495963276a no need to update the ui manager here, the parent class already does it.
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need
	to update the ui manager here, the parent class already does it.
2004-12-01 00:06:23 +00:00
Michael Natterer
d669e4a498 allow to set color and viewable to NULL, GimpAction handles this nicely.
2004-11-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_set_action_color)
	(gimp_action_group_set_action_color): allow to set color and
	viewable to NULL, GimpAction handles this nicely. Fixes warnings
	some foo_actions_update() functions were triggering.
2004-11-30 00:30:05 +00:00
Sven Neumann
eb7b317d36 app/main.c app/widgets/gimpenumstore.h app/widgets/gimpunitstore.c applied
2004-11-27  Sven Neumann  <sven@gimp.org>

	* app/main.c
	* app/widgets/gimpenumstore.h
	* app/widgets/gimpunitstore.c
	* plug-ins/common/retinex.c: applied patch by Tim Mooney that
	removes extraneous ;
2004-11-27 12:09:13 +00:00
Michael Natterer
6d63d50040 guarded the whole header with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION
2004-11-24  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcontroller.[ch]: guarded the whole header
	with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no
	fixed API yet. Added a "state" property bacause "name" was abused
	as the controller's state. Added "help_domain" to the controller
	class.

	* libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h

	* modules/controller_linux_input.c
	* modules/controller_midi.c: set the "name" property to the name
	retrieved from the device, or to a default string if no name is
	available. Store the status in the "state" property. Added and
	changed some strings, but it's better to have the controller
	strings untranslated than to have no tooltips at all or misleading
	labels.

	* app/widgets/gimpcontrollerkeyboard.c
	* app/widgets/gimpcontrollerwheel.c: set default strings for both.

	* app/widgets/gimpcontrollereditor.c: added a GUI for the "state"
	property.

	* app/widgets/gimpcontrollerkeyboard.h
	* app/widgets/gimpcontrollerwheel.h
	* app/widgets/gimpcontrollerinfo.c
	* app/widgets/gimpcontrollers.c: #define
	GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files
	above).

	* app/widgets/gimphelp-ids.h: added the IDs of all controller
	modules and also of all other modules. The defines are not
	actually used, but this file is the canonical place to collect all
	the core's help IDs.
2004-11-24 02:17:12 +00:00
Michael Natterer
d8a5ca6c1b added new function gimp_toggle_button_set_visible() which can be used as
2004-11-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_toggle_button_set_visible() which can be used as "toggled"
	callback on a GtkToggleButton and sets a widget (in)visible
	according to the toggle's "active" state.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c: use it to hide (rather than
	just insensitize) the seldomly used "Feather edges", "Autoshrink
	selection", "Adaptive supersampling", "Fade out" and "Use color
	from gradient" widgets when their enabling toggle is unchecked.
	Makes the affected tool options much less crowded and noisy in
	their default appearance. Fixes bug #159008.
2004-11-23 17:01:51 +00:00
Michael Natterer
69ead3955c always create the event mapping table. Fixes tons of warnings and
2004-11-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init):
	always create the event mapping table. Fixes tons of warnings and
	non-functional controller mapping dialog when an empty controller
	was deserialized from controllerrc. Spotted by drc.
2004-11-22 21:46:23 +00:00
Hans Breuer
696663a611 [new file] app/dialogs/Makefile.am : added to EXTRA_DIST
2004-09-21  Hans Breuer  <hans@breuer.org>

	* app/dialogs/makefile.msc : [new file]
	  app/dialogs/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc app/gimpcore.def : updated

	* app/gimp.rc : let wilber be first

	* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either

	* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib

	* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32

	* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h

	* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/scrip-fu.c : there
	is no script-fu-server on win32
2004-11-21 14:22:45 +00:00
Michael Natterer
567bb7b2db added boolean property "value-variable" which specifies if the
2004-11-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpenumaction.[ch]: added boolean property
	"value-variable" which specifies if the GimpEnumAction::selected()
	signal may be emitted with arbirtary values (value-variable = TRUE)
	or *only* with enum_action->value (value-variable = FALSE).

	* app/widgets/gimpactiongroup.[ch]: added "gboolean
	value_variable" to GimpEnumActionEntry and set it in
	gimp_action_group_add_enum_actions().

	* app/actions/channels-actions.c
	* app/actions/colormap-editor-actions.c
	* app/actions/context-actions.c
	* app/actions/drawable-actions.c
	* app/actions/edit-actions.c
	* app/actions/error-console-actions.c
	* app/actions/gradient-editor-actions.c
	* app/actions/image-actions.c
	* app/actions/layers-actions.c
	* app/actions/palette-editor-actions.c
	* app/actions/plug-in-actions.c
	* app/actions/vectors-actions.c
	* app/actions/view-actions.c: set "variable" to FALSE for all enum
	actions except those which are used with the GIMP_ACTION_SELECT_SET
	voodoo.

	* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
	fall back to gtk_action_activate() if the action specified in a
	GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables
	triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events
	(like midi note-on and note-off).
2004-11-18 16:04:41 +00:00
Michael Natterer
30164f1be2 added back the .xcf.gz and .xcf.bz2 extensions because they are the only
2004-11-18  Michael Natterer  <mitch@gimp.org>

	* plug-ins/common/compressor.c (compressors): added back the
	.xcf.gz and .xcf.bz2 extensions because they are the only way
	to figure the special nature of this plug-in's extensions.

	* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
	extensions" (extensions which have a '.' themselves).

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	try to replace the whole extension if the last extension is one of
	the meta extensions kept by GimpFileProcView. Fixes bug #158377.
2004-11-18 11:50:25 +00:00
Manish Singh
f12184a72e Hide SVG drop g_print under be_verbose.
2004-11-16  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under
        be_verbose.
2004-11-17 03:42:47 +00:00
Michael Natterer
fb87f44701 get rid of the gimp_fg_bg_editor_context_changed() callback and
2004-11-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfgbgeditor.c: get rid of the
	gimp_fg_bg_editor_context_changed() callback and
	g_signal_connect_swapped() gtk_widget_queue_draw() directly.
2004-11-16 18:53:54 +00:00
Michael Natterer
1e4dc95ec2 implement GimpDockedInterface::set_context() and set the context of the
2004-11-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpchanneltreeview.c: implement
	GimpDockedInterface::set_context() and set the context of the
	embedded GimpComponentEditor. Fixes NULL-context crashes in
	action callbacks when invoked from the component editor.
	Spotted by Jimmac.

	Unrelated:

	* app/widgets/gimpitemtreeview.c: get rid of the
	gimp_item_tree_view_context_changed() callback and
	g_signal_connect_swapped() gimp_item_tree_view_set_image()
	directly.
2004-11-16 18:36:48 +00:00
Sven Neumann
d4bf381c20 app/actions/file-commands.c app/dialogs/file-save-dialog.c
2004-11-16  Sven Neumann  <sven@gimp.org>

	* app/actions/file-commands.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-save.[ch]
	* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
	"set_image_clean" parameters into a single "save_a_copy"
	parameter.  When saving a copy, attach the used URI to the image and
	let the "Save a Copy" file chooser default to the last used value.
2004-11-16 13:37:36 +00:00
Sven Neumann
c286aece5d limit the number of file extensions that are added to the file filter menu
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	limit the number of file extensions that are added to the file
	filter menu to keep the file dialog from growing too wide.
2004-11-15 19:33:24 +00:00
Sven Neumann
fb0985a1c3 app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc) better fix
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	better fix for bug #158369.
2004-11-15 13:50:02 +00:00
Sven Neumann
562b1595f2 better fix for bug #158369.
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	better fix for bug #158369.
2004-11-15 13:42:22 +00:00
Sven Neumann
e196a77246 return early if gimp_file_proc_view_get_proc() didn't return a file
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	return early if gimp_file_proc_view_get_proc() didn't return a file
	procedure. Should fix bug #158369.
2004-11-15 13:38:00 +00:00
Sven Neumann
869a1b680d started to redo this dialog without using a GimpSizeBox. The widgets
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/dialogs/print-size-dialog.c: started to redo this dialog
	without using a GimpSizeBox. The widgets aren't connected, so it
	isn't usable yet.

	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpsizebox.c: trivial cleanups.

	* data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac.
2004-11-14 23:51:46 +00:00
Manish Singh
5d01581069 Fix a bunch of warnings from Sparse:
2004-11-13  Manish Singh  <yosh@gimp.org>

        Fix a bunch of warnings from Sparse:

        * app/actions/dockable-commands.c
        * app/actions/layers-actions.c
        * app/actions/view-commands.c
        * app/base/pixel-surround.c
        * app/config/gimpconfig-utils.c
        * app/config/gimpscanner.c
        * app/core/gimpbrushgenerated.c
        * app/core/gimpcontainer.c
        * app/core/gimpimage.c
        * app/dialogs/palette-import-dialog.c
        * app/file/gimprecentlist.c
        * app/plug-in/plug-in-params.c
        * app/text/gimptext-compat.c
        * app/text/gimptext-parasite.c
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpstroke.c
        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimpselectiondata.c
        * app/xcf/xcf.c
        * libgimp/gimp.c
        * libgimpthumb/gimpthumb-utils.c
        * libgimpthumb/gimpthumbnail.c
        * modules/cdisplay_proof.c
        * plug-ins/Lighting/lighting_ui.c
        * plug-ins/common/csource.c
        * plug-ins/common/glasstile.c
        * plug-ins/common/nova.c
        * plug-ins/common/pcx.c
        * plug-ins/common/pnm.c
        * plug-ins/common/randomize.c
        * plug-ins/common/screenshot.c
        * plug-ins/common/sel_gauss.c
        * plug-ins/common/spheredesigner.c
        * plug-ins/common/wind.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gimpressionist/gimpressionist.c
        * plug-ins/ifscompose/ifscompose.c
        * plug-ins/print/gimp_main_window.c
        * plug-ins/print/print.c: Cleanup integer vs. pointer confusion.

        * app/base/temp-buf.c
        * app/dialogs/about-dialog.c
        * plug-ins/common/bumpmap.c
        * plug-ins/common/jigsaw.c
        * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.

        * app/config/gimpconfig-deserialize.c
        * app/config/gimpconfig-path.c
        * app/config/gimpconfigwriter.c
        * app/core/gimpgradient.c
        * app/tools/gimpdrawtool.c
        * plug-ins/common/nlfilt.c
        * plug-ins/common/unsharp.c
        * plug-ins/common/zealouscrop.c: Define inline functions before they
        are used.

        * app/core/gimpdrawable-blend.c: PixelRegion definition was changed
        some time ago, but the initialization here didn't change. Fix it.

        * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
        assign token twice in a row.

        * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
        need to initialize file_data, since the code fills out all the fields.

        * plug-ins/common/CML_explorer.c
        * plug-ins/common/vpropagate.c: Declare function pointers fully.

        * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
        we assume we can use the "inline" keyword always.

        * plug-ins/common/psd_save.c
        * plug-ins/common/vinvert.c
        * plug-ins/gfig/gfig-arc.c
        * plug-ins/gfig/gfig-bezier.c
        * plug-ins/gfig/gfig-circle.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gfig/gfig-ellipse.c
        * plug-ins/gfig/gfig-line.c
        * plug-ins/gfig/gfig-poly.c
        * plug-ins/gfig/gfig-spiral.c
        * plug-ins/gfig/gfig-star.c
        * plug-ins/gfig/gfig.c
        * plug-ins/gimpressionist/orientmap.c
        * plug-ins/gimpressionist/placement.c
        * plug-ins/gimpressionist/sizemap.c
        * plug-ins/imagemap/imap_grid.c
        * plug-ins/imagemap/imap_main.c
        * plug-ins/imagemap/imap_preferences.c
        * plug-ins/imagemap/imap_settings.c
        * plug-ins/maze/maze.c
        * plug-ins/sel2path/curve.c
        * plug-ins/sel2path/fit.c
        * plug-ins/sel2path/pxl-outline.c
        * plug-ins/sel2path/spline.c
        * plug-ins/xjt/xjt.c: Functions with no args should be declared
        with (void).

        * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
        the compiler.
2004-11-14 02:50:33 +00:00
Sven Neumann
9ac6ecef0a app/dialogs/Makefile.am new files for the Print Size dialog that is still
2004-11-13  Sven Neumann  <sven@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/print-size-dialog.[ch]: new files for the Print Size
	dialog that is still missing. Still work in progress...

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: integrate the new dialog.
2004-11-13 22:27:39 +00:00
Sven Neumann
1fdcd8bee8 allow a smaller brush radius to be set in the brush editor. Fixes bug
2004-11-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpbrusheditor.c: allow a smaller brush radius to
	be set in the brush editor. Fixes bug #157508.
2004-11-06 18:55:06 +00:00
Sven Neumann
ce7f034638 fixed most of the Reset functionality (bug #157495). The offset box is
2004-11-06  Sven Neumann  <sven@gimp.org>

	* app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of
	the Reset functionality (bug #157495). The offset box is still not
	working correctly.

	* app/widgets/gimpsizebox.c (gimp_size_box_update_resolution):
	check for availability of the size entry before accessing it.
2004-11-06 12:30:38 +00:00
Sven Neumann
a24047788c be more tolerant and silently skip entries that the dialog factory doesn't
2004-11-04  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c: be more tolerant and silently
	skip entries that the dialog factory doesn't recognize.

	* app/widgets/gimpdialogfactory.c: minor cleanup.
2004-11-04 21:02:34 +00:00
Michael Natterer
5d7b121fd7 Don't use deprecated GtkToolbar API in GimpTextEditor:
2004-11-04  Michael Natterer  <mitch@gimp.org>

	Don't use deprecated GtkToolbar API in GimpTextEditor:

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/text-editor-actions.[ch]
	* app/actions/text-editor-commands.[ch]: added acions and
	callbacks for the new "text-editor" action group.

	* app/menus/menus.c: register a "<TextEditor>" UI manager.

	* menus/Makefile.am
	* menus/text-editor-toolbar.xml: new file for the toolbar.

	* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
	UI manager instead of constructing it using deprecated API.

	* app/tools/gimptextoptions.c: changed accordingly.

	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
	(used by text-editor-commands.c).
2004-11-04 14:24:32 +00:00
Michael Natterer
40928bb578 use a GtkUIManager instead of a GtkItemFactory. Added virtual function
2004-11-04  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
	of a GtkItemFactory. Added virtual function ::get_action_type()
	and create the manager's actions manually using that action type
	instead of using gtk_action_group_add_actions().

	* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
	creates GimpActions (which can have a color attached) instead of
	GtkActions. Changed the menu item visibility and color preview
	code accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpitemfactory.[ch]: finally removed.

	* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
2004-11-04 12:15:49 +00:00
Michael Natterer
29de307128 don't forget to g_free(editor->segments).
2004-11-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't
	forget to g_free(editor->segments).
2004-11-03 14:31:51 +00:00
Michael Natterer
c568322c43 app/display/gimpscalecombobox.c (gimp_scale_combo_box_mru_remove_last)
2004-11-03  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpscalecombobox.c
	(gimp_scale_combo_box_mru_remove_last)
	* app/widgets/gimpeditor.c (gimp_editor_add_action_button)
	* app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.
2004-11-03 11:50:37 +00:00
Sven Neumann
c70b12137b plugged a mem-leak.
2004-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	plugged a mem-leak.

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_render): don't leak the pixbuf.

	* app/widgets/gimpviewrenderer-frame.c: added a comment.
2004-11-03 00:48:06 +00:00
Sven Neumann
caac418cb2 don't check for file_proc->menu_paths. Our load and save procedure don't
2004-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	don't check for file_proc->menu_paths. Our load and save procedure
	don't necessarily register a menu path any longer.

	* app/plug-in/plug-ins.c: minor cleanup.

	* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
	XCF load and save procedures.

	* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.

	* app/pdb/fileops_cmds.c
	* libgimp/gimpfileops_pdb.c: regenerated.
2004-11-01 15:44:57 +00:00
Sven Neumann
d254eaf3d5 set the active image. Fixes bug #156942.
2004-10-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpimageeditor.c (gimp_image_editor_set_context):
	set the active image. Fixes bug #156942.
2004-10-31 11:46:00 +00:00
Sven Neumann
fcbe26d888 added a size entry to edit the resolution. This should close bug #151022.
2004-10-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.c: added a size entry to edit the
	resolution. This should close bug #151022.
2004-10-30 23:55:34 +00:00
Øyvind Kolås
ae30cacd28 addition of white balance in menus, and related code reorganization 2004-10-29 22:18:49 +00:00
Sven Neumann
a27b0bff1c app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load) only be verbose
2004-10-29  Sven Neumann  <sven@gimp.org>

        * app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load)
        * app/widgets/gimpclipboard.c (gimp_clipboard_init): only be
        verbose on request.

        * app/plug-in/plug-in.c (plug_in_close): turned warnings into
        messages and respect gimp->be_verbose.
2004-10-29 21:54:32 +00:00
Michael Natterer
4a4a1096d5 added foreign entries for the keyboard shortcut and the controller action
2004-10-29  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/dialogs.c (toplevel_entries): added foreign entries
	for the keyboard shortcut and the controller action dialogs.

	* app/dialogs/preferences-dialog.c
	* app/widgets/gimpcontrollereditor.c: register the dialogs with
	the "toplevel" dialog factory so they remember their size and
	position.
2004-10-29 10:58:16 +00:00
Michael Schumacher
e718a6817c fixed a typo in #include "libgimpbase/gimpwin32-io.h"
2004-10-27  Michael Schumacher <schumaml@gmx.de>

	* app/widgets/gimpwidgets-utils.c: fixed a typo in
	#include "libgimpbase/gimpwin32-io.h"
2004-10-27 19:02:04 +00:00
Sven Neumann
4349469e3c changed menu label from "Show Image Menu" to "Show Image Selection".
2004-10-27  Sven Neumann  <sven@gimp.org>

	* app/actions/dockable-actions.c (dockable_toggle_actions): changed
	menu label from "Show Image Menu" to "Show Image Selection".

	* app/widgets/gimpsizebox.c: unmarked a string for translation.

	* app/dialogs/scale-dialog.c: added back the message when scaling
	an indexed image.
2004-10-27 15:59:52 +00:00
Sven Neumann
fffebe8ec2 app/dialogs/Makefile.am a wrapper around the scale dialog that takes care
2004-10-27  Sven Neumann  <sven@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale
	dialog that takes care verifying the user input and optionally
	asking for confirmation. Most of this moved out of image-commands.c.

	* app/actions/image-commands.c: use the new image scale dialog
	even though it doesn't allow to edit the resolution yet. That's a
	temporary regression that will get fixed soon.

	* app/actions/layers-commands.c: cosmetics.

	* app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the
	resolution.

	* app/widgets/gimpsizebox.c: fixed cut'n'paste error.
2004-10-27 01:20:07 +00:00
Sven Neumann
b0330f95d4 added a resolution label similar to one in the template editor. Prepared
2004-10-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsizebox.[ch]: added a resolution label similar
	to one in the template editor. Prepared for editable resolution,
	work in progress...

	* app/dialogs/scale-dialog.[ch]: added resolution and resolution
	unit parameters to ScaleDialogCallback.

	* app/actions/layers-commands.c: changed accordingly.
2004-10-26 23:31:34 +00:00
Sven Neumann
664b5a0a09 commented out the memory size label. The visual clutter of it's bold
2004-10-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: commented out the memory size
	label. The visual clutter of it's bold appearance was IMO not
	appropriate. I think the dialog is better without it.

	* app/widgets/gimpsizebox.c: added a pixel size label as in the
	Image New dialog.
2004-10-26 21:18:20 +00:00
Michael Natterer
2075f1e742 added parameter "const gchar *select_action" and preselect the passed
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionview.[ch] (gimp_action_view_new): added
	parameter "const gchar *select_action" and preselect the passed
	action if non-NULL. Made the column enum public to users of this
	widget can get data from its tree store.

	* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
	pass NULL because we don't want a preselected action here.

	* app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete"
	buttons to change the event -> action mapping. Implement a action
	chooser dialog using GimpActionView. Fixes bug #106920.
2004-10-26 15:10:00 +00:00
Sven Neumann
1ee62f771e app/actions/channels-commands.c app/core/gimpchannel-select.c
2004-10-26  Sven Neumann  <sven@gimp.org>

	* app/actions/channels-commands.c
	* app/core/gimpchannel-select.c
	* app/core/gimpimagefile.c
	* app/core/gimpundo.c
	* app/widgets/gimpcomponenteditor.c: use the new enum utility
	functions from libgimpbase instead of accessing enum_value->value_name.
2004-10-26 14:45:25 +00:00
Michael Natterer
ea1b88f580 app/widgets/Makefile.am app/widgets/widgets-types.h new widget built from
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollereditor.[ch]: new widget built from
	preliminary code from the prefs dialog. Prerequisite for finally
	fixing bug #106920.

	* app/dialogs/preferences-dialog.c: use the new widget.
2004-10-26 12:26:47 +00:00
Michael Natterer
6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Michael Natterer
e88a663631 app/actions/gradient-editor-commands.c irrelevant coding style and spacing
2004-10-25  Michael Natterer  <mitch@gimp.org>

	* app/actions/gradient-editor-commands.c
	* app/display/gimpdisplayshell-preview.c: irrelevant coding style
	and spacing cleanups.

	* app/widgets/gimpimageeditor.c: removed utility function
	gimp_image_editor_context_changed() and connect
	gimp_image_editor_set_image() directly using
	g_signal_connect_swapped().
2004-10-25 12:42:23 +00:00
Michael Natterer
df34354784 added gimp_text_buffer_save() which saves a GtkTextBuffer's contents to a
2004-10-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save()
	which saves a GtkTextBuffer's contents to a file.

	* app/widgets/gimperrorconsole.c: use
	gimp_editor_add_action_button() and removed all "clicked"
	callbacks, including all file saving code.

	* app/actions/error-console-actions.c
	* app/actions/error-console-commands.[ch]: added the code removed
	above to the action callbacks. Use gimp_text_buffer_save().
2004-10-24 22:26:11 +00:00
Michael Natterer
714771d450 app/widgets/gimpgradienteditor.[ch] added public APIs for zooming the
2004-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: added public APIs for
	zooming the editors. Use gimp_editor_add_action_button() to create
	all buttons. Removed all button callbacks and all duplicated
	button sensitivity logic.

	* app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update
	the editor's UI manager if it exists.

	* app/actions/gradient-editor-actions.c
	* app/actions/gradient-editor-commands.[ch]: added zoom actions
	and callback and call gimp_gradient_editor_zoom(). Fixed
	gradient_editor_actions_update() to actually set all items'
	sensitivity (it was possible to modify read-only gradients and
	even to crash GIMP).

	* app/actions/palette-editor-actions.c
	* app/actions/palette-editor-commands.[ch]: changed "new" and
	"zoom" actions to actually do their job instead of calling
	gtk_button_clicked(editor->foo_button).
2004-10-24 20:38:35 +00:00
Michael Natterer
8afbb733c7 removed the "Edit Color" dialog callbacks and use
2004-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.c: removed the "Edit Color"
	dialog callbacks and use gimp_editor_add_action_button() for
	the edit button. Removed button sensitivity logic. Hide the
	color dialog when the image's mode changes.

	* app/actions/colormap-editor-actions.c: added missing tooltip
	for the edit action.

	* app/actions/colormap-editor-commands.c: implement the dialog
	here.
2004-10-24 18:32:24 +00:00
Sven Neumann
ea273aadb9 libgimpthumb/gimpthumb-utils.[ch] libgimpthumb/gimpthumbnail.[ch] added
2004-10-23  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumbnail.[ch]
	* libgimpthumb/gimpthumb.def: added missing API, mainly for deleting
	thumbnails.

	* app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a
	failure thumbnail if one exists. Unless the thumbnail was created
	explicitely, remove all other thumbnails for this image.

	* app/actions/documents-commands.c: changed accordingly.

	* app/file/file-open.c: only save a thumbnail if there isn't a
	valid thumbnail already.

	* app/widgets/gimpthumbbox.c: before attempting to create a new
	thumbnail, check if there's an uptodate failure thumbnail.
2004-10-23 15:30:39 +00:00
Michael Natterer
6e9d0cfa5d added labels ("_Stroke") to the SLEECTION_STROKE and PATH_STROKE stock
2004-10-23  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
	SLEECTION_STROKE and PATH_STROKE stock items so they can be used
	in action areas.

	* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
	with "_Stroke" and reordered some code.

	* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
	of GTK_STOCK_OK. Added parameters to specify the dialog's title
	so it doesn't say "Stroke Options".

	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
	Path" as dialog titles.
2004-10-23 10:28:56 +00:00
Michael Natterer
fd6d30fd30 When there are variants of actions with and without dialog, let the
2004-10-23  Michael Natterer  <mitch@gimp.org>

	When there are variants of actions with and without dialog, let
	the dialog-less actions try to use the values from the last dialog
	invocation:

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
	actions to foo-new-last-values and use the last values entered in
	the dialogs.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
	the dialog on clicking "New" and call the last-values action on
	<shift>+click.

	* app/actions/select-actions.c
	* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
	to -last-values.

	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpvectorstreeview.c: stroke with last values on
	<shift> clicking the stroke buttons.
2004-10-23 00:53:48 +00:00
Michael Natterer
59bd430526 make sure the button_box is always interted at the very bottom of the
2004-10-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make
	sure the button_box is always interted at the very bottom of the
	editor.

	* app/widgets/gimpviewabledialog.c: changed the "description"
	property from CONSTRUCT_ONLY to CONSTRUCT.

	* app/widgets/gimpcolormapeditor.c: show the index of the edited
	color in the color dialog and use the correct icon. Replaced label
	"Hex triplet" by "HTML notation" to be consistent with the color
	dialog. Removed wrong 2 pixel border around the table below the
	preview.
2004-10-22 15:41:03 +00:00
Sven Neumann
341b6da981 app/actions/colormap-editor-actions.c app/actions/dialogs-actions.c
2004-10-22  Sven Neumann  <sven@gimp.org>

	* app/actions/colormap-editor-actions.c
	* app/actions/dialogs-actions.c
	* app/core/gimpimage-colormap.c
	* app/dialogs/convert-dialog.c
	* app/dialogs/dialogs.c
	* app/widgets/gimpcolormapeditor.c: use the term "Colormap"
	instead of "Indexed Palette". Fixes bug #155829.
2004-10-22 14:43:43 +00:00
Michael Natterer
14a2a2aa09 remember the param_spec with each radio button instead of with the
2004-10-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c: remember the param_spec with each
	radio button instead of with the box/frame around them.
2004-10-22 02:15:14 +00:00
Michael Natterer
c84475c989 moved "item_type" and "signal_name" from GimpItemTreeView to
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
	"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
	Removed them from gimp_item_tree_view_new(). Require the view_type
	instead of item_type in gimp_item_tree_view_new().

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpdrawabletreeview.c (get_type): made them
	abstract base classes.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c (class_init): set the
	item_type and signal_name members if GimpItemTreeViewClass.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2004-10-16 20:17:30 +00:00
Michael Natterer
ea1dc9ab9f added utility function gimp_ui_manager_get_action() which takes
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: added utility function
	gimp_ui_manager_get_action() which takes "group_name" and
	"action_name".

	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: use it.
2004-10-16 17:29:42 +00:00
Michael Natterer
f4d7260c64 app/actions/channels-actions.c app/actions/colormap-editor-actions.c
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/actions/channels-actions.c
	* app/actions/colormap-editor-actions.c
	* app/actions/documents-actions.c
	* app/actions/tool-options-actions.c
	* app/actions/vectors-actions.c: added more tooltips for actions
	which are used as extended dialog button callbacks.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
	the list of extended actions in reverse order.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: don't set the tooltips
	manually. Removes another bunch of insane translatable multiline
	format strings. Pass the extended actions in the right order
	to gimp_editor_add_action_button().
2004-10-16 17:10:04 +00:00
Michael Natterer
8effb0cfaf Ported the layers, channels and paths dialogs from
2004-10-16  Michael Natterer  <mitch@gimp.org>

	Ported the layers, channels and paths dialogs from
	gimp_editor_add_button() to gimp_editor_add_action_button(),
	removing a massive amount of duplicated code, sensitivity logic
	and confusing utility functions.

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: added "foo-new-default"
	actions and callbacks which create items without a dialog,
	optionally using default values from a passed template. Removed
	all public utility function that were passed as function pointers
	to widget construtors. Added tooltips to all actions which are now
	used for dialog buttons.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
	automatically create multi-line tooltips showing the modifiers for
	extended action buttons. Removes the need for lots of insane
	format strings that need to be translated correctly.

	* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
	replaced tooltip and help_id strings by action names.

	(struct GimpItemTreeView)
	(gimp_item_tree_view_new): removed "edit", "new" and "activate"
	function pointers.

	(gimp_item_tree_view_constructor): create all buttons
	with gimp_editor_add_action_button(), using the action names
	from GimpItemTreeViewClass.

	Removed tons of "clicked" callbacks and all code which sets the
	buttons' sensitivity. They are not needed any longer.

	Require all subclasses to implement GimpItemTreeView::new_item(),
	a new virtual function which creates a plain new item without
	showing a dialog.

	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: fill in the action names and
	implement GimpItemTreeView::new_item(). Removed all button
	sensitivity logic.

	* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
	include anything from actions/ any more.
2004-10-16 15:48:23 +00:00
Michael Natterer
e2fd8ab534 Fixed bug #155328:
2004-10-15  Michael Natterer  <mitch@gimp.org>

	Fixed bug #155328:

	* app/actions/vectors-actions.c (vectors_actions_update): don't
	set the "selection to path" actions sensitive if there is no
	image.

	* app/widgets/gimpitemtreeview.c: update the UI manager after
	setting the view's image. Connect to GimpImage::flush() and
	update the UI manager in the callback, too.
2004-10-15 12:27:07 +00:00
Sven Neumann
428a80a1ee removed the "Density" label. It wasn't helpful and caused the transform
2004-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c: removed the "Density" label.
	It wasn't helpful and caused the transform options to be wider than
	necessary.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptransformoptions.c: let combo boxes expand
	horizontally like we do in other (all ?) dialogs.

	* app/widgets/gimptemplateeditor.c
	(gimp_template_editor_aspect_callback): update the pixel size label.
2004-10-14 22:55:18 +00:00
Michael Natterer
27c2be7cea libgimpwidgets/gimpwidgets.c app/widgets/gimpenumwidgets.[ch]
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.c
	* app/widgets/gimpenumwidgets.[ch]
	* app/widgets/gimppropwidgets.c
	* app/actions/layers-commands.c
	* app/dialogs/convert-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinkoptions-gui.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: the child of a GimpFrame must
	not have any border width. Fixes many subtle misalignments.
2004-10-14 15:44:13 +00:00
Sven Neumann
0b6f4114d8 added "message" function to the GimpProgress interface. Call
2004-10-14  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added "message" function to the
	GimpProgress interface. Call gimp_message() if it is unimplemented.

	* app/plug-in/plug-in-progress.[ch]: added new function
	plug_in_progress_message() that passes the message to the current
	proc_frame's progress.

	* app/widgets/gimpthumbbox.c: implement GimpProgress::message.
	Just do nothing in the implementation. We don't want to see
	messages from file plug-ins that we use to create the thumbnails.

	* tools/pdbgen/pdb/message.pdb
	* app/pdb/message_cmds.c: if there's a current plug-in, dispatch
	the message by calling plug_in_progress_message().

	* app/display/gimpdisplayshell-close.c: fixed wrong types in
	function calls.
2004-10-14 15:15:03 +00:00
Michael Natterer
6030036fe2 use GIMP_HELP_COLOR_DIALOG as help_id.
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use
	GIMP_HELP_COLOR_DIALOG as help_id.
2004-10-14 14:34:01 +00:00
Michael Natterer
1e4203e665 register GimpConvertPaletteType with the type system.
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch]: register GimpConvertPaletteType with
	the type system.

	* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
	fixed to insert the widget at the right place in the radio box.

	* app/dialogs/convert-dialog.c: use enum widgets and
	gimp_enum_radio_frame_add(), resulting in a much better looking
	dialog with much less lines of code.
2004-10-14 13:44:06 +00:00
Kevin Cozens
f92848d2ef Fixed a spelling error.
2004-10-13  Kevin Cozens  <kcozens@cvs.gimp.org>

    * app/widgets/gimpactionview.c: Fixed a spelling error.
2004-10-13 21:51:40 +00:00
Sven Neumann
479e65e388 improved handling of parent widget; probably just being paranoid here.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagedialog.c: improved handling of parent
	widget; probably just being paranoid here.

	* app/actions/image-commands.c
	* app/dialogs/image-new-dialog.c: ported memory size confirmation
	dialogs to GimpMessageDialog.
2004-10-13 19:02:37 +00:00
Sven Neumann
2b2737f2ad handle parent widget not being a GtkWindow by calling
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagedialog.c: handle parent widget not being
	a GtkWindow by calling gtk_widget_get_toplevel().

	* app/actions/data-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c: ported more boolean queries to
	GimpMessageDialog.
2004-10-13 15:27:00 +00:00
Sven Neumann
8300c550e3 app/widgets/Makefile.am app/widgets/widgets-types.h added a simple message
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagedialog.[ch]: added a simple message
	dialog to avoid code duplication.

	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

	* app/dialogs/file-save-dialog.c
	* app/dialogs/quit-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 14:35:28 +00:00
Sven Neumann
8a5502f89e changed the description for GIMP_HELP_BROWSER_GIMP.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-enums.[ch]: changed the description for
	GIMP_HELP_BROWSER_GIMP.

	* app/dialogs/file-save-dialog.c:
	* app/widgets/gimphelp.c: use a GimpDialog embedding a
	GimpMessageBox instead of gimp_query_boolean_box which looks
	somewhat old fashioned.
2004-10-13 11:57:07 +00:00
Sven Neumann
6b489baaeb improved error messages on missing help browser plug-in.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: improved error messages on missing help
	browser plug-in.

	* libgimpthumb/gimpthumb-utils.c
	* libgimpthumb/gimpthumbnail.c: improved documentation.
2004-10-13 10:34:02 +00:00
Sven Neumann
280a497f48 ref the imagefile while creating the thumbnail.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref
	the imagefile while creating the thumbnail.

	* app/core/gimpimagefile.[ch]
	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved
	the tricky part about thumbnail creation into the new function
	gimp_imagefile_create_thumbnail_weak().
2004-10-12 23:25:19 +00:00
Sven Neumann
ab6c609ce1 renamed struct member "unit" to "resolution_unit".
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: renamed struct member "unit" to
	"resolution_unit".

	* app/actions/image-commands.c
	* app/core/gimp-edit.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-undo-push.c
	* app/dialogs/info-window.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimptoolbox-dnd.c:
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit()
	where appropriate.

	* app/core/gimptemplate.c (gimp_template_set_from_image): fixed
	unit handling. Don't touch the template unit, it is used as the
	initial display unit. This will need further changes...
2004-10-12 21:28:53 +00:00
Michael Natterer
fcc342b00b need to pack the widget expanding. Fixes pattern container entries.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
	need to pack the widget expanding. Fixes pattern container
	entries.
2004-10-12 20:37:50 +00:00
Sven Neumann
22a1384b5a app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.

	* app/widgets/gimppropwidgets.c: the order of setting the X and Y
	properties does matter.

	* app/dialogs/Makefile.am
	* app/dialogs/scale-dialog.[ch]: added first version of a new
	Scale dialog in an attempt to address bug #151022.

	* app/actions/layers-commands.c: use the new scale dialog.
2004-10-12 14:59:14 +00:00
Sven Neumann
5ae3d5952b added mnemonics for the size entries.
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: added mnemonics for the size
	entries.
2004-10-12 14:14:16 +00:00
Michael Natterer
eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Sven Neumann
b09225b1a1 use a larger icon size for GimpImagefile views.
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger
	icon size for GimpImagefile views.

	* themes/Default/images/stock-frame-64.png: removed the 1 pixel
	wide empty border around the frame.

	* app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values.
2004-10-12 10:37:11 +00:00
Sven Neumann
9adf514e7d tweaked table spacings to get the Height label aligned with the entry
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.c: tweaked table spacings to get
	the Height label aligned with the entry again.
2004-10-12 00:12:31 +00:00
Sven Neumann
3a81bf7314 set the "skip_taskbar_hint" and "skip_pager_hint" properties on the
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set
	the "skip_taskbar_hint" and "skip_pager_hint" properties on the
	progress window.
2004-10-11 23:29:32 +00:00
Sven Neumann
5460383b57 construct a case-insensitive glob pattern to use when filtering for file
2004-10-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
	pattern to use when filtering for file extensions.
2004-10-11 11:57:32 +00:00
Michael Natterer
1db1a19574 user-visible counting starts at 1, not 0.
2004-10-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
	user-visible counting starts at 1, not 0.
2004-10-11 11:27:26 +00:00
Sven Neumann
9203906065 libgimpthumb/gimpthumb-utils.[ch] added an API to delete thumbnails.
2004-10-11  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumb.def: added an API to delete thumbnails.

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail):
	when recreating a thumbnail on user request, delete all existing
	thumbnails for it.

	* plug-ins/common/AlienMap2.c: removed unused variable.
2004-10-10 23:02:34 +00:00
Sven Neumann
bfeb12d2bb handle NULL as viewable parameter as a workaround for bug #149906.
2004-10-10  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c (gimp_container_view_lookup):
	handle NULL as viewable parameter as a workaround for bug #149906.

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made
	the code more robust.

	* app/xcf/xcf-private.h
	* app/xcf/xcf.c: added a const qualifier.
2004-10-10 14:33:01 +00:00
Sven Neumann
dc539fda18 tweaked the text shown while updating the preview so that the dialog
2004-10-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.c: tweaked the text shown while
	updating the preview so that the dialog doesn't need to resize.
2004-10-08 22:33:07 +00:00
Sven Neumann
ec693d7b09 app/config/gimpcoreconfig.[ch] added new gimprc option
2004-10-08  Sven Neumann  <sven@gimp.org>

	* app/config/gimpcoreconfig.[ch]
	* app/config/gimprc-blurbs.h: added new gimprc option
	"thumbnail-filesize-limit" that allows to control the maximum
	filesize for automatic thumbnail creation.

	* app/dialogs/preferences-dialog.c: added a GUI for it, needs
	review.

	* app/core/gimpimagefile.[ch]: minor cleanups. Moved call to
	gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to
	 gimp_imagefile_save_thumbnail() to avoid it being called twice.

	* app/file/file-utils.[ch]: export utility function
	file_utils_find_proc_by_extension() that allows to check for a
	file plug-in by looking at the filename extension only.

	* app/widgets/gimpthumbbox.[ch]: automatically create or update
	thumbnails for image files with a known extension that are smaller
	than "thumbnail-filesize-limit".  Fixes bug #137176.
2004-10-08 19:29:33 +00:00
Sven Neumann
299dad1de3 invalidate the preview when the toggle buttons are used. Reported by
2004-10-08  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/apply_lens.c (lens_dialog): invalidate the
	preview when the toggle buttons are used. Reported by Olivier.

	* app/widgets/gimpview.c: minor cleanup.
2004-10-08 18:09:41 +00:00
Michael Natterer
57f9d32e56 Made the text options about two toolbox grid columns smaller. Addresses
2004-10-08  Michael Natterer  <mitch@gimp.org>

	Made the text options about two toolbox grid columns smaller.
	Addresses bug #122862.

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
	the number of digits of the property's max_val plus two as number
	of chars for the sizeentry'y spinbutton (instead of always 10 as
	before).

	* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
	has a minimal width of 150 pixels (eek). Set a silly small minimal
	width instead (the entry expands to the available width anyway).
2004-10-08 14:00:41 +00:00
Sven Neumann
de68f16e72 added some (disabled) debug output.
2004-10-07  Sven Neumann  <sven@gimp.org>

	* libgimpthumb/gimpthumbnail.c: added some (disabled) debug output.

	* app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve
	the size of the frame borders.

	* app/widgets/gimpthumbbox.c: don't set an arbitrary padding but
	exactly the size of the frame borders. Otherwise we get large
	thumbnails (scaled down) if we request normal sized ones.
2004-10-07 21:38:35 +00:00
Michael Natterer
da1a2de846 remember for which GdkDragContext the icon_widget was made.
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for
	which GdkDragContext the icon_widget was made.

	(gimp_dnd_data_drag_end): destroy the icon_widget only if it was
	created for this GdkDragContext. Fixes broken DND icon_widgets
	when dragging the same source again while the old icon_widget is
	still floating back from an unsuccessful drop. Fixes bug #139337.
2004-10-06 18:55:24 +00:00
Sven Neumann
94b427de98 added a help button.
2004-10-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: added a help button.
2004-10-04 22:25:04 +00:00
Sven Neumann
62b5c77c76 app/config/gimpguiconfig.[ch] added gimprc option "show-help-button".
2004-10-04  Sven Neumann  <sven@gimp.org>

        * app/config/gimpguiconfig.[ch]
        * app/config/gimprc-blurbs.h: added gimprc option "show-help-button".

        * app/dialogs/preferences-dialog.c: added a GUI for it.

        * app/dialogs/file-save-dialog.c
        * app/dialogs/image-new-dialog.c
        * app/dialogs/quit-dialog.c
        * app/display/gimpdisplayshell-close.c
        * app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
        dialogs.

        * libgimpbase/gimpprotocol.[ch]
        * libgimp/gimp.[ch]: added boolean "show_help_button" to the
        config message.

        * app/plug-in/plug-in-run.c: pass the new preference to the plug-in.

        * libgimpwidgets/gimpdialog.[ch]: added new function that allows to
        set whether new dialogs should get a help button added.

        * app/gui/gui.c
        * libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
        to the gimprc settings.
2004-10-04 16:21:52 +00:00
Sven Neumann
65f0c88485 replaced the obtrusive drop-shadow by a thin white frame with a subtle
2004-10-01  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/stock-frame-64.png: replaced the obtrusive
	drop-shadow by a thin white frame with a subtle shadow. Taken from
	a mockup done by Jimmac.

	* app/widgets/gimpviewrenderer-frame.c: changed the hardcoded
	offsets for the new frame image :(
2004-10-01 11:17:46 +00:00
Sven Neumann
872c5a83ae fixed brokeness I introduced with my last cleanup.
2004-09-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness
	I introduced with my last cleanup.
2004-09-29 23:31:05 +00:00
Michael Natterer
2c74680ef6 code review / cleanup.
2004-09-28  Michael Natterer  <mitch@gimp.org>

	* app/core/gimppalette.c: code review / cleanup.

	(gimp_palette_delete_entry): don't add "Black" when the last color
	gets removed, a palette can easily live with zero colors.

	* app/widgets/gimppaletteeditor.c
	(palette_editor_invalidate_preview): also update the entry which
	shows the palette_entry's name.
2004-09-28 14:59:55 +00:00
Michael Natterer
2b45c7a302 removed hack which strcmp()s the property name to figure the preview's
2004-09-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview):
	removed hack which strcmp()s the property name to figure the
	preview's border_width and use the container view's
	preview_border_width instead.
2004-09-28 11:24:48 +00:00
Sven Neumann
cfd2c9c367 added a hack to get rid of the border drawn around thumbnails in the "Open
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack
	to get rid of the border drawn around thumbnails in the "Open Recent"
	menu.
2004-09-27 23:31:46 +00:00
Sven Neumann
fadd9ca045 added some padding for the shadow frame to avoid scaling the thumbnail.
2004-09-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some
	padding for the shadow frame to avoid scaling the thumbnail.
2004-09-27 20:50:04 +00:00
Sven Neumann
e29c3cd230 quick fix for large previews 2004-09-27 19:51:28 +00:00
Sven Neumann
0527d02329 themes/Default/images/Makefile.am added a stock icon that shows a simple
2004-09-27  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-frame-64.png: added a stock icon
	that shows a simple drop shadow but could be exchanged for other
	image decorations.

	* libgimpwidgets/gimpstock.[ch]: register the new icon.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
	ugly code to draw a frame around a preview pixbuf.

	* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
	to the GimpViewRenderer class so it can be shared by all renderers.

	* app/widgets/gimpviewrendererimagefile.c: use the new functionality
	to draw a nice frame around imagefile previews.

	* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
2004-09-27 19:40:12 +00:00
Michael Natterer
24f8d7e7c2 cleanup.
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c: cleanup.

	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell.c
	* tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.

	* app/text/gimptext-bitmap.c
	* app/text/gimptext-parasite.c
	* app/text/gimptext-vectors.c
	* app/text/gimptext-xlfd.c
	* app/text/gimptext.c
	* app/text/gimptextlayer-xcf.c: include "text-types.h" instead
	of "text/text-types.h".

	* app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
	instead of GimpDataFactoryView.

	* app/pdb/paint_tools_cmds.c: regenerated.
2004-09-27 12:30:04 +00:00
Michael Natterer
96a27b59cf app/actions/brushes-actions.c app/actions/gradients-actions.c
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/brushes-actions.c
	* app/actions/gradients-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c: made the "foo-edit" actions
	GimpStringActions and pass the identifier of the editor dialog
	to the callback.

	* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
	show the editor dialog here instead of calling view->edit_func().

	* app/dialogs/dialogs-constructors.[ch]: removed the brush,
	gradient and palette edit_funcs.

	* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.

	* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
	member and parameters and create the edit button unconditionally.

	* app/widgets/gimpbrushfactoryview.[ch]
	* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpdataselect.[ch]: removed this class, it's not
	needed any longer.

	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
	and follow the edit_func removal.

	* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
	stuff.

	* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
2004-09-27 10:45:49 +00:00
Sven Neumann
ab269fc645 removed conversion to TempBuf. Instead implement
2004-09-27  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c: removed conversion to TempBuf.
	Instead implement GimpViewable::get_new_pixbuf by compositing the
	thumbnail on a checkerboard.

	* app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf
	struct member to pixbuf.
	(gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf()
	and render the pixbuf before falling back to the TempBuf preview.
	(gimp_view_renderer_render_pixbuf): new function that sets a
	pixbuf for the renderer and flushes the render_buffer.

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_render): render the pixbuf.

	* app/dialogs/dialogs-constructors.c: create the document history
	dockable with a zero borderwidth.
2004-09-26 23:44:24 +00:00
Sven Neumann
75a59c682d use the GIMP_CHECK_SIZE_SM define, not the enum value
2004-09-27  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use
	the GIMP_CHECK_SIZE_SM define, not the enum value
	GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!).

	* app/pdb/fileops_cmds.c: regenerated.

	* app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup.
2004-09-26 23:26:25 +00:00
Michael Natterer
692863b31c added "data" property.
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.[ch]: added "data" property.

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimppaletteeditor.c: pass the current data to
	g_object_new() so we never end up with initially empty editors.
2004-09-26 19:41:56 +00:00
Michael Natterer
db85b16927 added CONSTRUCT_ONLY "data-factory" property. Removed
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY
	"data-factory" property. Removed gimp_data_editor_construct().

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimppaletteeditor.c: pass the construct parameters
	to g_object_new().
2004-09-26 19:26:37 +00:00
Sven Neumann
07e65b01cd changed label alignment to be more HIG conformant and consistent with the
2004-09-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c: changed label alignment to be more
	HIG conformant and consistent with the rest of the user interface.
2004-09-26 19:15:51 +00:00
Michael Natterer
6a50c27047 added "name", "blurb", "stock_id" and "help_id" to struct
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added "name", "blurb",
	"stock_id" and "help_id" to struct GimpDialogFactoryEntry and to
	gimp_dialog_factory_dialog_register(). Added typedef
	GimpDialogConstructor which takes a GimpDialogFactoryEntry in
	addition to the parameters GimpDialogNewFunc takes. Added a
	constructor function pointer to GimpDialogFactory which defaults
	to a function that just returns entry->new_func(). Use that
	constructor instead of entry->new_func() for creating
	dialogs. Added public API gimp_dialog_factory_set_constructor().

	* app/dialogs/dialogs.c: register name, blurb, stock_id and
	help_id for all dockables so all the dialog info lives in one huge
	ugly table now. For the global_toolbox_factory and the
	global_dock_factory, set a constructor which creates a dockable
	around the widget returned by entry->new_func().

	* app/dialogs/dialogs-constructors.[ch]: don't create the dockable
	in each dialog constructor. Removes tons of code and reduces most
	constructors to a "return gimp_foo_new(...)" one-liner. Got rid of
	all static variables, they were from a time when GimpDialogFactory
	was unable to manage singletons.

	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not
	GimpDataEditor from gimp_foo_editor_new().

	* app/widgets/gimpdataeditor.c: minor cleanups.
2004-09-26 18:41:29 +00:00
Michael Natterer
f6a205f83f moved stuff from new() to init().
2004-09-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolordialog.c: moved stuff from new() to init().
2004-09-26 18:22:29 +00:00
Michael Natterer
b4ea222c23 Ported GimpNavigationView to use actions for its buttons:
2004-09-26  Michael Natterer  <mitch@gimp.org>

	Ported GimpNavigationView to use actions for its buttons:

	* app/menus/menus.c (menus_init): register a <GimpNaviagaionEditor>
	UI manager containing the "view" action group.

	* app/actions/actions.c (action_data_get_foo): handle "data" being
	a GimpNavigationEditor.

	* app/actions/view-actions.c (view_actions): added tooltips for
	the actions used in the editor.

	(view_actions_update): use action_data_get_display() instead of
	checking the type of "data" manually.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
	a GtkToggleButton instead of GimpButton for GtkToggleActions.

	* app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
	parameter to the public constructor and removed all other
	parameters. Simplified gimp_navigation_editor_new_private() and
	use gimp_editor_add_action_button() instead of just add_button()
	for creating the buttons. Made gimp_navigation_view_set_shell()
	private. Update the UI manager when the shell zooms or scrolls.

	* app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
	pass the menu_factory to gimp_navigation_editor_new().

	Removed #includes which are not needed any more.
2004-09-26 15:21:44 +00:00
Sven Neumann
1b58ab567a removed trailing whitespace.
2004-09-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewrenderer.h: removed trailing whitespace.
2004-09-25 20:59:36 +00:00
Michael Natterer
28f7c94dbf app/widgets/gimpcolormapeditor.[ch] app/widgets/gimphistogrameditor.[ch]
2004-09-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimphistogrameditor.[ch]
	* app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage"
	parameters from public constructors. They are all GimpImageEditor
	widgets which get their image via gimp_docked_set_context() and
	gimp_image_editor_set_image() later anyway. Fixes uglyness as well
	as problems where the editors had an image but no context, causing
	strange behavior in their foo_actions_update() functions.

	* app/dialogs/dialogs-constructors.c: changed accordingly. Removed
	redundant calls to gimp_dockable_set_context() on newly created
	dockables because they will get a context when added to their
	containers.
2004-09-25 12:48:41 +00:00
Michael Natterer
ed35eedb9f moved stuff from gimp_colormap_editor_new() to
2004-09-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcolormapeditor.c: moved stuff from
	gimp_colormap_editor_new() to
	gimp_colormap_editor_init(). Untabified.
2004-09-25 11:25:49 +00:00
Sven Neumann
c58b176784 added resolution and image type information which is usually hidden in the
2004-09-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.[ch]: added resolution and image
	type information which is usually hidden in the Advanced Options.
2004-09-25 01:47:01 +00:00
Sven Neumann
f4b3d0918e added a label that shows the pixel size (as in the initial mockup done by
2004-09-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.[ch]: added a label that shows
	the pixel size (as in the initial mockup done by Jimmac).
2004-09-24 14:43:32 +00:00
Michael Natterer
ee5354e4b7 app/dialogs/Makefile.am removed...
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/color-dialog.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.

	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* app/actions/gradient-editor-commands.c
	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 20:41:40 +00:00
Michael Natterer
9ffc00be80 app/plug-in/Makefile.am removed... ...and added with a new name.
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-proc.[ch]: removed...
	* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.

	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.[ch]
	* app/plug-in/plug-in-progress.[ch]
	* app/plug-in/plug-in-rc.[ch]
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.[ch]
	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
	minor cosmetic cleanups.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2004-09-22 15:12:24 +00:00
Michael Natterer
10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
Sven Neumann
e0d0d7cff1 removed the prelit event box from the header frame, use a smaller font for
2004-09-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: removed the prelit event box
	from the header frame, use a smaller font for the subtitle,
	removed the separator.

	* app/dialogs/preferences-dialog.c: removed the prelit event box
	from the header frame. Perhaps we should have subtitles here with
	a more verbose description of the settings page?
2004-09-21 22:31:20 +00:00
Michael Natterer
37912655f2 For the sake of completeness, added a GUI for the hidden "Open as Layer"
2004-09-21  Michael Natterer  <mitch@gimp.org>

	For the sake of completeness, added a GUI for the hidden
	"Open as Layer" feature:

	* app/actions/file-actions.c
	* app/actions/file-commands.[ch]: added "file-open-as-layer"
	action and callback. Abuse the "gimage" field of GimpFileDialog to
	indicate layer opening (it's otherwise unused for file-open).

	* app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
	open the selected files as layers for that image.

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.

	* menus/image-menu.xml.in: added it to the menu.
2004-09-21 12:08:30 +00:00
Sven Neumann
69c5ce557d fixed handling of too many error messages.
2004-09-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
	handling of too many error messages.
2004-09-19 17:10:53 +00:00
Sven Neumann
c3ef897b10 Try to make floating selections more obvious:
2004-09-19  Sven Neumann  <sven@gimp.org>

	Try to make floating selections more obvious:

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): always display
	"Floating Selection" as the name for a floating selection.

	* app/core/gimpselection.c (gimp_selection_float): call the new
	layer "Selection" instead of "Floating Selection". This is what
	will be displayed if the FS is turned into a layer.

	* app/actions/layers-commands.c (layers_edit_layer_query): don't
	special case floating selections here.

	* app/core/gimplayer-floating-sel.c: cosmetics.
2004-09-19 16:56:03 +00:00
Michael Natterer
c9cac47fbe use gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.c
	(gimp_component_editor_renderer_update): use
	gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17 11:20:30 +00:00
Simon Budig
430c5f8170 Added a slider for the brush spacing to the brush editor. Should make it
2004-09-17  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.[ch]: Added a slider for the
	brush spacing to the brush editor. Should make it more obvious
	how to change it.
2004-09-17 10:31:34 +00:00
Michael Natterer
357dc2d777 depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.

	* app/gui/gui.c: changed accordingly.

	* app/sanity.c: ditto. Added check for GLib and put each check
	into its own utility function. Enabled #if 0'ed check for
	FreeType >= 6.2.7.

	* app/widgets/gimpactiongroup.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpselectiondata.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpwidgets-utils.c: removed workarounds for library
	versions we refuse to start with.
2004-09-16 14:31:39 +00:00
Michael Natterer
f338d93835 reverse order of DND dests so "text/uri-list" is preferred again after my
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
	order of DND dests so "text/uri-list" is preferred again after my
	DND change of 2004-06-29. Fixes dropping of multiple files.
2004-09-16 14:28:10 +00:00
Michael Natterer
0514ee4ba2 set the viewable renderer's "renderer" property to NULL when clearing the
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.[ch]: set the viewable
	renderer's "renderer" property to NULL when clearing the
	view to work around bug #149906.
2004-09-16 14:00:02 +00:00
Michael Natterer
186b590844 added help IDs for the drawable- and vectors-visible and -liked actions as
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
	vectors-visible and -liked actions as well as for the layer mask
	property action.

	* app/actions/drawable-actions.c
	* app/actions/vectors-actions.c: use them.

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: ditto. Use
	GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
	"paint_mode" by "mode" in all action and function/variable names
	because this is the layer mode, not a paint mode.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c: set the "activates-default"
	property on the name entry in all "New Foo" and "Edit Foo
	Attributes" dialogs except in the "New Layer" dialog.
	Addresses bug #148026.

	* menus/image-menu.xml.in: added a (commented out) layer
	properties menu containing all the new actions.
2004-09-15 15:06:08 +00:00
Michael Natterer
6a723efc4b app/actions/layers-actions.c added actions and callbacks
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: added actions and callbacks
	"layers-preserve-transparency" and
	"layers-paint-mode-first,last,previous,next". Update the "active"
	state of the recently added layer mask property actions in
	layers_actions_update().

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.[ch]: added actions and callbacks
	for "drawable-visible" and "drawable-linked". Fixes bug #152597.

	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
	and "vectors-linked").

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_preserve_button_toggled): flush the image
	so the new actions are updated. Compress preserve_trans undos.

	* menus/image-menu.xml.in: added the layer mask property actions
	to the Layers/Mask submenu.

	* menus/layers-menu.xml: reordered the mask property actions
	to have the same order as in the image menu.
2004-09-15 13:24:45 +00:00
Sven Neumann
b5f8fa24d8 improved the fix for bug #152662 and removed trailing whitespace.
2004-09-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_menu_position): improved the fix for bug
	#152662 and removed trailing whitespace.
2004-09-15 09:34:02 +00:00
Nathan Summers
8c4062f2b2 clamp the popup menu's Y position to the visible area of the GtkTreeView.
2004-09-15  Nathan Summers  <rock@gimp.org>

        * app/widgets/gimpcontainertreeview.c
        (gimp_container_tree_view_menu_position): clamp the popup menu's Y
        position to the visible area of the GtkTreeView.  Fixes #152662.
2004-09-15 05:55:56 +00:00
Michael Natterer
d62a3f0487 simplified the code which deals with the global_buffer's preview. The new
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbufferview.c: simplified the code which deals
	with the global_buffer's preview. The new buffer view renderer
	does the aspect ratio magic all by itself now.

	* app/actions/image-commands.h: removed trailing whitespace.
2004-09-14 12:19:16 +00:00
Michael Natterer
c450ca1858 app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
	which knows how to preserve a GimpBuffer's aspect ratio if the
	view's aspect ratio is different.

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_from_viewable_type): use it for viewables
	of type GimpBuffer. Fixes bug #152531
2004-09-14 12:06:28 +00:00
Michael Natterer
7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Sven Neumann
952cd37e00 simulate the behaviour of GNU gettext and look at the LANGUAGE environment
2004-09-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
	look at the LANGUAGE environment variable if the locale is not "C".
2004-09-13 12:19:34 +00:00
Simon Budig
4a75d7271e Added boolean parameter to gimp_dialog_factories_toggle to make it
2004-09-11  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
	gimp_dialog_factories_toggle to make it possible to ensure a visible
	toolbox.

	* app/actions/dialogs-commands.c: Use the new parameter to ensure
	toolbox visibility after the last image window closes.

	* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.

	Fixes bug #137057 (the discussion is in bug #152285)
2004-09-11 19:19:26 +00:00
William Skaggs
fe876df0ed Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimperrorconsole.c: fix typo
2004-09-10 15:38:17 +00:00
Michael Natterer
4b553f186c always call gdk_drag_status() before returning FALSE.
2004-09-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c
	(gimp_container_tree_view_drop_status): always call
	gdk_drag_status() before returning FALSE.

	(gimp_container_tree_view_drag_motion): never return FALSE, an
	impossible drop location is now reported by calling
	gdk_drag_status() above. Always returning TRUE makes sure
	gimp_container_tree_view_drag_leave() is called unconditionally
	and can remove the scroll_timeout set in drag_motion().

	Fixes bug #152193 and many other obscure DND crashes caused by the
	scroll_timeout being invoked after the widget is destroyed.
2004-09-10 12:20:16 +00:00
Michael Natterer
fa3f37e96e app/widgets/gimpviewrendererbrush.c app/widgets/gimpviewrendererdrawable.c
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimage.c
	* app/widgets/gimpviewrendererimagefile.c
	* app/widgets/gimpviewrendererlayer.c
	* app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.
2004-09-09 11:58:49 +00:00
Michael Natterer
d7fc14fbc8 use g_type_name(dialog_type) instead of just "pdb dialog" as name for the
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
	g_type_name(dialog_type) instead of just "pdb dialog" as name for
	the dialog's private context.
2004-09-09 11:48:45 +00:00
Michael Natterer
abf395c0cd renamed parameter "gboolean raise_if_found" to "return_existing" and added
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factory_dialog_new_internal): renamed parameter
	"gboolean raise_if_found" to "return_existing" and added
	additional parameter "gboolean present".

	(gimp_dialog_factory_dialog_new)
	(gimp_dialog_factory_dialog_raise)
	(gimp_dialog_factory_dockable_new): pass both parameters (passing
	"present" as "raise_if_found" was not quite correct).
2004-09-09 09:02:26 +00:00
Michael Natterer
d8a3c0c08c simplified the code that selects an image file by its URI.
2004-09-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
	simplified the code that selects an image file by its URI.
2004-09-07 10:45:36 +00:00
Simon Budig
20504d16a9 Added an indicator for generated brushes. Pretty straightforward,
2004-09-07  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpviewrendererbrush.c: Added an indicator for
	generated brushes. Pretty straightforward, suggestions for
	improvements are welcome.
2004-09-06 23:55:24 +00:00
Sven Neumann
4bfbd2c5c3 bumped version number to 2.1.5.
2004-09-05  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 2.1.5.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
	the image file, not only the folder it lives in. Fixes bug #151638.
2004-09-05 20:17:53 +00:00
Simon Budig
fe7eb34e6e Implement function to resize the image to contain all layers completely.
2004-09-05  Simon Budig  <simon@gimp.org>

	* app/core/gimpimage-resize.[ch]: Implement function to resize
	the image to contain all layers completely. Untabified.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: Make it available in the GUI.

	* tools/pdbgen/pdb/image.pdb: Make it available in the PDB.

	* app/pdb/image_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpimage_pdb.[ch]: regenerated.
2004-09-04 22:08:43 +00:00
Michael Natterer
1c045ca77e removed "Configure input devices" button. Fixes bug #150177.
2004-09-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdevicestatus.c: removed "Configure input
	devices" button. Fixes bug #150177.
2004-09-03 14:26:50 +00:00
Michael Natterer
2a67415c51 app/display/gimpdisplay.c gracefully handle progress calls after the
2004-09-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.c
	* app/widgets/gimpprogressdialog.c: gracefully handle progress
	calls after the widget is destroyed. Re-fixes bug #150194.
2004-09-01 15:26:48 +00:00
Sven Neumann
ce1370bb2e added a boolean parameter to gimp_dialog_factory_dialog_new() to let the
2004-09-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
	gimp_dialog_factory_dialog_new() to let the caller decide whether
	the window should be presented or not.

	* app/actions/dialogs-commands.c
	* app/actions/image-commands.c
	* app/actions/templates-commands.c
	* app/gui/gui-vtable.c
	* app/gui/gui.c
	* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
	gimp_dialog_factory_dialog_new() present the dialog if we need to
	change it after creation. This avoids annoying resizes, noticeable
	especially with the error dialog.
2004-08-31 22:41:15 +00:00
Sven Neumann
cd4154e142 app/widgets/gimpdockable.c converted tabs to spaces.
2004-08-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c
	* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
2004-08-31 21:29:30 +00:00
Michael Natterer
a3bb332214 emit "clicked" on the edit_button only if it exists and is sensitive.
2004-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdatafactoryview.c
	(gimp_data_factory_view_activate_item): emit "clicked" on the
	edit_button only if it exists and is sensitive. Fixes bug #151343.
2004-08-31 21:07:35 +00:00
David Odin
b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
Sven Neumann
7e9f0d4a71 applied a patch from Joao S. O. Bueno which adds an API that allows to
2004-08-28  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
	S. O. Bueno which adds an API that allows to make the scale widget
	of a GimpScaleEntry behave logarithmic. Fixes bug #149420.

	* app/widgets/gimpbrusheditor.c: use the new functionality for the
	radius control.
2004-08-28 16:57:37 +00:00
Sven Neumann
52bf83ee69 app/widgets/gimphelp-ids.h added a help-id for the image area.
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h
	* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
	help-id for the image area.
2004-08-28 10:57:24 +00:00
Michael Natterer
28e1f2a9da call gimp_container_editor_select_item() manually at construction time so
2004-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainereditor.c
	(gimp_container_editor_construct): call
	gimp_container_editor_select_item() manually at construction time
	so views show the initially selected object's state correctly
	(e.g. the brush spacing). Fixes bug #151227.
2004-08-27 17:38:57 +00:00
David Odin
ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin
5af63086ba GimpViewRendererVector is really derived from GimpViewRenderer and not
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
  really derived from GimpViewRenderer and not from GimpViewRendererDrawable.
2004-08-26 14:59:31 +00:00
David Odin
1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin
d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
David Odin
e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann
8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
Sven Neumann
80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
Sven Neumann
d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
Sven Neumann
6939d7ab90 added API to change the labels. Modeled after the proposed new API for
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
	Modeled after the proposed new API for GtkMessageDialog.

	* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 20:08:33 +00:00
David Odin
cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann
578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Sven Neumann
509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
Sven Neumann
c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
Manish Singh
83a94230ed app/widgets/gimpcellrendereraccel.c app/widgets/gimphistogrambox.c Get rid
2004-08-18  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimphistogrambox.c
        * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
2004-08-19 00:21:55 +00:00
Sven Neumann
0620ee069e no need to set a size_request here.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/gui/color-notebook.c: no need to set a size_request here.

	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.

	* libgimpwidgets/gimpcolorscales.c
	* modules/colorsel_cmyk.c: don't set a minimum width on the color
	scales. Improves behaviour for narrow color dockables.
2004-08-18 21:50:26 +00:00
Sven Neumann
2d5ee4485d define GIMP_HELP_DOCK_SEPARATOR.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.

	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: help-ids are never used directly,
	use the defines from app/widgets/gimphelp-ids.h instead.
2004-08-18 09:53:38 +00:00
William Skaggs
8e36dd8ffb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: add help-ids.
2004-08-17 17:46:48 +00:00
Sven Neumann
6543cfde20 fixed labels in CMYK mode. Fixes bug #150213.
2004-08-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
	labels in CMYK mode. Fixes bug #150213.
2004-08-16 07:24:42 +00:00
Michael Natterer
1437f52d63 make sure that all actions, even if they have no menu proxy, can be
2004-08-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
	make sure that all actions, even if they have no menu proxy, can
	be invoked by their accelerators. Fixes bug #149938.

	* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
	removed the same code here.

	* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
	function which disconnects from "accel_changed" of the accel_group
	before upchaining (== before emitting "destroy").

	The above changes make this one redundant, but since the crash in
	bug #149938 was triggered by "accel_changed" emitted in the middle
	of g_object_unref(tree_model), it feels better to be paranoic here
	(fiddling with objects in destruction is no fun).

	(gimp_action_view_accel_edited): don't warn if assigning the same
	accel to the same action again.

	(gimp_action_view_new): don't leak all accel_closures.
2004-08-12 20:04:19 +00:00
Michael Natterer
a8e599ebbf app/widgets/gimpcontainercombobox.[ch] when removing the last item from
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainertreeview.c: when removing the last item
	from the view, manually clear all GimpCellRendererViewables'
	"renderer" properties; otherwise we have stale GimpPreviewRenderers
	with still-refed viewables hanging around in the cells.
	Works around GTK+ bug #149906.
2004-08-11 14:07:35 +00:00
Michael Natterer
57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
Sven Neumann
846bacd905 app/gui/file-open-location-dialog.c increased horizontal size request to
2004-08-11  Sven Neumann  <sven@gimp.org>

	* app/gui/file-open-location-dialog.c
	* app/widgets/gimpprogressbox.c: increased horizontal size request
	to reduce resizing.
2004-08-10 23:37:06 +00:00
Michael Natterer
828b852e06 fixed annoying resizing when thumbnailing exactly one image.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
	fixed annoying resizing when thumbnailing exactly one image.
2004-08-10 22:34:45 +00:00
Michael Natterer
06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer
95607cce19 new function which works on all widgets in the dialog except the cancel
2004-08-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]
	(gimp_file_dialog_set_sensitive): new function which works on all
	widgets in the dialog except the cancel button.

	Remember if the active progress is cancelable and added two
	booleans "busy" and "canceled". Added GtkDialog::response()
	implementation which, if the dialog is busy, cancels the active
	progress and sets the dialog's "canceled" state.

	Moved the progress bar right above the action area so it is next
	to the cancel button and in the same place for both open and save
	dialogs.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: use the new API to make image loading
	and saving cancelable again.

	* app/widgets/gimpthumbbox.c: use the same stuff to make
	thumbnailing cancelable. Increased the minimum height a bit so it
	doesn't resize when the progress bars are shown.
2004-08-10 21:20:38 +00:00
Michael Natterer
02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Hans Breuer
eafd79de87 gimp_create_display() with the right parameters order
2004-08-09  Hans Breuer  <hans@breuer.org>

	* app/core/gimp-edit.c(gimp_edit_paste_as_new) :
	gimp_create_display() with the right parameters order

	* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
	handle gtk_style_lookup_icon_set() returnig NULL

	* app/gimpcore.def app/widgets/makefile.msc
	  themes/default/images/makefile.msc : updated
2004-08-08 22:47:23 +00:00
Michael Natterer
60fd11d79b Enabled previewing items without selecting them in all list and grid views
2004-08-05  Michael Natterer  <mitch@gimp.org>

	Enabled previewing items without selecting them in all list and
	grid views using mouse button 2. Implicitly enables previewing of
	items in container popups and thus fixes bug #121011:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event)
	* app/widgets/gimpcellrendererviewable.c
	(gimp_cell_renderer_viewable_clicked): show the preview also on
	mouse button 2 click.

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): dispatch mouse button 2
	clicks to GimpCellRendererViewable, but don't select or change
	anything in the tree_view.

	Unrelated cleanup:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event):
	don't offset bevent->x,y by widget->allocation.x,y before calling
	gimp_preview_popup_show() ...

	* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
	... instead, do it here generically (check if the parent widget is
	GTK_WIDGET_NO_WINDOW()).
2004-08-05 13:43:38 +00:00
Sven Neumann
50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer
fd1a0e142c Allow URI drops from apps linked against GLib < 2.4.4 to GIMP linked
2004-08-04  Michael Natterer  <mitch@gimp.org>

	Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
	linked against GLib >= 2.4.5. Fixes bug #148140.

	* app/core/gimp-utils.[ch]: added gimp_check_glib_version().

	* app/widgets/gimpselectiondata.c: added runtime check for GLib
	versions that encode file:// URIs correctly (>= 2.4.5). For older
	(broken) GLibs, leave the code path as is, for newer (fixed) ones,
	perform an additional check if the dropped URI is in the (broken)
	escaped-UTF-8 format and convert it to local filename encoding.

	* app/gui/gui.c: warn the user that non-ASCII filenames can't
	be used when linked against GLib 2.4.4.
2004-08-04 17:11:39 +00:00
Michael Natterer
0dabeab6cb #include "core/gimpimage-undo.h"
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 10:15:49 +00:00
Michael Natterer
8260cd69ce ref/unref the view around the calls to gimp_container_view_item_selected()
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c
	(gimp_container_grid_view_item_context): ref/unref the view around
	the calls to gimp_container_view_item_selected() and _item_context()
	because the former may destroy the view which leads to a crash
	when trying the latter. Fixes bug #148955.
2004-08-03 14:55:31 +00:00
Michael Natterer
b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Hans Breuer
3b3039148c build but *dont link* display-enums.obj, widget-enums.obj and
2004-07-31  Hans Breuer  <hans@breuer.org>

	* app/display/makefile.msc app/widgets/makefile.msc : build
	but *dont link* display-enums.obj, widget-enums.obj and
	gimpdisplayoptions.obj. They must be in the dll
	* app/makefile.msc : build gimp.exe and gimp-console.exe both
	using the same gimp-core.dll
	* app/gimpcore.def : new file, exports for gimp-core.dll
	* app/Makefile.am : added to EXTRA_DIST

	* cursors/makefile.msc : new file to create gimp-tool-cursors.h
	* cursors/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc : updated

	* app/main.c app/app_procs.c : moved code to close the console
	from the former to the later. It only is to be used if The Gimp
	is not build as console app.

	* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
	drawable twice
	* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
	crashing on File/Import
2004-08-01 20:51:12 +00:00
Simon Budig
b05f9f4b60 Fixed oversight that accidentially reset the number of spikes to 2.
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
	reset the number of spikes to 2.
2004-08-01 18:09:41 +00:00
Simon Budig
1eb3009f1a Added optional spikes for the generated brushes, enabling star shaped
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
	the generated brushes, enabling star shaped generated brushes.

	* app/widgets/gimpbrusheditor.[ch]: GUI for this.

	* app/core/gimpbrush.c: changed accordingly.
2004-08-01 17:20:00 +00:00
Simon Budig
c40e29399d app/core/core-enums.h Implement three different brush shapes for generated
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/core-enums.h
	* app/core/gimpbrushgenerated.[ch]: Implement three different
	brush shapes for generated brushes.

	* app/core/gimpbrush.c: changed accordingly.
	* app/core/core-enums.c: regenerated.

	* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
	* themes/Default/images/stock-brush-generated-*-16.png: New stock
	icons for the brush shapes.

	* themes/Default/images/Makefile.am
	* libgimpwidgets/gimpstock.[ch]: changed accordingly

	untabified the files touched.
2004-08-01 03:06:58 +00:00
Sven Neumann
26a4b20dfe always do the check for perl and use the substituted perl executable name
2004-07-30  Sven Neumann  <sven@gimp.org>

	* configure.in: always do the check for perl and use the
	substituted perl executable name in the call for gimp-mkenums.
	Fixes the build on platforms where perl is not available as
	/usr/bin/perl. Closes bug #148813.

	* app/widgets/gimpenumstore.c: added missing include.
2004-07-30 20:42:53 +00:00
Sven Neumann
c6cbd6d335 Applied a bunch of AIX portability fixes (bug #148813):
2004-07-30  Sven Neumann  <sven@gimp.org>

	Applied a bunch of AIX portability fixes (bug #148813):

	* configure.in: when testing for Xmu library, link with -lXt -lX11.

	* app/gui/tips-parser.c
	* app/gui/user-install-dialog.c
	* app/tools/tools-enums.h
	* app/widgets/gimpdasheditor.c
	* app/widgets/widgets-enums.h
	* libgimpthumb/gimpthumb-error.h
	* libgimpwidgets/gimpcolorbutton.c
	* plug-ins/common/edge.c: removed trailing commas from enums.

	* plug-ins/common/snoise.c

	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 00:57:22 +00:00
Sven Neumann
e10ebe1805 removed enums GimpImageType and GimpImageBaseType ...
2004-07-29  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h: removed enums GimpImageType and
	GimpImageBaseType ...

	* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
	all enums from gimpbasetypes.h to this new file.

	* libgimpbase/Makefile.am
	* tools/pdbgen/Makefile.am: changed accordingly.

	* app/core/core-enums.c
	* libgimp/gimpenums.h
	* libgimpbase/gimpbaseenums.c
	* tools/pdbgen/enums.pl: regenerated.

	* libgimpbase/gimpparasite.c
	* libgimpbase/gimpprotocol.c
	* libgimp/gimp.c: include <glib-object.h>

	* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
	translation domain on a GType. This is used for translatable enum
	values.

	* libgimpbase/gimputils.[ch]: added API to retrieve the translated
	name for an enum value.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
2004-07-29 12:33:15 +00:00
Michael Natterer
ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Michael Natterer
9a153f6e58 forgot to strip mnemonics here.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_set_action_label): forgot to strip mnemonics
	here.
2004-07-27 22:38:40 +00:00
Michael Natterer
210ef45abb Enabled disabling all menu mnemonics. Addresses bug #120034:
2004-07-28  Michael Natterer  <mitch@gimp.org>

	Enabled disabling all menu mnemonics. Addresses bug #120034:

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added boolean RESTART property
	"menu-menonics".

	* app/gui/preferences-dialog.c: added a GUI for it.

	* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
	property "mnemonics".

	(gimp_action_group_add_*_actions): call gimp_strip_uline() on
	the actions' labels if mnemonics is FALSE.

	* app/widgets/gimpactionfactory.[ch]
	* app/actions/actions.c: pass gui_config->menu_menmonics to
	all action groups.
2004-07-27 22:17:30 +00:00
Sven Neumann
bd427b2e4d libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def
2004-07-27  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbase.def
	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
	related functions (moved here from gimputil.c) and
	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
	app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimpbase-private.c
	* libgimp/gimptile.c
	* libgimp/gimpunitcache.c
	* plug-ins/help/domain.c
	* app/xcf/xcf-read.c: need to include glib-object.h.

	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

	* app/config/gimpconfig-types.[ch]: removed code that lives in
	libgimpbase now.

	* app/config/gimpconfig-deserialize.c: changed accordingly.

	* app/config/gimpbaseconfig.c
	* app/config/gimpdisplayconfig.c
	* app/core/gimpcontext.c
	* app/gui/grid-dialog.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
	any longer.
2004-07-27 16:39:00 +00:00
Sven Neumann
7e3e851c63 string change.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
2004-07-27 12:41:44 +00:00
Michael Natterer
a66a3b47c9 make sure we always set a non-null URI.
2004-07-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
	sure we always set a non-null URI.
2004-07-27 12:39:56 +00:00
Sven Neumann
67ff4473a2 app/widgets/gimphelp-ids.h removed unused help IDs GIMP_HELP_FILE_OPEN_XCF
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h removed unused help IDs
	GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
	for these entries are generated from the procedure names.
2004-07-27 12:28:30 +00:00
Sven Neumann
228aadc25c print the help-id and help-domain to stdout if gimp was started with the
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help): print the help-id and
	help-domain to stdout if gimp was started with the --verbose
	command-line option.
2004-07-27 11:19:33 +00:00
Sven Neumann
a1ac37ed19 show extensions in the filters menu.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	show extensions in the filters menu.
2004-07-27 00:26:14 +00:00
Sven Neumann
744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00
Michael Natterer
a2b85a62b0 new function which clears the whole list of data set by plug-ins.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
	function which clears the whole list of data set by plug-ins.

	(procedural_db_free): use it.

	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.[ch]: added action, callback and
	confirmation dialog for "Reset all filters to default values".
	Somehow addresses bug #81015.

	* app/widgets/gimphelp-ids.h: added a help ID for the new action.

	* menus/image-menu.xml.in: added it to the "Filters" submenu.
2004-07-26 21:07:15 +00:00
Michael Natterer
caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00
Sven Neumann
b50ea15b26 rephrased the text for the dialog that appears if a new shortcut collides
2004-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactionview.c: rephrased the text for the dialog
	that appears if a new shortcut collides with an existing one.

	* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
	which accepts RGB colors in hexadezimal notation or as SVG color
	keywords.
2004-07-22 12:42:57 +00:00
Michael Natterer
a5760e33fe connect to "accel-changed" of the accel_group using connect_object(), not
2004-07-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
	"accel-changed" of the accel_group using connect_object(), not
	just connect() so we don't crash when it's emitted after the
	toolbox is destroyed.
2004-07-22 11:18:52 +00:00
Michael Natterer
a80977b0bc app/widgets/gimptemplateeditor.c plug-ins/common/gif.c set GTK_SHADOW_IN
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptemplateeditor.c
	* plug-ins/common/gif.c
	* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
	text views. Fixes bug #148025.
2004-07-21 16:29:29 +00:00
Michael Natterer
cc6288a4fb Enabled the various "Clear saved foobar now" buttons in prefs:
2004-07-21  Michael Natterer  <mitch@gimp.org>

	Enabled the various "Clear saved foobar now" buttons in prefs:

	* app/gui/session.[ch]
	* app/menus/menus.[ch]
	* app/widgets/gimpdevices.[ch]: implemented the _clear()
	functions: unlink() the rc file and set an internal flag that it
	has been deleted. Added "gboolean always_save" parameter to the
	_save() functions and don't save anything if it is FALSE and the
	internal deletion flag has been set.

	* app/gui/gui.c
	* app/widgets/gimpdevicestatus.c: changed accordingly.

	* app/gui/preferences-dialog.c: added callbacks for all "Save now"
	and "Clear now" buttons and show error messages if clearing fails.
	Inform the user that she has to restart GIMP to see the effect of
	the clearing.
2004-07-21 16:11:31 +00:00
Michael Natterer
e7479951b5 app/core/gimpmarshal.list added "gboolean delete" parameter to the
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
	parameter to the GimpCellRendererAccel::accel_edited() signal.

	* app/widgets/gimpactionview.c: distinguish between deletion of an
	accelerator and the user entering an invalid accelerator.
2004-07-21 14:09:36 +00:00
Michael Natterer
b241a40b43 remember the keyboard shortcut dialog and show it only once.
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/gui/preferences-dialog.c: remember the keyboard shortcut
	dialog and show it only once.

	* app/widgets/gimpactionview.c
	* app/widgets/gimpcellrendereraccel.c: minor cleanups.

	Seems to work pretty well now and thus fixes bug #142922.
2004-07-21 11:28:31 +00:00
Michael Natterer
62bf62a151 app/core/gimpmarshal.list app/widgets/Makefile.am
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
	which displays an accelerator and allows to edit it (ripped
	out of libegg and modified).

	* app/widgets/gimpactionview.c: use the new renderer and connect
	to its "accel-edited" signal (its callback is one huge mess that
	needs to be cleaned up). Added ugly hack to work around GTK+ API
	limitation that seems to prevent implementing a shortcut editor in
	a sane way.

	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/tools-actions.c: added ugly hacks here, too.

	* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
	editor by Close.
2004-07-21 00:39:46 +00:00
Michael Natterer
94fc8f15a1 app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties
2004-07-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionfactory.[ch]
	* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
	properties to GtkActionGroup and allow to register them in the
	GimpActionFactory.

	* app/actions/actions.c: register user visible labels and icons
	with all action groups.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactionview.[ch]: new widget which shows a
	treeview of action groups and their actions & shortcuts.

	* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
	utility function.

	* app/widgets/gimpwidgets-utils.[ch]: added
	gimp_get_accel_string() utility function.

	* app/widgets/gimpcontrollers.[ch]: added
	gimp_controllers_get_ui_manager() which will be used for setting
	up the controller mapping dialog.

	* app/gui/preferences-dialog.c: added a "Configure Keyboard
	Shortcuts" button which pops up a GimpControllerView. Work in
	progress...
2004-07-20 18:50:20 +00:00
Michael Natterer
28b3fd4a74 reordered and commented to match API docs.
2004-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h: reordered and commented to match
	API docs.
2004-07-19 12:08:37 +00:00
Michael Natterer
09c6ee7363 added the removed help IDs back.
2004-07-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added the removed help IDs back.

	* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
	IDs and added gimp_file_proc_view_get_help_id() which returns the
	selected item's help ID.

	* app/widgets/gimpfiledialog.c: added a custom help func which
	shows the help for the selected file_proc if the proc_view has the
	focus.
2004-07-17 19:53:05 +00:00
Sven Neumann
d95059db48 use GIMP_STOCK_WEB for "file-open-location".
2004-07-17  Sven Neumann  <sven@gimp.org>

	* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
	for "file-open-location".

	* app/widgets/gimpfiledialog.c: create the scrolled window with
	shadow_type GTK_SHADOW_IN.

	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
	procedures that register a prefix (the URL loader).

	* app/widgets/gimphelp-ids.h: removed help IDs that used to be
	used from the file-open and file-save menus.

	* plug-ins/common/xwd.c (query): "X window dump" seems to be more
	appropriate than "X window image".
2004-07-17 13:06:59 +00:00
Sven Neumann
5222925694 sort the file procedures by their menu labels.
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
	by their menu labels.

	* app/widgets/gimpfileprocview.c: removed the sort function here.
2004-07-16 21:47:06 +00:00
Sven Neumann
ccf8ed69e7 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfileprocview.[ch]: added new widget that offers
	a treeview on file procedures.

	* app/widgets/gimpfiledialog.[ch]: replaced the file type option
	menu with the new GimpFileProcView widget.
	(gimp_file_dialog_set_image): reset the file type to Automatic
	(fixes bug #141535).

	* app/actions/file-commands.c
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]: changed accordingly.

	* plug-ins/common/bz2.c
	* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
	extension. It's redundant and breaks the code that sets the
	extension from the selected file-type.

	* plug-ins/common/dicom.c: register a shorter menu label.

	* plug-ins/common/gbr.c
	* plug-ins/common/gih.c
	* plug-ins/common/pat.c
	* plug-ins/common/url.c: register stock icons.
2004-07-16 21:24:39 +00:00
Michael Natterer
fe9d9be66b Code review & cleanup:
2004-07-14  Michael Natterer  <mitch@gimp.org>

	Code review & cleanup:

	* app/config/gimpguiconfig.[ch]: removed transparency-size,
	transparency-type and snap-distance properties...

	* app/config/gimpdisplayconfig.[ch]: ...and added them here.

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
	"max_memsize" parameter instead of looking it up in GimpGuiConfig.

	* app/actions/image-commands.c: changed accordingly.

	* app/core/gimparea.c
	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
	GimpProjectionIdleRender, reordered functions, cleanup.

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.c: removed unused #includes.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-close.c: renamed
	shell->warning_dialog to shell->close_dialog, some random
	cleanups.

	* app/display/gimpdisplayshell-handlers.c
	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-14 10:31:59 +00:00
Michael Natterer
54cc251b08 app/core/Makefile.am app/core/core-types.h new interface which has
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppickable.[ch]: new interface which has
	get_image_type(), get_tiles() and get_color_at() methods.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimagemap.[ch]
	* app/core/gimpprojection.[ch]: implement GimpPickableInterface
	and removed public get_colot_at() functions.

	* app/core/gimpimage-pick-color.[ch]: removed typedef
	GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
	gimp_pickable_pick_color() instead.

	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-crop.c
	* app/gui/info-window.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpselectioneditor.c: use GimpPickable functions
	instead of the various get_color_at() functions. Simplifies code
	which has a "sample_merged" boolean. Various cleanups.
2004-07-13 23:04:05 +00:00
Michael Natterer
c5ec0d4f70 *** empty log message *** 2004-07-13 16:36:29 +00:00
Michael Natterer
d41e45b1f4 added a preview of the global buffer.
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbufferview.[ch]: added a preview of the global
	buffer.
2004-07-12 20:25:05 +00:00
Michael Natterer
da74f1269e app/core/gimpundo.[ch] app/core/gimpitemundo.[ch] removed all _new()
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpundo.[ch]
	* app/core/gimpitemundo.[ch]
	* app/text/gimptextundo.[ch]: removed all _new() functions and
	added properties and GObject::constructor() implementations
	instead.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
	"GType undo_gtype" parameter and allow to pass name-value pairs as
	"...". Une the new GParameter utility functions to construct the
	appropriate undo step with g_object_newv().

	(gimp_image_undo_push_item): removed.

	(gimp_image_undo_push_undo): removed. Merged its code back into
	gimp_image_undo_push(), where it originally came from.

	* app/core/gimpimage-undo-push.c
	* app/core/gimpundostack.c
	* app/paint/gimppaintcore-undo.c
	* app/tools/gimptransformtool-undo.c
	* app/widgets/gimpundoeditor.c: changed accordingly.
2004-07-12 16:59:36 +00:00
Michael Natterer
5b83b759d7 set/unset the busy cursor on all windows which have widget->window, not
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factories_set_busy_foreach)
	(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
	cursor on all windows which have widget->window, not only for
	those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
	dialogs are hidden while the busy cursor is active and later shown
	again.
2004-07-12 11:47:54 +00:00
Hans Breuer
b56eb39ead updated app/actions/makefile.msc app/menus/makefile.msc : (new files)
2004-07-11  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated
	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
	  app/widgets/gimppropwidgets.c : bumped compiler version check,
	msvc6 still can't cast from unsigned __int64 to double

	* app/actions/debug-actions.c : only use debug_*_callback
	and thus debug_action if ENABLE_DEBUG_MENU

	* app/core/gimpalette-import.c : added gimpwin32-io.h

	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

	* plug-ins/common/screenshot.c : make it compile with msvc,
	but still no win32 specific implementation ...
2004-07-11 21:53:17 +00:00
Philip Lafleur
3a5019b270 Applied a patch from Robert Robert Ögren, moved here from
2004-07-11  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied
	a patch from Robert Robert Ögren, moved here from
	toolbox_check_device() - Only change devices if the event came from
	a widget that accepts extension events. Fixes bug #115774.
2004-07-11 03:01:05 +00:00
Michael Natterer
2176afbbbb Removed any remaining GUI dependency from the PDB wrappers:
2004-07-10  Michael Natterer  <mitch@gimp.org>

	Removed any remaining GUI dependency from the PDB wrappers:

	* app/core/gimp.[ch]: added vtable entries for the display and
	help stuff.

	* app/widgets/gimphelp.[ch]: renamed gimp_help() to
	gimp_help_show().

	* app/gui/gui-vtable.c: implement the new display and help vtable
	entries.

	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/display.pdb
	* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
	object instead of using stuff from display/ and widgets/.

	* tools/pdbgen/app.pl: removed bad hacks which enabled including
	stuff from gui/, display/ and widgets/.

	* app/Makefile.am: link widgets-enums.o, display-enums.o and
	gimpdisplayoptions.o into the gimp-console binary because they are
	needed for the config system and don't depend on any GUI stuff.

	* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/

	* app/pdb/display_cmds.c
	* app/pdb/help_cmds.c: regenerated.
2004-07-10 20:29:11 +00:00
Michael Natterer
8d9e362249 app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch]
2004-07-09  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/brush-select.[ch]
	* app/gui/font-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppdbdialog.[ch]
	* app/widgets/gimpdataselect.[ch]
	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]
	* app/widgets/gimpfontselect.[ch]: ...and added here as a
	hierarchy of widgets.

	* app/widgets/gimpdatafactoryview.h: removed typdef
	GimpDataEditFunc, it's in widgets-types.h now.

	* app/gui/convert-dialog.c: changed accordingly.

	* app/core/gimp.[ch]: added vtable entries for creating, closing
	and setting PDB dialogs.

	* app/gui/gui-vtable.c: implement the vtable entries using the new
	widgets.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
	the Gimp object to create / manage the selection dialogs. The
	generated files don't depend on GUI stuff any longer.

	* app/pdb/brush_select_cmds.c
	* app/pdb/font_select_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/palette_select_cmds.c
	* app/pdb/pattern_select_cmds.c: regenerated.
2004-07-09 19:14:59 +00:00
Sven Neumann
458ea9a50e reverted my last change. (gimp_histogram_editor_item_visible): fix the
2004-07-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_menu_update): reverted my last change.
	(gimp_histogram_editor_item_visible): fix the problem here instead.
2004-07-08 22:45:36 +00:00
Michael Natterer
788ae2fd5f removed "role" property because GtkWindow has an equivalent property now.
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpdialog.c: removed "role" property because
	GtkWindow has an equivalent property now. Added "help-func" and
	"help-id" construct properties.

	* app/widgets/gimptexteditor.c
	* app/widgets/gimptooldialog.c
	* app/widgets/gimpviewabledialog.c: removed calls to
	gimp_help_connect() and pass help_func and help_id to
	g_object_new().
2004-07-08 21:57:05 +00:00
Sven Neumann
1746c311e7 set the active item of the combo-box after changing the visibility filter.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_menu_update): set the active item of the
	combo-box after changing the visibility filter.
2004-07-08 13:23:27 +00:00
Michael Natterer
c8d9457f07 same fix as below.
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
	same fix as below.
2004-07-08 13:17:06 +00:00
Sven Neumann
822db32134 block gimp_prop_enum_combo_box_callback() before changing the combo-box.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
	block gimp_prop_enum_combo_box_callback() before changing the
	combo-box.
2004-07-08 12:50:15 +00:00
Sven Neumann
8bc46f69f3 only write aux-info for properties that have been changed from their
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c: only write aux-info for properties
	that have been changed from their default values.

	* app/widgets/gimphistogrameditor.c: some code cleanup.
2004-07-08 12:04:15 +00:00
Michael Natterer
d18097028e added a "const gchar *format" parameter to
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
	parameter to gimp_selection_data_set_pixbuf() which selects the
	format in which to encode the pixbuf (was defaulting to "png"
	before).

	* app/widgets/gimpclipboard.c: when copying, offer all formats which
	are savable with GdkPixbuf. Added a GimpClipboard struct which is
	attached to the Gimp and which stores all the persistent data
	needed by the clipboard. Renamed some private functions.

	(unfortunately this change breaks pasting to AbiWord:
	 http://bugzilla.abisource.com/show_bug.cgi?id=7068)
2004-07-08 11:27:48 +00:00
Sven Neumann
a4ac4de072 app/config/gimpconfig-deserialize.c removed redundant casts.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-serialize.c: removed redundant casts.

	* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
	get and set aux-info based on object properties.

	* app/widgets/gimphistogrameditor.c: use the new functions to save
	a histogram's channel and scale in the sessionrc.
2004-07-08 00:09:41 +00:00
Sven Neumann
73b1182c80 sort the list of pixbuf formats so that PNG is the preferred format and
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
	that PNG is the preferred format and GIF and JPEG come last.
2004-07-07 18:09:14 +00:00
Michael Natterer
94163a8beb changed to allow pasting any GdkPixbuf supported format (makes pasting
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
	GdkPixbuf supported format (makes pasting from OpenOffice
	work). Cleaned up a bit to perpare pasting of SVG data.
2004-07-07 16:02:23 +00:00
Michael Natterer
8fc8cb487c app/gui/Makefile.am removed...
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/clipboard.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/gimpclipboard.[ch]: ...and added here.

	* app/actions/edit-commands.c
	* app/gui/gui.c: changed accordingly.
2004-07-07 14:38:23 +00:00
Sven Neumann
2d412472c2 fixed a drawing bug I introduced earlier today.
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
	fixed a drawing bug I introduced earlier today.
2004-07-07 01:59:33 +00:00
Sven Neumann
ef885f7691 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes bug
2004-07-06  Sven Neumann  <sven@gimp.org>

	Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
	bug #145401.

	* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
	it to the PDB.

	* app/base/gimphistogram.c: implemented histogram functions for
	the RGB mode.

	* app/base/levels.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimphistogrameditor.c: handle the new enum value.

	* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
	draw a histogram that shows the RGB channels simultaneously
2004-07-06 16:33:30 +00:00
Michael Natterer
fa668df1ee call gtk_menu_set_monitor() only for GTK+ < 2.4.4 and added a #warning
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
	(gimp_button_menu_position): call gtk_menu_set_monitor() only
	for GTK+ < 2.4.4 and added a #warning about it.
2004-07-06 15:05:47 +00:00
Michael Natterer
3b7fc27b5e queue an idle update when setting the viewable to NULL so the view gets
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppreviewrenderer.c
	(gimp_preview_renderer_set_viewable): queue an idle update when
	setting the viewable to NULL so the view gets cleared correctly.

	(gimp_preview_renderer_idle_update): call
	gimp_preview_renderer_update() even if renderer->viewable is NULL
	so clearing the viewable gets propagated to the GUI.

	Moved clearing the viewable and removing the idle from
	GObject::finalize() to GObject::dispose() because calling
	set_viewable() with a NULL viewable triggers typechecking casts
	and queuing idle functions, which is not nice in finalize().
2004-07-06 13:18:42 +00:00
Sven Neumann
d5724ff596 return the proper type.
2004-07-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
	return the proper type.
2004-07-06 10:54:46 +00:00
Michael Natterer
960c32e94a connect to "editing-canceled" of the name cell renderer and restore the
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.c: connect to
	"editing-canceled" of the name cell renderer and restore the
	original text in the callback. Doesn't work reliably until GTK+
	bug #145463 is fixed.
2004-07-05 22:50:38 +00:00
Michael Natterer
49a46c76a0 removed unused local variables.
2004-07-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptemplateview.c
	(gimp_template_view_tree_name_edited): removed unused local variables.
2004-07-05 14:57:22 +00:00
Simon Budig
e7af53b0d3 app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c
2004-07-04  Simon Budig  <simon@gimp.org>

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/preferences-dialog.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdeviceinfo.c
	* app/widgets/gimpitemtreeview.c
	* plug-ins/imagemap/imap_selection.c
	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
	CVS compile with gcc 2.95 again. Mostly double semicolons and
	variable declarations after other stuff. Spotted by Martin
	Renold.

	* app/pdb/gradients_cmds.c: regenerated.

	(there is one issue left, see his patch at
	http://old.homeip.net/martin/gcc-2.95.diff, I did not
	copy the #define va_copy __va_copy, since I don't know
	what happens here.)
2004-07-04 21:27:09 +00:00