Commit graph

171 commits

Author SHA1 Message Date
Sven Neumann
93dcbb1904 app/widgets/Makefile.am new files that renders a Wilber image as a Cairo
2008-03-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-wilber.[ch]: new files that renders a
	Wilber image as a Cairo path. Or at least it is supposed to do
	this at some point...

	* app/display/gimpcanvas.c (gimp_canvas_draw_drop_zone): use the
	scalable Wilber path. Needs more work...

svn path=/trunk/; revision=25244
2008-03-26 15:59:52 +00:00
Sven Neumann
384835d7e2 app/widgets/Makefile.am app/widgets/widgets-types.h
2008-02-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimplanguageentry.[ch]
	* app/widgets/gimptexteditor.c: turned language entry into a 
widget.


svn path=/trunk/; revision=24866
2008-02-11 20:19:03 +00:00
Sven Neumann
7f2a8fc35a added configure checks for the iso-codes package.
2008-02-07  Sven Neumann  <sven@gimp.org>

	* configure.in: added configure checks for the iso-codes package.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimplanguagestore.[ch]:
	* app/widgets/gimplanguagestore-parser.[ch]: added rough outline
	of GtkListStore for language selection.

svn path=/trunk/; revision=24828
2008-02-07 16:50:11 +00:00
Sven Neumann
a44fa674f0 app/widgets/Makefile.am removed here...
2007-12-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-utils.[ch]: removed here...

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpcairo-utils.[ch]: and added here after some
	cleanup.

	* libgimpwidgets/gimpwidgets.h: include gimpcairo-utils.h.

	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererpalette.c: changed accordingly.

	* libgimpwidgets/gimpwidgets.def: updated for Cairo utils.

	* libgimp/gimp.def: added gimp_image_get_vectors_by_tattoo.


svn path=/trunk/; revision=24339
2007-12-12 14:17:19 +00:00
Michael Natterer
c22ca3f4f6 app/widgets/widgets-types.h app/widgets/Makefile.am new widget
2007-11-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h
	* app/widgets/Makefile.am
	* app/widgets/gimphandlebar.[ch]: new widget implementing the slider
	bar known from histogram and levels.

	* app/widgets/gimphistogrambox.[ch]: use the new widget. General
	cleanup and UI streamlining.


svn path=/trunk/; revision=24198
2007-11-20 09:10:39 +00:00
Michael Natterer
ae1f2eb2bc app/widgets/Makefile.am app/widgets/widgets-types.h new GimpHistogramView
2007-11-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcurveview.[ch]: new GimpHistogramView subclass
	which does all the curve stuff.

	* app/widgets/gimphistorgramview.[ch]: removed all curve code again.

	* app/tools/gimpcurvestool.c: changed accordingly.


svn path=/trunk/; revision=24051
2007-11-04 13:09:10 +00:00
Sven Neumann
734e02f121 app/widgets/Makefile.am new files holding Cairo utility functions.
2007-11-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-utils.[ch]: new files holding Cairo
	utility functions.

	* app/widgets/gimpviewrenderer.[ch]: ported partly to Cairo 
drawing.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpview.c: removed calls to
	gimp_view_renderer_unrealize() which are not needed anymore
	because we don't allocate a GC in the renderer any longer.

	* app/widgets/gimpcellrendererdashes.c: removed a redundant 
cast.


svn path=/trunk/; revision=24039
2007-11-01 23:37:00 +00:00
Sven Neumann
718ca7c790 app/widgets/Makefile.am app/widgets/widgets-types.h new widget derived
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagecommenteditor.[ch]: new widget derived from
	GimpImageParasiteView. Basically the code that used to live in
	image-properties-dialog.c.

	* app/dialogs/image-properties-dialog.c: use the comment editor.

svn path=/trunk/; revision=22846
2007-06-27 09:46:00 +00:00
Sven Neumann
09578ea070 removed extra check for gthread and fold it into the GLIB and GTK checks.
2007-06-25  Sven Neumann  <sven@gimp.org>

	* configure.in: removed extra check for gthread and fold it into
	the GLIB and GTK checks.

	* */Makefile.am: changed accordingly.

	* app/main.c (main): always call g_thread_init().

svn path=/trunk/; revision=22832
2007-06-25 12:41:59 +00:00
Sven Neumann
f322854007 app/text/Makefile.am app/core/Makefile.am app/tools/Makefile.am
2007-06-07  Sven Neumann  <sven@gimp.org>

	* app/text/Makefile.am
	* app/core/Makefile.am
	* app/tools/Makefile.am
	* app/display/Makefile.am
	* app/widgets/Makefile.am
	* app/base/Makefile.am
	* app/paint/Makefile.am
	* app/plug-in/Makefile.am
	* libgimp/Makefile.am
	* libgimpthumb/Makefile.am
	* tools/pdbgen/Makefile.am
	* libgimpwidgets/Makefile.am: applied the remaining parts of the
	patch from Daniel Richard G. to fix out-of-source-tree builds
	(bug #444960).

svn path=/trunk/; revision=22735
2007-06-07 13:19:44 +00:00
Michael Natterer
1a5cfac5e6 app/widgets/gimpsessioninfoaux.[ch] app/widgets/gimpsessioninfobook.[ch]
2007-05-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfoaux.[ch]
	* app/widgets/gimpsessioninfobook.[ch]
	* app/widgets/gimpsessioninfodock.[ch]
	* app/widgets/gimpsessioninfodockable.[ch]: renamed these...

	* app/widgets/gimpsessioninfo-aux.[ch]
	* app/widgets/gimpsessioninfo-book.[ch]
	* app/widgets/gimpsessioninfo-dock.[ch]
	* app/widgets/gimpsessioninfo-dockable.[ch]: ...to these.

	* app/widgets/Makefile.am
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdocked.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpsessioninfo.c: changed accordingly.


svn path=/trunk/; revision=22614
2007-05-25 11:42:28 +00:00
Michael Natterer
2bf21338a3 removed more code and cleaned up the API.
2007-05-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]: removed more code and cleaned
	up the API.

	* app/widgets/Makefile.am
	* app/widgets/gimpsessioninfodock.[ch]: added the removed code here.

	* app/widgets/gimpdialogfactory.c: changed accordingly.


svn path=/trunk/; revision=22604
2007-05-24 20:06:34 +00:00
Michael Natterer
616ba659f3 removed lots of code...
2007-05-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]: removed lots of code...

	* app/widgets/Makefile.am
	* app/widgets/gimpsessioninfoaux.[ch]
	* app/widgets/gimpsessioninfobook.[ch]
	* app/widgets/gimpsessioninfodockable.[ch]: ...and added it here.
	Also allocate all structs using GSLice.

	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdocked.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppaletteeditor.c: changed accordingly.


svn path=/trunk/; revision=22603
2007-05-24 19:22:06 +00:00
Michael Natterer
dfd1309b19 app/widgets/Makefile.am app/widgets/widgets-types.h remove
2007-04-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: remove GimpCellRenererAccel.

	* app/widgets/gimpactionview.c: use GtkCellRendererAccel instead.
	If an action has no label, use its name as label. Always show the
	"Name" column because there are too many actions with confusingly
	similar names.


svn path=/trunk/; revision=22256
2007-04-16 13:43:31 +00:00
Sven Neumann
bfd1dd5f07 INSTALL check for D-Bus GLib bindings.
2007-01-19  Sven Neumann  <sven@gimp.org>

	* INSTALL
	* configure.in: check for D-Bus GLib bindings.

	* app/Makefile.am
	* app/main.c: check if an interactive GIMP instance proposes
	itself on the D-Bus and delegate to it. Allow this behaviour to be
	overridden by using the --new-instance command-line option.

	* app/widgets/Makefile.am
	* app/widgets/gimpdbusservice.[ch]
	* app/widgets/dbus-service.xml: added an object that offers a
	D-Bus service.

	* app/gui/Makefile.am
	* app/gui/gui.c: connect to the D-Bus and export the GimpDBusService.


svn path=/trunk/; revision=21737
2007-01-19 14:50:13 +00:00
Sven Neumann
fd2b9ce3e9 app/plug-in/plug-in-icc-profile.[ch] removed run-mode argument from
2006-12-18  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-icc-profile.[ch]
	* plug-ins/common/lcms.c: removed run-mode argument from
	plug-in-icc-profile-info. Added new procedure to obtain
information
	about a color profile on disk.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprofilechooserdialog.[ch]: added a first draft
	of a file-chooser dialog for selecting a color profile.

	* app/dialogs/preferences-dialog.c: use it.
2006-12-18 08:15:56 +00:00
Michael Natterer
cd0c301a3f app/widgets/Makefile.am new widget featuring a proof-of-concept palette
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcolorselectorpalette.[ch]: new widget featuring
	a proof-of-concept palette color selector. It always shows the
	current palette and doesn't bother to have any features yet. If I
	don't get around finishing this I will disable it for the 2.4
	release, but it's better kept in CVS than on my disk...
	Addresses bug #132146.

	* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): attach
	the passed context to the dialog so the palette selector can find
	it (puke).

	* app/gui/gui.c (gui_restore_callback): register the new object
	with the GType system.
2006-11-03 17:28:52 +00:00
Sven Neumann
4f4dea5645 app/widgets/Makefile.am app/widgets/widgets-types.h new abstract base
2006-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimageparasiteview.[ch]: new abstract base class.

	* app/widgets/gimpimageprofileview.[ch]: derive from
	GimpImageParasiteView.
2006-11-03 13:52:17 +00:00
Sven Neumann
13ba2a52db added signals "parasite-attached" and "parasite-detached".
2006-10-25  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: added signals "parasite-attached" and
	"parasite-detached".

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimageprofileview.[ch]: draft of a new widget
that
	displays color profile information.

	* app/widgets/gimpimagepropview.c: minor cleanup and bug fix.

	* app/dialogs/image-properties-dialog.c: added Color Profile
	information.

	* plug-ins/common/lcms.c: bug fixes.
2006-10-25 07:31:04 +00:00
Michael Natterer
7d08450cbc Really fix bug #150593:
2005-09-12  Michael Natterer  <mitch@gimp.org>

	Really fix bug #150593:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpdockseparator.[ch]: new widget implementing the
	droppable separator bar in docks.

	* app/widgets/gimpdock.c: use it and removed local separator
	utility functions.

	* app/widgets/gimptoolbox.c: use GimpDockSeparator API to show/hide
	the label. Expand the separator initially.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: the separator height style property moved
	from GimpDock to GimpDockSeparator.
2005-09-12 17:48:40 +00:00
Michael Natterer
19ea2a9db4 app/widgets/Makefile.am new files keeping the render acceleration check
2005-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimprender.[ch]: new files keeping the render
	acceleration check buffers.

	* app/display/gimpdisplayshell-render.[ch]: removed them here.

	* app/gui/gui.c: initialize/shutdown the new buffers.

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/actions/view-actions.c
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell.c: use the new stuff. Removes
	lots of broken widgets -> display dependencies.
2005-07-19 20:42:14 +00:00
Michael Natterer
c0a10c8303 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-07-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppaletteview.[ch]: new widget which manages the
	selected palette entry itself and emits "selected", "activated"
	and "context" signals. Not used yet.

	* app/widgets/gimpviewrendererpalette.[ch]: reimplemented palette
	drawing: added optional grid drawing and APIs to configure the
	renderer. Should be ready for the palette editor now.
2005-07-14 14:41:29 +00:00
Michael Natterer
98dc0a67b7 app/widgets/Makefile.am app/widgets/widgets-types.h new view renderer,
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererpalette.[ch]: new view renderer,
	does nothing yet except chaining up in ::render().

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_by_viewable_type): use it for palettes.
2005-07-13 20:11:24 +00:00
Sven Neumann
a8318e18c5 added utility functions to copy and to free a dash pattern.
2005-05-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.[ch]: added utility functions to copy
	and to free a dash pattern.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendererdashes.[ch]: added a simple cell
	renderer to visualize a dash pattern.

	* app/widgets/gimpstrokeeditor.c: show previews of the dash
	presets in the combo-box.
2005-05-21 20:24:42 +00:00
Michael Natterer
1f1305c372 Some dock refactoring which separates the docking logic from active image
2005-05-11  Michael Natterer  <mitch@gimp.org>

	Some dock refactoring which separates the docking logic from
	active image and UI manager stuff:

	* app/widgets/gimpmenudock.[ch]: new widget renamed from
	GimpImageDock, zero changes except the name change.

	* app/widgets/gimpimagedock.[ch]: new widget derived from
	GimpDock. Keeps the UI manager.

	* app/widgets/gimpdock.[ch]: removed the UI manager. GimpDock only
	contains the basic docking logic again.

	* app/widgets/gimpmenudock.[ch]
	* app/widgets/gimptoolbox.[ch]: derive them from GimpImageDock.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/actions/dialogs-commands.c
	* app/actions/dock-actions.c
	* app/actions/dock-commands.c
	* app/actions/dockable-commands.c
	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-05-11 20:26:12 +00:00
Michael Natterer
92ad7c1d53 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-05-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerlist.[ch]: new widget which allows
	adding/removing controllers using two lists of available/active
	controllers. Work in progress...

	* app/widgets/gimpcontrollerinfo.[ch]: derive it from GimpVieable
	so it can have an icon (unfinished). Added convenience constructor
	gimp_controller_info_new().

	* app/dialogs/preferences-dialog.c: use a GimpControllerList
	instead of a notebook of GimpControllerEditors.
2005-05-09 09:35:41 +00:00
Michael Natterer
7609645970 Implement dragging and dropping in any GdkPixbuf supported format. Fixes
2005-04-09  Michael Natterer  <mitch@gimp.org>

	Implement dragging and dropping in any GdkPixbuf supported
	format. Fixes bug #172794 and bug #172795.

	* app/core/gimplayer.[ch] (gimp_layer_new_from_region): new
	function which contains all stuff that was in
	gimp_layer_new_from_tiles().

	(gimp_layer_new_from_tiles): use above function.
	(gimp_layer_new_from_pixbuf): new function.

	* app/widgets/Makefile.am
	* app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf
	utility functions for clipboard and DnD.

	* app/widgets/gimpselectiondata.[ch]: removed
	gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API.
	Also removed GdkAtom parameters all over the place because it's
	always the same as selection_data->target.

	* app/widgets/gimpclipboard.c: use the new pixbuf utility
	functions and gtk_selection_data_set,get_pixbuf().

	* app/widgets/widgets-enums.h
	* app/widgets/gimpdnd.[ch]: removed never-implemented
	GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF
	instead. Added API to drag and drop GdkPixbufs which transparently
	converts from/to and GdkPixbuf-supported image format. Removed
	passing around of GdkAtoms, since they were always the same
	as selection_data->target.

	* app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal.

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_pixbuf().

	* app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf().

	* app/widgets/gimplayertreeview.c: implement drop_pixbuf().

	* app/widgets/gimpdrawabletreeview.c: allow to drag all drawables
	as pixbufs.

	* app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
Michael Natterer
dba31b149c More unfinished replacement for the info window:
2005-04-05  Michael Natterer  <mitch@gimp.org>

	More unfinished replacement for the info window:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagepropview.[ch]: new widget showing an image's
	size, resolution, mode, memsize etc.

	* app/dialogs/Makefile.am
	* app/dialogs/image-properties-dialog.[ch]: a dialog keeping the
	widget.

	* app/widgets/gimphelp-ids.h: a help ID for the dialog.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* menus/image-menu.xml.in: action and menu entry for the dialog.
2005-04-04 22:34:29 +00:00
Michael Natterer
0231374c86 added new signals "sample-point-added" and "sample-point-removed" and
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added new signals "sample-point-added"
	and "sample-point-removed" and public functions to emit them.

	* app/core/gimpimage-sample-points.c (gimp_image_add_sample_point)
	(gimp_image_remove_sample_point): emit them accordingly.

	* app/core/gimpimage-undo-push.c (undo_pop_image_sample_point):
	ditto.

	(undo_pop_image_guide)
	(undo_pop_image_sample_point): added comments why we add/remove
	stuff manually instead of using the GimpImage APIs.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcursorview.[ch]
	* app/widgets/gimpsamplepointeditor.[ch]: new widgets.
	GimpCursorView is a replacement for the info window's "Cursor"
	page, GimpSamplePointEditor is a view on an image's sample points.
	The sample point editor does nothing yet except keeping a 2x2 grid
	of GimpColorFrames. Addresses bug #137776.

	* app/dialogs/dialogs.c
	* app/dialogs/dialogs-constructors.[ch]: register the new widgets
	as dockable dialogs.

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* menus/dialogs-menuitems.xml: added actions and menu items for
	the new dialogs.

	* app/display/gimpdisplayshell-cursor.c
	(gimp_display_shell_update_cursor)
	(gimp_display_shell_clear_cursor): update the new cursor view.

	* app/widgets/gimphelp-ids.h: help IDs for the new dialogs.

	* app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode):
	changed description "Pixel values" to "Pixel" because the former
	was too long.
2005-04-03 15:48:03 +00:00
Sven Neumann
3ba107f1f9 app/widgets/Makefile.am app/widgets/gimpfgbgview.[ch] added new widget
2005-03-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpfgbgview.[ch]
	* app/widgets/widgets-types.h: added new widget GimpFgBgView;
	somewhat similar to GimpFgBgEditor but a lot simpler.

	* app/widgets/gimpcoloreditor.c: use GimpFgBgView as preview widget.
	Closes bug #168592.

	* app/widgets/gimpfgbgeditor.c: gracefully handle a very small
	size allocation.
2005-03-31 13:39:18 +00:00
Sven Neumann
0bc3233be7 app/widgets/Makefile.am new files.
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpdnd-xds.[ch]: new files.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/widgets-enums.h: added a basic XDS (Direct Save
	Protocol) implementation.

	* app/widgets/gimpimageview.c: allow to save images by dragging
	them from the Images dialog to an XDS capable file manager.
2005-03-25 14:23:35 +00:00
Sven Neumann
9511753a02 check for gthread-2.0 unless the --disable-mp option is given.
2005-02-13  Sven Neumann  <sven@gimp.org>

	* configure.in: check for gthread-2.0 unless the --disable-mp
	option is given.

	* app/app_procs.c (app_libs_init): call g_thread_init().

	* app/base/pixel-processor.c: ported to GThread.

	* app/Makefile.am
	* app/*/Makefile.am: use @GTHREAD_CFLAGS@.
2005-02-13 15:08:08 +00:00
William Skaggs
6d74b06daf Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpenumwidgets.c
	* app/widgets/gimpenumwidgets.h: magic-moved from here...

	* libgimpwidgets/gimpenumwidgets.c
	* libgimpwidgets/gimpenumwidgets.h: ...to here.

	* app/dialogs/convert-dialog.c
	* app/dialogs/layer-add-mask-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/Makefile.am
	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h: all changed accordingly.
	Still need to do devel-docs.
2005-01-29 01:08:20 +00:00
Sven Neumann
3069695265 app/widgets/Makefile.am app/widgets/widgets-types.h
2005-01-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenumcombobox.[ch]
	* app/widgets/gimpenumstore.[ch]: moved GimpEnumStore and
	GimpEnumComboBox from here ...

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpenumcombobox.[ch]
	* libgimpwidgets/gimpenumstore.[ch]: ... to libgimpwidgets.

	* app/dialogs/convert-dialog.c
	* app/dialogs/scale-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpstrokeeditor.c
	* data/images/gimp-splash.png: changed includes accordingly.
2005-01-21 22:59:51 +00:00
Michael Natterer
40928bb578 use a GtkUIManager instead of a GtkItemFactory. Added virtual function
2004-11-04  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
	of a GtkItemFactory. Added virtual function ::get_action_type()
	and create the manager's actions manually using that action type
	instead of using gtk_action_group_add_actions().

	* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
	creates GimpActions (which can have a color attached) instead of
	GtkActions. Changed the menu item visibility and color preview
	code accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpitemfactory.[ch]: finally removed.

	* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
2004-11-04 12:15:49 +00:00
Michael Natterer
ea1b88f580 app/widgets/Makefile.am app/widgets/widgets-types.h new widget built from
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollereditor.[ch]: new widget built from
	preliminary code from the prefs dialog. Prerequisite for finally
	fixing bug #106920.

	* app/dialogs/preferences-dialog.c: use the new widget.
2004-10-26 12:26:47 +00:00
Michael Natterer
6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Sven Neumann
8300c550e3 app/widgets/Makefile.am app/widgets/widgets-types.h added a simple message
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagedialog.[ch]: added a simple message
	dialog to avoid code duplication.

	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

	* app/dialogs/file-save-dialog.c
	* app/dialogs/quit-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 14:35:28 +00:00
Sven Neumann
22a1384b5a app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.

	* app/widgets/gimppropwidgets.c: the order of setting the X and Y
	properties does matter.

	* app/dialogs/Makefile.am
	* app/dialogs/scale-dialog.[ch]: added first version of a new
	Scale dialog in an attempt to address bug #151022.

	* app/actions/layers-commands.c: use the new scale dialog.
2004-10-12 14:59:14 +00:00
Michael Natterer
eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Sven Neumann
0527d02329 themes/Default/images/Makefile.am added a stock icon that shows a simple
2004-09-27  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-frame-64.png: added a stock icon
	that shows a simple drop shadow but could be exchanged for other
	image decorations.

	* libgimpwidgets/gimpstock.[ch]: register the new icon.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
	ugly code to draw a frame around a preview pixbuf.

	* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
	to the GimpViewRenderer class so it can be shared by all renderers.

	* app/widgets/gimpviewrendererimagefile.c: use the new functionality
	to draw a nice frame around imagefile previews.

	* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
2004-09-27 19:40:12 +00:00
Michael Natterer
96a27b59cf app/actions/brushes-actions.c app/actions/gradients-actions.c
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/brushes-actions.c
	* app/actions/gradients-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c: made the "foo-edit" actions
	GimpStringActions and pass the identifier of the editor dialog
	to the callback.

	* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
	show the editor dialog here instead of calling view->edit_func().

	* app/dialogs/dialogs-constructors.[ch]: removed the brush,
	gradient and palette edit_funcs.

	* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.

	* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
	member and parameters and create the edit button unconditionally.

	* app/widgets/gimpbrushfactoryview.[ch]
	* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpdataselect.[ch]: removed this class, it's not
	needed any longer.

	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
	and follow the edit_func removal.

	* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
	stuff.

	* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
2004-09-27 10:45:49 +00:00
Michael Natterer
ee5354e4b7 app/dialogs/Makefile.am removed...
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/color-dialog.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.

	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* app/actions/gradient-editor-commands.c
	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 20:41:40 +00:00
Michael Natterer
c450ca1858 app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
	which knows how to preserve a GimpBuffer's aspect ratio if the
	view's aspect ratio is different.

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_from_viewable_type): use it for viewables
	of type GimpBuffer. Fixes bug #152531
2004-09-14 12:06:28 +00:00
David Odin
ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin
1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin
e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann
80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin
cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann
578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00