Commit graph

4995 commits

Author SHA1 Message Date
Sven Neumann
cbb9ba9860 fixed label.
2004-12-18  Sven Neumann  <sven@gimp.org>

	* app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label.
2004-12-18 17:05:32 +00:00
Sven Neumann
a493f0dea2 don't use the rect-select cursor if the tool is in move-layer mode.
2004-12-17  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't
	use the rect-select cursor if the tool is in move-layer mode.
	Spotted by Joao S. O. Bueno, bug #161465.
2004-12-17 15:16:36 +00:00
Simon Budig
7228441256 Minor fix: Update the Graph after adding a control point
(merged into the last Changelog entry)
2004-12-17 13:47:29 +00:00
Simon Budig
306fa33a01 Kill some nonsensical code that tried to set control points in a free form
2004-12-17  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcurvestool.c: Kill some nonsensical code that
	tried to set control points in a free form curve based on the
	image coordinates (huh?). Untabbified.
2004-12-17 13:11:29 +00:00
Sven Neumann
da12388bd2 take drawable offsets into account. Fixes bug #161508.
2004-12-17  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color):
	take drawable offsets into account. Fixes bug #161508.
2004-12-17 12:31:11 +00:00
Sven Neumann
f21cde69a0 don't show the Crop tool window if Shift is being pressed on the initial
2004-12-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: don't show the Crop tool window if
	Shift is being pressed on the initial button_press event.
2004-12-13 21:09:43 +00:00
Michael Natterer
13a32c91cc applied patch from Sven Neumann which removes code that prevents layers
2004-12-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.c: applied patch from Sven Neumann
	which removes code that prevents layers with mask from being
	transformed.

	* app/tools/gimptransformtool.[ch]: added "gboolean mask_empty"
	parameter to GimpTransformTool::transform(). Needed because the
	selection gets cleared by cutting from the drawable and we need
	the selection's state before that cutting.

	(gimp_transform_tool_doit): pass "mask_empty" to
	GimpTransformTool::transform():

	* app/tools/gimptransformtool.c (gimp_transform_tool_real_transform)
	* app/tools/gimpfliptool.c (gimp_flip_tool_transform): when
	transforming a layer with mask and there is no selection,
	transform the mask just as if it was a linked item.
	Fixes bug #143837 and bug #159697.
2004-12-06 14:37:00 +00:00
Sven Neumann
027cec0d18 made the Size scale logarithmic as suggested in bug #159632.
2004-11-27  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic
	as suggested in bug #159632.
2004-11-27 13:06:39 +00:00
Sven Neumann
2dcbec8418 only show the Incremental toggle for tools that use it (bug #159306).
2004-11-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only
	show the Incremental toggle for tools that use it (bug #159306).
2004-11-26 15:14:21 +00:00
Michael Natterer
d8a5ca6c1b added new function gimp_toggle_button_set_visible() which can be used as
2004-11-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_toggle_button_set_visible() which can be used as "toggled"
	callback on a GtkToggleButton and sets a widget (in)visible
	according to the toggle's "active" state.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c: use it to hide (rather than
	just insensitize) the seldomly used "Feather edges", "Autoshrink
	selection", "Adaptive supersampling", "Fade out" and "Use color
	from gradient" widgets when their enabling toggle is unchecked.
	Makes the affected tool options much less crowded and noisy in
	their default appearance. Fixes bug #159008.
2004-11-23 17:01:51 +00:00
Michael Natterer
512b1120c4 added a "menu_factory" parameter instead of trying to get it from the
2004-11-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new):
	added a "menu_factory" parameter instead of trying to get it from
	the toplevel GimpDock (which does not exists if the tool options
	dialog does not exist). Fixes bug #159071.

	* app/tools/gimptexttool.c (gimp_text_tool_editor): pass the
	menu_factory.

	* app/dialogs/dialogs.c (dialogs_init): pass the global menu
	factory also when constructing the "toplevel" dialog factory so
	the above works.
2004-11-22 16:03:54 +00:00
Hans Breuer
696663a611 [new file] app/dialogs/Makefile.am : added to EXTRA_DIST
2004-09-21  Hans Breuer  <hans@breuer.org>

	* app/dialogs/makefile.msc : [new file]
	  app/dialogs/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc app/gimpcore.def : updated

	* app/gimp.rc : let wilber be first

	* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either

	* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib

	* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32

	* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h

	* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/scrip-fu.c : there
	is no script-fu-server on win32
2004-11-21 14:22:45 +00:00
Michael Natterer
c0d9179492 removed redundant "gimage" parameter.
2004-11-16  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list):
	removed redundant "gimage" parameter.

	* app/tools/gimpeditselectiontool.c: changed accordingly.
2004-11-16 13:52:04 +00:00
Manish Singh
5d01581069 Fix a bunch of warnings from Sparse:
2004-11-13  Manish Singh  <yosh@gimp.org>

        Fix a bunch of warnings from Sparse:

        * app/actions/dockable-commands.c
        * app/actions/layers-actions.c
        * app/actions/view-commands.c
        * app/base/pixel-surround.c
        * app/config/gimpconfig-utils.c
        * app/config/gimpscanner.c
        * app/core/gimpbrushgenerated.c
        * app/core/gimpcontainer.c
        * app/core/gimpimage.c
        * app/dialogs/palette-import-dialog.c
        * app/file/gimprecentlist.c
        * app/plug-in/plug-in-params.c
        * app/text/gimptext-compat.c
        * app/text/gimptext-parasite.c
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpstroke.c
        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimpselectiondata.c
        * app/xcf/xcf.c
        * libgimp/gimp.c
        * libgimpthumb/gimpthumb-utils.c
        * libgimpthumb/gimpthumbnail.c
        * modules/cdisplay_proof.c
        * plug-ins/Lighting/lighting_ui.c
        * plug-ins/common/csource.c
        * plug-ins/common/glasstile.c
        * plug-ins/common/nova.c
        * plug-ins/common/pcx.c
        * plug-ins/common/pnm.c
        * plug-ins/common/randomize.c
        * plug-ins/common/screenshot.c
        * plug-ins/common/sel_gauss.c
        * plug-ins/common/spheredesigner.c
        * plug-ins/common/wind.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gimpressionist/gimpressionist.c
        * plug-ins/ifscompose/ifscompose.c
        * plug-ins/print/gimp_main_window.c
        * plug-ins/print/print.c: Cleanup integer vs. pointer confusion.

        * app/base/temp-buf.c
        * app/dialogs/about-dialog.c
        * plug-ins/common/bumpmap.c
        * plug-ins/common/jigsaw.c
        * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.

        * app/config/gimpconfig-deserialize.c
        * app/config/gimpconfig-path.c
        * app/config/gimpconfigwriter.c
        * app/core/gimpgradient.c
        * app/tools/gimpdrawtool.c
        * plug-ins/common/nlfilt.c
        * plug-ins/common/unsharp.c
        * plug-ins/common/zealouscrop.c: Define inline functions before they
        are used.

        * app/core/gimpdrawable-blend.c: PixelRegion definition was changed
        some time ago, but the initialization here didn't change. Fix it.

        * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
        assign token twice in a row.

        * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
        need to initialize file_data, since the code fills out all the fields.

        * plug-ins/common/CML_explorer.c
        * plug-ins/common/vpropagate.c: Declare function pointers fully.

        * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
        we assume we can use the "inline" keyword always.

        * plug-ins/common/psd_save.c
        * plug-ins/common/vinvert.c
        * plug-ins/gfig/gfig-arc.c
        * plug-ins/gfig/gfig-bezier.c
        * plug-ins/gfig/gfig-circle.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gfig/gfig-ellipse.c
        * plug-ins/gfig/gfig-line.c
        * plug-ins/gfig/gfig-poly.c
        * plug-ins/gfig/gfig-spiral.c
        * plug-ins/gfig/gfig-star.c
        * plug-ins/gfig/gfig.c
        * plug-ins/gimpressionist/orientmap.c
        * plug-ins/gimpressionist/placement.c
        * plug-ins/gimpressionist/sizemap.c
        * plug-ins/imagemap/imap_grid.c
        * plug-ins/imagemap/imap_main.c
        * plug-ins/imagemap/imap_preferences.c
        * plug-ins/imagemap/imap_settings.c
        * plug-ins/maze/maze.c
        * plug-ins/sel2path/curve.c
        * plug-ins/sel2path/fit.c
        * plug-ins/sel2path/pxl-outline.c
        * plug-ins/sel2path/spline.c
        * plug-ins/xjt/xjt.c: Functions with no args should be declared
        with (void).

        * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
        the compiler.
2004-11-14 02:50:33 +00:00
Michael Natterer
cd7972a8c2 call gimp_image_flush() after committing the image_map so the menus are
2004-11-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
	call gimp_image_flush() after committing the image_map so the
	menus are up-to-date. Fixes bug #157914.
2004-11-11 10:16:57 +00:00
Michael Natterer
04a7e8585b added new function gimp_statusbar_push_length(), which works exactly like
2004-11-10  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.[ch]: added new function
	gimp_statusbar_push_length(), which works exactly like
	push_coords() but takes only one value plus a GimpOrientationType
	for specifying the value's axis.

	* app/tools/gimptool.[ch]: added the corresponding
	gimp_tool_push_status_length().

	* app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
	so the guide position is shown in the selected display unit.
	Cleaned up the status message code a bit.
2004-11-10 01:17:40 +00:00
Michael Natterer
6d9a69c0a6 pass (gint)-truncated coordinates instead of RINT()-rounded ones to
2004-11-09  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): pass (gint)-truncated
	coordinates instead of RINT()-rounded ones to
	gimp_display_shell_update_cursor(). Restores correct coordinates
	display for zoomed-in display and fixes bug #153534.

	* app/tools/gimpmovetool.c: added statusbar messages including the
	(rounded) guide coordinate. Keeps bug #141719 closed.
2004-11-09 13:03:07 +00:00
Michael Natterer
5d7b121fd7 Don't use deprecated GtkToolbar API in GimpTextEditor:
2004-11-04  Michael Natterer  <mitch@gimp.org>

	Don't use deprecated GtkToolbar API in GimpTextEditor:

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/text-editor-actions.[ch]
	* app/actions/text-editor-commands.[ch]: added acions and
	callbacks for the new "text-editor" action group.

	* app/menus/menus.c: register a "<TextEditor>" UI manager.

	* menus/Makefile.am
	* menus/text-editor-toolbar.xml: new file for the toolbar.

	* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
	UI manager instead of constructing it using deprecated API.

	* app/tools/gimptextoptions.c: changed accordingly.

	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
	(used by text-editor-commands.c).
2004-11-04 14:24:32 +00:00
Michael Natterer
ecc9fecfc9 added "gboolean recalc_highlight" and call
2004-11-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c (crop_recalc): added "gboolean
	recalc_highlight" and call gimp_display_shell_set_highlight() only
	when it's TRUE. Pass TRUE from all places where the crop outline
	actually changed.

	(gimp_crop_tool_control): added back the call to crop_recalc() for
	the RESUME case so the outline gets updated on zoom/scroll, but pass
	recalc_highlight = FALSE because it has not changed.
	Fixes bug #157001.
2004-11-02 11:26:05 +00:00
Øyvind Kolås
c5c0a219d9 renamed *levels-auto to *levels-stretch 2004-11-01 16:05:19 +00:00
Sven Neumann
267676fa99 app/config/gimpguiconfig.[ch] app/config/gimprc-blurbs.h
2004-10-30  Sven Neumann  <sven@gimp.org>

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h
	* app/dialogs/preferences-dialog.c
	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimpmovetool.[ch]: reverted changes for bug #156801.
	Instead added a gimprc option that allows to get the old behaviour
	back.
2004-10-30 15:02:39 +00:00
Sven Neumann
e4a871c10b changed default value for new "change-active" property 2004-10-30 14:16:57 +00:00
Sven Neumann
9fd4ac8a6d app/tools/gimpmoveoptions.[ch] applied (cleaned up version of) a patch
2004-10-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a
	patch from Joao S. O. Bueno that adds a tool-option to restore the
	old Move tool behaviour. Fixes bug #156801.
2004-10-30 13:52:20 +00:00
Michael Natterer
d0ab9a7470 app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2 bounding boxes
2004-10-27  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2
	bounding boxes to x,y,width,height ones. Added
	gimp_transform_matrix_flip_free(). Renamed some parameters to be
	consistent with others. Some internal cleanup.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* tools/pdbgen/pdb/drawable_transform.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

	* tools/pdbgen/pdb/drawable_transform.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: guard all transform
	wrappers with if(gimp_drawable_mask_intersect(...)), also the
	ones which don't need the returned bounding box.

	* tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters
	and added gimp_drawable_transform_matrix() which takes the 9
	coefficients of a 3x3 matrix for ultimate flexibility ;)

	* app/pdb/drawable_transform_cmds.c
	* app/pdb/internal_procs.c
	* app/pdb/transform_tools_cmds.c
	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-10-27 17:56:02 +00:00
Michael Natterer
6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Simon Budig
fdd150e310 Switch to design mode when Escape gets pressed. Untabbified.
2004-10-25  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Switch to design mode when
	Escape gets pressed. Untabbified.
2004-10-25 13:29:32 +00:00
Michael Natterer
6e9d0cfa5d added labels ("_Stroke") to the SLEECTION_STROKE and PATH_STROKE stock
2004-10-23  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
	SLEECTION_STROKE and PATH_STROKE stock items so they can be used
	in action areas.

	* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
	with "_Stroke" and reordered some code.

	* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
	of GTK_STOCK_OK. Added parameters to specify the dialog's title
	so it doesn't say "Stroke Options".

	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
	Path" as dialog titles.
2004-10-23 10:28:56 +00:00
Sven Neumann
43a4629965 app/tools/gimpimagemaptool.[ch] app/tools/gimpcurvestool.c allow to
2004-10-22  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: allow to Shift-click the Load and
	Save buttons to skip the file chooser dialog and reuse the last
	used filename. Fixes bug #75558.
2004-10-22 19:44:03 +00:00
Michael Natterer
5507c47c6d removed 3 mnemonics. No other tool options label has a mnemonic. Addresses
2004-10-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_gui): removed
	3 mnemonics. No other tool options label has a mnemonic.
	Addresses bug #155861.
2004-10-19 17:37:44 +00:00
Michael Natterer
c49df22eef Action code review and pre-release consistency cleanup:
2004-10-18  Michael Natterer  <mitch@gimp.org>

	Action code review and pre-release consistency cleanup:

	* app/actions/*-actions.c: added some missing and resolved
	conflicting mnemonics, added missing help IDs. Cleaned up the
	*_actions_update() functions.

	* app/actions/channels-actions.c
	* app/actions/layers-actions.c
	* app/actions/vectors-actions.c (*_actions_update): simplified
	the code that figures the prev and next channel,layer,vectors.

	* app/actions/qmask-actions.c: use the same accelerator for
	"qmask-active" and "qmask-toggle". Fixed action sensitivity.

	* app/actions/channels-commands.c
	* app/actions/dockable-commands.c
	* app/actions/documents-commands.c
	* app/actions/gradients-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/image-commands.c
	* app/actions/select-commands.c
	* app/actions/vectors-commands.c: folded tons of private utility
	functions into their only callers (they used to be public and
	called from outside before the switch to action based menus).
	Renamed functions and variables saying "query" or "qbox" to
	"dialog". Moved static functions to the end of the files. Misc
	minor cleanups.

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.c: made the "drawable-visible" and
	"drawable-linked" actions affect the layer if the active drawable
	is a layer mask.

	* app/actions/select-commands.c: added action to stroke with the
	last values used in an attempt to address bug #135746 but #if 0'ed
	it because the approach is too ugly.

	* app/tools/gimpiscissorstool.c: changed mnemonic from I to S.

	* menus/image-menu-xml.in: added more stuff to the (commented out)
	"context" menu.
2004-10-18 11:29:58 +00:00
Sven Neumann
428a80a1ee removed the "Density" label. It wasn't helpful and caused the transform
2004-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c: removed the "Density" label.
	It wasn't helpful and caused the transform options to be wider than
	necessary.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptransformoptions.c: let combo boxes expand
	horizontally like we do in other (all ?) dialogs.

	* app/widgets/gimptemplateeditor.c
	(gimp_template_editor_aspect_callback): update the pixel size label.
2004-10-14 22:55:18 +00:00
Michael Natterer
27c2be7cea libgimpwidgets/gimpwidgets.c app/widgets/gimpenumwidgets.[ch]
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.c
	* app/widgets/gimpenumwidgets.[ch]
	* app/widgets/gimppropwidgets.c
	* app/actions/layers-commands.c
	* app/dialogs/convert-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinkoptions-gui.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: the child of a GimpFrame must
	not have any border width. Fixes many subtle misalignments.
2004-10-14 15:44:13 +00:00
Michael Natterer
eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Michael Natterer
08bab5b31d added utility functions which create a
2004-10-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: added utility functions
	which create a GimpViewableButton+GimpContainerEntry combo for
	brushes, patterns, gradients and fonts and a very ugly utility
	function which packs one of these combos into a GtkFrame returned
	by gimp_prop_enum_radio_frame_new(). This stuff does not really
	belong here but is too ugly to be moved to a more general place.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: use the new utility functions. Moved
	the pattern previews into the radio frame where using the pattern
	is selected. Make them insensitive if using the pattern is not
	selected.
2004-10-11 13:27:42 +00:00
Michael Natterer
8a622048f3 implement GimpTool::key_press() and cancel the tool on GDK_Escape. Come
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
	cancel the tool on GDK_Escape. Come cleanup.
2004-10-08 15:32:30 +00:00
Michael Natterer
57f9d32e56 Made the text options about two toolbox grid columns smaller. Addresses
2004-10-08  Michael Natterer  <mitch@gimp.org>

	Made the text options about two toolbox grid columns smaller.
	Addresses bug #122862.

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
	the number of digits of the property's max_val plus two as number
	of chars for the sizeentry'y spinbutton (instead of always 10 as
	before).

	* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
	has a minimal width of 150 pixels (eek). Set a silly small minimal
	width instead (the entry expands to the available width anyway).
2004-10-08 14:00:41 +00:00
Michael Natterer
c9f9c56ce7 the gradient button in blend options got lost, added it back. Also moved
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppaintoptions-gui.c: the gradient button in blend
	options got lost, added it back. Also moved creation of the brush,
	pattern and gradient buttons to utility functions and cleaned up
	the whole file a bit.
2004-10-08 11:08:50 +00:00
Michael Natterer
76d95a10d0 added new parameter "gboolean propagate_release" to
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.[ch]: added new parameter
	"gboolean propagate_release" to gimp_edit_slection_tool_start()
	and remember it in the GimpEditSelectionTool struct. If requested,
	propagate GimpTool::button_release() to the tool below in the tool
	stack.

	* app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
	pass FALSE so we don't get the button_release().

	* app/tools/gimpmovetool.[ch]: pass TRUE so we get
	button_release(). If moving a layer or path in "pick active" mode,
	remember the old active layer/path and switch back to it in
	button_release(). Fixes bug #97734.

	Unrelated:

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_motion): set "first_move" to FALSE only
	if a move actually happened. Fixes un-undoable moves at high zoom
	factors.
2004-10-06 21:04:13 +00:00
Michael Natterer
62c23a2361 reset the tool options before deserializing so they have the correct
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
	options before deserializing so they have the correct default
	values. Fixes bug #120832.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: removed all set_defaults()
	utility functions and moved their code to reset(). The change
	above calls them automatically so there is no need to call them
	from the GUI constructors any more.
2004-10-06 17:21:22 +00:00
Michael Natterer
3f2d5e68b5 Fixed the scale constraints radio buttons:
2004-10-06  Michael Natterer  <mitch@gimp.org>

	Fixed the scale constraints radio buttons:

	* app/tools/gimptransformoptions.c (gimp_transform_options_gui):
	initialize the radio group with the correct value instead of
	resetting the model before creating the group.

	(gimp_scale_options_constrain_callback): change the model
	only if the radio button became active.

	(gimp_scale_options_constrain_notify): new callback which makes
	the radio buttons a real view on the model again (fixes GUI
	updates on modifier press/release).
2004-10-06 12:05:35 +00:00
Michael Natterer
dbd941c9f7 dispatch GDK_Escape to GimpTool::key_press().
2004-10-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_tool_events): dispatch GDK_Escape to
	GimpTool::key_press().

	* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
	* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
	cancel the tool on <Escape>.
2004-10-01 15:15:14 +00:00
Sven Neumann
6e8bb7ac12 destroy the info dialog instead of hiding it. Fixes session management.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c (crop_response): destroy the info
	dialog instead of hiding it. Fixes session management.
2004-10-01 12:41:54 +00:00
Sven Neumann
ef736c43b4 unset the highlight from crop_response() so it gets called when cropping
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: unset the highlight from
	crop_response() so it gets called when cropping is cancelled.

	* app/dialogs/info-dialog.c (info_dialog_show): do what the
	function name says, show the window, but don't present it.
	Fixes bugs #128833 and #138816.
2004-10-01 12:23:43 +00:00
Sven Neumann
297b53a466 no need to include gimpdisplayshell-render.h here.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: no need to include
	gimpdisplayshell-render.h here.

	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-render.[ch]

	* app/display/gimpdisplayshell.[ch]: added an API to highlight a
	rectangle (specified in image coordinates). Actually it doesn't
	highlight but dims the area outside the rectangle.

	* app/tools/gimpcroptool.c: use the new functionality to show the
	area to be cropped. Fixes bug #93360.
2004-10-01 09:50:04 +00:00
Sven Neumann
ab1045b8a1 plugged a tiny memleak spotted by Olivier.
2004-09-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
	tiny memleak spotted by Olivier.
2004-09-29 15:40:29 +00:00
Sven Neumann
5cc2b3e5f8 simplified code and removed a compiler warning.
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
	simplified code and removed a compiler warning.
2004-09-28 08:23:25 +00:00
Sven Neumann
d725502cff add a shortcut to the filechooser that points to the user's folder.
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
	add a shortcut to the filechooser that points to the user's folder.

	* app/actions/vectors-commands.c: added a file filter to the SVG
	import dialog.
2004-09-27 22:44:28 +00:00
Michael Natterer
fd8931f2ea set the folder using gtk_file_chooser_set_current_folder(), not
2004-09-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c
	(gimp_image_map_tool_settings_dialog): set the folder using
	gtk_file_chooser_set_current_folder(), not set_filename().
2004-09-24 14:15:38 +00:00
Sven Neumann
53ff497a93 app/base/curves.[ch] defined CURVES_NUM_POINTS and use it.
2004-09-24  Sven Neumann  <sven@gimp.org>

	* app/base/curves.[ch]
	* app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.

	* tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
	last control point which got initialized to (255,255) by
	curves_init(). Fixes bug #153635.

	* app/pdb/color_cmds.c: regenerated.
2004-09-24 13:39:57 +00:00
Michael Natterer
ff68106bf1 app/paint/gimpairbrushoptions.c app/paint/gimpcloneoptions.c
2004-09-24  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpairbrushoptions.c
	* app/paint/gimpcloneoptions.c
	* app/paint/gimpconvolveoptions.c
	* app/paint/gimpdodgeburnoptions.c
	* app/paint/gimperaseroptions.c
	* app/paint/gimpinkoptions.c
	* app/paint/gimppaintoptions.c
	* app/paint/gimppenciloptions.c
	* app/paint/gimpsmudgeoptions.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimphistogramoptions.c
	* app/tools/gimpimagemapoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmeasureoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptextoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c: code cleanup: untabified and
	trailing whitespace removal, removed empty instance_init()
	funcions, cleaned up variable declarations/initializations.
2004-09-24 12:01:35 +00:00
Michael Natterer
db89d80cb1 app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register) add
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
	* app/tools/gimppenciltool.c (gimp_pencil_tool_register):
	add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
	these tools use the current gradient. Fixes bug #153584.
2004-09-23 21:04:39 +00:00
Michael Natterer
10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
William Skaggs
b8265901d8 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
	by my previous commit -- no functional change.
2004-09-19 19:50:09 +00:00
William Skaggs
4b8a00274c Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: rearrange tool options as
	described in bug #153014.
2004-09-19 19:15:03 +00:00
Michael Natterer
7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Simon Budig
c07125554a Fix trailing whitespace introduced by me. /me hides embarrassed in a
2004-09-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
	/me hides embarrassed in a corner...   :)
2004-09-13 12:02:06 +00:00
Simon Budig
ef206e7fd2 Fix warnings and coding style.
2004-09-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Fix warnings and coding style.
2004-09-13 10:10:43 +00:00
Nathan Summers
8be9e2b2be disable crop and resize buttons while the operation is being processed.
2004-09-12  Nathan Summers  <rock@gimp.org>

        * app/tools/gimpcroptool.c: disable crop and resize buttons while the
	operation is being processed.  Fixes #152372.
2004-09-13 01:45:45 +00:00
Simon Budig
f7e4e55d1d reordered info_dialog_hide() and crop_tool_crop_image(), which avoids the
2004-09-06  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: reordered info_dialog_hide() and
	crop_tool_crop_image(), which avoids the repeated popping up
	of the info dialog and avoids a crash.

	Fixes bug #151712
2004-09-05 23:42:30 +00:00
Sven Neumann
d1825782ea avoid excessive use of strdup() and strcmp(). The strings are all constant
2004-08-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
	avoid excessive use of strdup() and strcmp(). The strings are all
	constant anyway.
2004-08-30 15:08:02 +00:00
David Odin
b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
David Odin
1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
Sven Neumann
7e18e1f3f8 set the paintbrush as the default tool as suggested in bug #151091.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
	as the default tool as suggested in bug #151091.
2004-08-26 09:41:18 +00:00
David Odin
cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
David Odin
f672ae9169 fixed a typo that broke the build.
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-23 00:45:40 +00:00
Sven Neumann
0c2d88e992 app/tools/Makefile.am added gimp_tool_motion_constrain(),
2004-08-22  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
	instead of duplicating that functionality.

	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
	instead of implementing completely different constraints.
2004-08-22 21:48:50 +00:00
Michael Natterer
02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Michael Natterer
da9c039eb2 removed the recently added "gdouble aspect_ratio"...
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.h: removed the recently added
	"gdouble aspect_ratio"...

	* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
2004-08-06 16:39:11 +00:00
Michael Natterer
db821565e2 Transform tool cleanup:
2004-08-06  Michael Natterer  <mitch@gimp.org>

	Transform tool cleanup:

	* app/tools/gimptransformtool.[ch]: added new virtual function
	GimpTransformTool::dialog_update().
	Made wrapper for ::recalc() public and function
	transform_bounding_box() private.
	Call ::dialog_update() and transform_bounding_box() from the
	::recalc() wrapper.

	* app/tools/gimpperspectivetool.[ch]
	* app/tools/gimprotatetool.[ch]
	* app/tools/gimpscaletool.[ch]
	* app/tools/gimpsheartool.[ch]: turned all info_dialog update
	functions into GimpTransformTool::dialog_update() implementations
	and don't call them from ::recalc(), also removed calls to
	transform_bounding_box(); both functions are called by the parent
	class now. Call gimp_transform_tool_recalc() when dialog values
	were changed, not the tool's internal function.
	Moved all static variables to the instance structs.
2004-08-06 16:27:13 +00:00
Michael Natterer
42bc755ca7 applied (modified) patch from Ari Pollak which enables controlling the
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
	Pollak which enables controlling the shear direction from the
	dialog and changing the shear direction without hitting "Reset".
	Fixes bug #149467.

	Also moved all static variables to the GimpShearTool struct and
	converted tabs to spaces.
2004-08-06 13:56:34 +00:00
Michael Natterer
bba0394529 increased the handle size from 8 to 9 pixels (which is the same as in the
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpiscissorstool.c: increased the handle size from 8
	to 9 pixels (which is the same as in the path tool) as suggested
	in bug #134250.
2004-08-05 15:44:34 +00:00
Michael Natterer
8db70a4c79 app/tools/gimpscaletool.c applied patch from Jordi Gay (attached to bug
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpscaletool.c
	* app/tools/gimptransformtool.h: applied patch from Jordi Gay
	(attached to bug #131111) which adds an aspect ratio spinbutton to
	the scale dialog and keeps the aspect ratio intact when with or
	height are changed using the dialog. Fixes bug #132274.

	* app/tools/gimpcroptool.c
	* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
	"wrap" and decrease their climb_rate.
2004-08-05 11:12:58 +00:00
Sven Neumann
50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer
b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Sven Neumann
c6cbd6d335 Applied a bunch of AIX portability fixes (bug #148813):
2004-07-30  Sven Neumann  <sven@gimp.org>

	Applied a bunch of AIX portability fixes (bug #148813):

	* configure.in: when testing for Xmu library, link with -lXt -lX11.

	* app/gui/tips-parser.c
	* app/gui/user-install-dialog.c
	* app/tools/tools-enums.h
	* app/widgets/gimpdasheditor.c
	* app/widgets/widgets-enums.h
	* libgimpthumb/gimpthumb-error.h
	* libgimpwidgets/gimpcolorbutton.c
	* plug-ins/common/edge.c: removed trailing commas from enums.

	* plug-ins/common/snoise.c

	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 00:57:22 +00:00
Michael Natterer
4b582b481a Replaced the concept of having a boolean indicating if an undo step
2004-07-29  Michael Natterer  <mitch@gimp.org>

	Replaced the concept of having a boolean indicating if an undo
	step dirties the image by a bitfield indicating which parts
	of the image are dirtied:

	* app/core/core-enums.[ch]: reordered two values in enum
	GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.

	The values of GimpDirtyMask are still questionable and will
	probably change...

	* app/core/gimpimage.[ch]: removed signal "undo_start" and added
	a GimpDirtyMask parameter to the "dirty" and "clean" signals.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
	"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
	it to gimp_image_dirty().

	(gimp_image_undo_group_start): added *ugly* code which tries to
	figure GimpDirtyMask from the group's GimpUndoType and store it in
	the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
	gimp_image_undo_start(). This means the undo group now dirties the
	image just like one of its undo steps, but that's no problem since
	undoing cleans it in the same way.

	* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g

	(gimp_undo_pop): emit clean/dirty signals *before* performing the
	actual undo step so listeners can detach from the image before it
	is changed by undo.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
	GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().

	* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
	because it makes no sense to use GimpImageMap noninteractively.
	Don't freeze()/thaw() undo while the image_map is active which
	fixes many ways of trashing the image's undo state but probably
	introduces new ways of doing evil things.

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplayshell-handlers.c: changed according
	to the GimpImage::clean()/dirty() signal changes. Small fixes
	in the quit dialog's dirty image container.

	* app/tools/gimptoolcontrol.[ch]: added member and API to
	set/get the dirty_mask.

	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: whenever setting "preserve" to
	FALSE, also set a "dirty_mask" which specifies on which image
	changes the tool wants to be canceled.

	* app/tools/tool_manager.c: removed "undo_start" connection and
	connect to both "dirty" *and* "clean" to check if the active_tool
	needs to be canceled. Cancel the tool only if the dirty_mask
	passed in the signal has common bits with the tool's dirty_mask.

	Fixes bug #109561 and probably opens some new ones...
2004-07-29 14:16:21 +00:00
Michael Natterer
e36039f447 app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init) don't
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
	don't call gimp_tool_control_set_preserve (tool->control, FALSE)
	because these tools don't cashe any image state and don't care
	about the image changing under their feet.
2004-07-28 16:21:00 +00:00
Michael Natterer
ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Sven Neumann
bd427b2e4d libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def
2004-07-27  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbase.def
	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
	related functions (moved here from gimputil.c) and
	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
	app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimpbase-private.c
	* libgimp/gimptile.c
	* libgimp/gimpunitcache.c
	* plug-ins/help/domain.c
	* app/xcf/xcf-read.c: need to include glib-object.h.

	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

	* app/config/gimpconfig-types.[ch]: removed code that lives in
	libgimpbase now.

	* app/config/gimpconfig-deserialize.c: changed accordingly.

	* app/config/gimpbaseconfig.c
	* app/config/gimpdisplayconfig.c
	* app/core/gimpcontext.c
	* app/gui/grid-dialog.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
	any longer.
2004-07-27 16:39:00 +00:00
Michael Natterer
caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00
Michael Natterer
d50a2db779 renamed init_edit_selection() to gimp_edit_selection_tool_start(). Removed
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
	to gimp_edit_selection_tool_start(). Removed enum EditType.

	* app/tools/tools-enums.h: added enum GimpTranslateMode instead.

	* app/tools/gimpmovetool.c: changed accordingly.

	* app/tools/gimpselectiontool.[ch]: added protected utility
	function gimp_selection_tool_start_edit().

	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimprectselecttool.c: use the new function instead of
	duplicating the same code three times, don't include
	"gimpeditselectiontool.h".

	* app/tools/gimpiscissorstool.c: don't include
	"gimpeditselectiontool.h".
2004-07-26 14:50:51 +00:00
Michael Natterer
674f80e155 don't freeze()/thaw() the image's undo to prevent live-movement from
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
	image's undo to prevent live-movement from ending up on the undo
	stack. Instead, just stop pushing undo steps after the initial
	movement. Simplifies edit_select's undo code quite a bit and fixes
	bug #148458.
2004-07-26 13:15:22 +00:00
Michael Natterer
85c2b2dd4f removed enum GimpPaintCoreState.
2004-07-19  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.

	* app/paint/paint-enums.h: added enum GimpPaintState (with values
	that have a name space).

	* app/paint/gimppaintcore.[ch]
	* app/paint/gimpairbrush.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimpink.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore-stroke.c
	* app/paint/gimpsmudge.c
	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpinktool.c: removed unused #include.
2004-07-19 14:37:40 +00:00
Michael Natterer
fe9d9be66b Code review & cleanup:
2004-07-14  Michael Natterer  <mitch@gimp.org>

	Code review & cleanup:

	* app/config/gimpguiconfig.[ch]: removed transparency-size,
	transparency-type and snap-distance properties...

	* app/config/gimpdisplayconfig.[ch]: ...and added them here.

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
	"max_memsize" parameter instead of looking it up in GimpGuiConfig.

	* app/actions/image-commands.c: changed accordingly.

	* app/core/gimparea.c
	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
	GimpProjectionIdleRender, reordered functions, cleanup.

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.c: removed unused #includes.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-close.c: renamed
	shell->warning_dialog to shell->close_dialog, some random
	cleanups.

	* app/display/gimpdisplayshell-handlers.c
	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-14 10:31:59 +00:00
Michael Natterer
54cc251b08 app/core/Makefile.am app/core/core-types.h new interface which has
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppickable.[ch]: new interface which has
	get_image_type(), get_tiles() and get_color_at() methods.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimagemap.[ch]
	* app/core/gimpprojection.[ch]: implement GimpPickableInterface
	and removed public get_colot_at() functions.

	* app/core/gimpimage-pick-color.[ch]: removed typedef
	GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
	gimp_pickable_pick_color() instead.

	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-crop.c
	* app/gui/info-window.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpselectioneditor.c: use GimpPickable functions
	instead of the various get_color_at() functions. Simplifies code
	which has a "sample_merged" boolean. Various cleanups.
2004-07-13 23:04:05 +00:00
Michael Natterer
c5ec0d4f70 *** empty log message *** 2004-07-13 16:36:29 +00:00
Sven Neumann
11795e78f4 plugged a tiny memory leak.
2004-07-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
	a tiny memory leak.
2004-07-13 08:59:10 +00:00
Michael Natterer
a81e96450a removed member "guint time"...
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/text/gimptextundo.[ch]: removed member "guint time"...

	* app/core/gimpundo.[ch]: ...and added it here.

	* app/tools/gimptexttool.c (gimp_text_tool_apply): changed
	accordingly. Reordered undo compression code to look like other
	pieces of code which do undo compression.
2004-07-12 17:10:34 +00:00
Michael Natterer
da74f1269e app/core/gimpundo.[ch] app/core/gimpitemundo.[ch] removed all _new()
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpundo.[ch]
	* app/core/gimpitemundo.[ch]
	* app/text/gimptextundo.[ch]: removed all _new() functions and
	added properties and GObject::constructor() implementations
	instead.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
	"GType undo_gtype" parameter and allow to pass name-value pairs as
	"...". Une the new GParameter utility functions to construct the
	appropriate undo step with g_object_newv().

	(gimp_image_undo_push_item): removed.

	(gimp_image_undo_push_undo): removed. Merged its code back into
	gimp_image_undo_push(), where it originally came from.

	* app/core/gimpimage-undo-push.c
	* app/core/gimpundostack.c
	* app/paint/gimppaintcore-undo.c
	* app/tools/gimptransformtool-undo.c
	* app/widgets/gimpundoeditor.c: changed accordingly.
2004-07-12 16:59:36 +00:00
Hans Breuer
b56eb39ead updated app/actions/makefile.msc app/menus/makefile.msc : (new files)
2004-07-11  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated
	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
	  app/widgets/gimppropwidgets.c : bumped compiler version check,
	msvc6 still can't cast from unsigned __int64 to double

	* app/actions/debug-actions.c : only use debug_*_callback
	and thus debug_action if ENABLE_DEBUG_MENU

	* app/core/gimpalette-import.c : added gimpwin32-io.h

	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

	* plug-ins/common/screenshot.c : make it compile with msvc,
	but still no win32 specific implementation ...
2004-07-11 21:53:17 +00:00
Sven Neumann
9f25f8608b adapt the arrow key velocity to the display scale factor. Please test and
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_key_press): adapt the arrow key velocity
	to the display scale factor. Please test and complain if you
	dislike this behaviour.

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-color-pick-from-screen-16.png: new
	icon drawn by Jimmac.

	* libgimpwidgets/gimpstock.[ch]: register the new icon.

	* libgimpwidgets/gimppickbutton.c: use it for the screen color
	picker instead of reusing the color picker tool icon.
2004-07-06 22:58:33 +00:00
Sven Neumann
ef885f7691 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes bug
2004-07-06  Sven Neumann  <sven@gimp.org>

	Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
	bug #145401.

	* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
	it to the PDB.

	* app/base/gimphistogram.c: implemented histogram functions for
	the RGB mode.

	* app/base/levels.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimphistogrameditor.c: handle the new enum value.

	* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
	draw a histogram that shows the RGB channels simultaneously
2004-07-06 16:33:30 +00:00
Michael Natterer
5ce611e0d8 return TRUE if initialization was successful. Makes the tool->drawable
2004-07-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
	return TRUE if initialization was successful. Makes the
	tool->drawable pointer being set correctly by the calling code and
	fixes bugs where colorize was leaving the drawable in a modified
	but non-undoable state when cancelling or changing images.
2004-07-05 12:54:58 +00:00
Simon Budig
e7af53b0d3 app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c
2004-07-04  Simon Budig  <simon@gimp.org>

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/preferences-dialog.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdeviceinfo.c
	* app/widgets/gimpitemtreeview.c
	* plug-ins/imagemap/imap_selection.c
	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
	CVS compile with gcc 2.95 again. Mostly double semicolons and
	variable declarations after other stuff. Spotted by Martin
	Renold.

	* app/pdb/gradients_cmds.c: regenerated.

	(there is one issue left, see his patch at
	http://old.homeip.net/martin/gcc-2.95.diff, I did not
	copy the #define va_copy __va_copy, since I don't know
	what happens here.)
2004-07-04 21:27:09 +00:00
Michael Natterer
23f6a194ac added context->serialize_props mask which enables specifying exactly which
2004-07-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.[ch]: added context->serialize_props mask
	which enables specifying exactly which properties will be
	serialized. Also fixes a bug that prevented undefined properties
	from being serialized, breaking tool_options and device status
	serialization.

	* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
	properties in the tool_info->context_props mask serializable, also
	configure/initialize tool_info->tool_options.

	* app/tools/gimp-tools.c (gimp_tools_register): removed
	tool_options initialization that is now done in
	gimp_tool_info_new().

	* app/widgets/gimpdeviceinfo.c: make only the properties in
	GIMP_DEVICE_INFO_CONTEXT_MASK serializable.

	* app/widgets/gimpdevicestatus.c: add the device table to its
	parent container again. Fixes "missing" devices.

	* app/core/gimptooloptions.c
	* app/widgets/gimpdevices.c: cleanup / code review.
2004-07-03 20:27:28 +00:00
Michael Natterer
04ed4a8a0f if the color tool is enabled, skip cursor hiding entirely.
2004-07-03  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
	the color tool is enabled, skip cursor hiding entirely.
2004-07-03 13:07:30 +00:00
Philip Lafleur
1d625ed2f5 Replaced "Preview" checkbutton with a combobox with options "Outline",
2004-07-02  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformoptions.[ch]:
	* app/tools/gimptransformtool.c:
	* app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
	a combobox with options "Outline", "Grid", "Image", and
	"Image + Grid".
2004-07-02 21:56:30 +00:00
Philip Lafleur
bbed5b577b Chain up if the color tool is enabled. This fixes the problem of the color
2004-06-30  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
	Chain up if the color tool is enabled. This fixes the problem of
	the color picker cursor not appearing when using a paint tool
	in color picking mode while "Show Paint Tool Cursor" is off.
2004-07-01 00:12:29 +00:00
William Skaggs
8d4bdf5d60 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/*/*-enums.h: did HIG-compliant capitalization in the right
	place, instead of the auto-generated *-enums.c files.
2004-06-30 15:47:32 +00:00
Michael Natterer
4022980314 Fixed a 1.2 -> 2.0 regression that was forgotten:
2004-06-30  Michael Natterer  <mitch@gimp.org>

	Fixed a 1.2 -> 2.0 regression that was forgotten:

	* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
	which can be one of { NEW, UPDATE }.

	* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
	gimp_palette_editor_update_color() to
	gimp_palette_editor_pick_color() and restored the functionality of
	creating/updating colors via this API

	Changed button_press handler to only edit the color on double
	click if it's really a double click on the same color.
	Fixes bug #141381.

	* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
	"add-to-palette" and a GUI for it.

	* app/core/gimpmarshal.list
	* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
	parameter to the "color_picked" signal. Pass NEW on button_press
	and UPDATE on motion.

	* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
	* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
	* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
	changed accordingly

	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
	If "add-to-palette" is TRUE, get the palette editor and call
	gimp_palette_editor_pick_color().
2004-06-30 12:10:08 +00:00
Michael Natterer
d61cc35ec0 fix typo in last commit. 2004-06-28 23:42:21 +00:00
Michael Natterer
6cd5737257 added new function gimp_get_mod_string() which takes a GdkModifierType and
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_get_mod_string() which takes a GdkModifierType and returns
	correctly formated strings for all shift,control,alt combinations.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: use the new function instead
	of gimp_get_mod_name_shift(),control(),alt(),separator(). This
	kindof addresses the issue of configurable modifier keys but is
	actually indended to ease translation of format strings ("%s" is
	easier to get right than "%s%s%s").
2004-06-28 23:30:57 +00:00
Michael Natterer
a2850f6df2 Fixed bug #141930 while keeping bug #132322 fixed:
2004-06-28  Michael Natterer  <mitch@gimp.org>

	Fixed bug #141930 while keeping bug #132322 fixed:

	* app/base/curves.c (curves_lut_func)
	* app/base/levels.c (levels_lut_func): changed meaning of channel
	slots for GRAYA images: just as for GRAY images, expect the value
	channel in slot 0 and the alpha channel in slot 1, so it matches
	the meaning of slots of GimpHistogram (before this change, only
	GRAY images had their value in slot 0 and GRAYA images had it in
	slot 1, whereas the histogram had the value channel in slot 0,
	which was breaking auto levels for GRAYA images).

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
	and GRAYA images accordingly.

	* app/tools/gimpcurvestool.c (curves_update)
	* app/tools/gimplevelstool.c (levels_update): call
	gimp_color_bar_set_buffers() with the right buffers.

	* app/pdb/color_cmds.c: regenerated.
2004-06-28 14:24:56 +00:00
Sven Neumann
b9c23cac5d select the standard tool.
2004-06-28  Sven Neumann  <sven@gimp.org>

	* app/gui/gui.c (gui_initialize_after_callback): select the
	standard tool.

	* app/tools/tool_manager.c: cosmetics.
2004-06-28 13:18:00 +00:00
Michael Natterer
3ec1647d36 reverted fix for bug #141930. These hacks are there because the enum used
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimplevelstool.c: reverted fix for bug #141930. These
	hacks are there because the enum used in levels doesn't match
	the enum used by the combo box and the histogram widget.
2004-06-28 11:45:14 +00:00
Michael Natterer
c186126083 removed again (tools must not draw outside GimpDrawTool::draw()).
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
	removed again (tools must not draw outside GimpDrawTool::draw()).

	(gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
	because the draw function would not be called if the draw tool was
	inactive. Simplified check for whether or not to draw the src
	location.

	* app/tools/gimppainttool.c (gimp_paint_tool_button_release):
	pause/resume the draw tool across all button_release actions so
	tools (clone) have a chance to draw different things depending on
	gimp_tool_control_is_active(tool->control). Fixes bug #145022.
2004-06-28 11:36:00 +00:00
Simon Budig
96e8b93e2a fixed drawing code to properly update after deleting nodes via
2004-06-28  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: fixed drawing code to properly
	update after deleting nodes via BackSpace/Delete.
2004-06-27 23:00:46 +00:00
William Skaggs
d6428d61ab Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimplevelstool.c: removed two small chunks of code.
	Fixes bug #141930.  Possibly unfixes bug #132322.
2004-06-27 17:30:55 +00:00
William Skaggs
47ec8205cd Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpclonetool.c: added button_release callback
	to fix bug #145022.
2004-06-26 23:45:13 +00:00
Michael Natterer
02b91f6628 app/tools/gimptool.[ch] added boolean return value to
2004-06-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: added boolean return value to
	GimpTool::key_press() which indicates if the event was handled.

	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.[ch]
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: return TRUE if the key event was handled.

	* app/tools/gimppainttool.c: removed key_press() implementation.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
	which takes GdkEventKey and emits controller events for all
	combinations of modifiers and cursor keys.

	* app/widgets/gimpcontrollers.[ch]: added new function
	gimp_controllers_get_keyboard().

	* app/display/gimpdisplayshell-callbacks.c: if a key event was not
	handled by the active tool, dispatch it to the keyboard controller.

	* etc/controllerrc: add a keyboard controller which is configured
	to do the same as the removed gimp_paint_tool_key_press().
2004-06-24 10:16:08 +00:00
William Skaggs
b4197cf30e Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/*.c: HIGify capitalization for dialogs.  More
	progress on bug #123699.
2004-06-23 20:29:46 +00:00
Michael Natterer
7e52ed902a added signal "set-brush" which is G_SIGNAL_RUN_LAST so we can connect
2004-06-23  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
	G_SIGNAL_RUN_LAST so we can connect before and after the default
	implementation. Moved the brush setting and outline invalidation
	stuff to its default implementation. Also remember the outline's
	width and height. Call gimp_brush_core_set_brush() from
	gimp_brush_core_invalidate_cache() so "set-brush" is emitted
	whenever a generated brush becomes dirty.

	* app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
	pause/resume but rather stop/start the draw_tool. Fixes straight
	line preview aretefacts.

	(gimp_paint_tool_oper_update): set the brush_core's brush before
	starting the draw_tool.

	(gimp_paint_tool_draw): never free the brush_core's cached brush
	outline because the brush_core does that by itself now.

	(gimp_paint_tool_set_brush)
	(gimp_paint_tool_set_brush_after): new callbacks which pause and
	resume the draw_tool. Fixes brush outline artefacts when modifying
	the current brush e.g. by using the mouse wheel.
2004-06-23 12:19:28 +00:00
William Skaggs
546359f914 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpcurvestool.c: try again to revert.
2004-06-22 21:09:26 +00:00
Bill Skaggs
848307668e added Store/Recall buttons for one-click saving and loading of curves.
2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

	* app/tools/gimpcurvestool.c: added Store/Recall buttons for
	one-click saving and loading of curves.  Should create stock
	labels for them.  Hopefully resolves bug #75558.
2004-06-22 17:17:16 +00:00
Michael Natterer
afeaf96dd5 chain up unconditionally now that we draw the brush outline while
2004-06-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
	unconditionally now that we draw the brush outline while
	painting. Fixes brush outline artefacts on button_press and
	button_release. Spotted by sjburges.
2004-06-22 15:31:14 +00:00
William Skaggs
8a7e2703dc Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimptransformoptions.c: use radio buttons
	for constraint options.  Makes all options visible,
	should resolve bug #68106.
2004-06-22 02:21:13 +00:00
Sven Neumann
d97fb0a287 removed the label between the spinbuttons, it looks silly. Converted tabs
2004-06-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrambox.[ch]: removed the label between the
	spinbuttons, it looks silly. Converted tabs to spaces, removed
	trailing whitespace.

	* app/widgets/gimphistogrameditor.c
	* app/tools/gimpthresholdtool.c: changed accordingly.
2004-06-20 22:04:10 +00:00
William Skaggs
ca7aac79d1 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphistogrambox.[ch]:
	* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
	so that it uses a two-triangle-slider scale of the sort used in the
	levels tool.  Almost all of the changes are actually in the
	histogram-box widget code, which is only used by the threshold
	tool.  Fixes bug #137521.
2004-06-20 20:51:23 +00:00
Bill Skaggs
8ec615926e fixed my fix for bug # 68106, which worked incorrectly for two of the
2004-06-19 Bill Skaggs  <weskaggs@primate.ucdavis.edu>

	* app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
	worked incorrectly for two of the control points.
2004-06-19 18:40:51 +00:00
William Skaggs
5180d547d0 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpscaletool.c: changed algorithm for scaling when
	aspect ratio is constrained, to fix strange behavior described
	in bug # 68106.
2004-06-18 23:07:23 +00:00
Philip Lafleur
31fd87873b reverted my fix to bug #144570.
2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c: reverted my fix to bug #144570.
2004-06-18 10:47:07 +00:00
Philip Lafleur
f6c502b40b Fix fuzzy select menu label.
2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.
2004-06-18 09:48:44 +00:00
Philip Lafleur
860d29d09c If transforming a path, use the path bounds rather than the mask bounds.
2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
	If transforming a path, use the path bounds rather than the mask
	bounds. Fixes bug #144570.
2004-06-18 05:47:44 +00:00
Philip Lafleur
d1e706484c Force aspect ratio to match selection when 'From Selection' is clicked.
2004-06-15  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimpcroptool.c (crop_selection_callback): Force
	aspect ratio to match selection when 'From Selection' is clicked.
	Fixes bug #144361. Also converted tabs to spaces.
2004-06-15 15:30:36 +00:00
Michael Natterer
587e070ff4 removed PRETRACE_PAINT and POSTTRACE_PAINT from the GimpPaintCoreState
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
	POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
	"gboolean traces_on_window" from GimpPaintCoreClass.

	* app/paint/gimpclone.[ch]
	* app/paint/gimpink.c
	* app/tools/gimpclonetool.c: changed accordingly.

	* app/tools/gimppainttool.c: ditto. Show the brush outline
	while painting. Fixes bug #118348.
2004-06-14 15:26:29 +00:00
Michael Natterer
4b9a4db275 use gimp_draw_tool_is_active() instead of
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
	instead of GIMP_IS_DISPLAY(draw_tool->gdisp).
2004-06-14 15:13:37 +00:00
Philip Lafleur
905b0e031e Disable preview in corrective mode, and notify preview when switching
2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c: Disable preview in corrective
	mode, and notify preview when switching transform type and
	direction.
2004-06-14 13:21:29 +00:00
Michael Natterer
3e2690832c added new virtual function GimpPaintCore::post_paint() and call it after
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: added new virtual function
	GimpPaintCore::post_paint() and call it after calling
	GimpPaintCore::paint().

	* app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
	to brush_core->main_brush and reset brush_core->brush
	to brush_core->main_brush in GimpPaintCore::post_paint().

	* app/paint/gimpbrushcore.c
	* app/paint/gimppaintcore-stroke.c
	* app/tools/gimppainttool.c: removed all code which restores
	the brush_core's old brush after painting since post_paint()
	does this automatically now.

	* app/paint/gimpclone.[ch]: moved static variables to the
	GimpClone struct.
2004-06-14 12:52:33 +00:00
Philip Lafleur
4ad2d7177f Preview is now only used for layer transformations.
2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c: Preview is now only used for
	layer transformations.
2004-06-14 11:45:45 +00:00
Michael Natterer
4c68bd878a app/tools/gimpperspectivetool.c app/tools/gimprotatetool.c
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: removed calls to
	gimp_transform_tool_expose_preview() from all
	GimpTransformTool::motion() implementations...

	* app/tools/gimptransformtool.c: ...and call it after calling
	tr_tool_class->preview().
2004-06-14 10:48:00 +00:00
Michael Natterer
1082ee6b94 remember the last used GimpCursorFormat so changing the format in prefs
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.[ch]: remember the last used
	GimpCursorFormat so changing the format in prefs applies
	instantly, and not after the next tool change.

	* app/display/gimpdisplayshell-cursor.[ch]
	* app/tools/gimptool.[ch]
	* app/tools/gimptoolcontrol.[ch]
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolortool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g
2004-06-14 10:19:39 +00:00
Philip Lafleur
71b4d89167 Preview wasn't being turned off before performing a transformation. Also
2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
	wasn't being turned off before performing a transformation. Also
	converted tabs to spaces.
2004-06-14 09:06:28 +00:00
Simon Budig
a3936388bc Minor tweaks to two macros. Shouldn't change anything.
2004-06-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
	Shouldn't change anything.
2004-06-13 12:48:40 +00:00
Michael Natterer
2498adc5f6 added enum GimpCursorFormat which can be one of { BITMAP, PIXBUF,
2004-06-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
	which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
	work around broken X servers.

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.

	* app/gui/preferences-dialog.c: added a GUI for the new option.

	* app/widgets/gimpcursor.[ch]: added cursor_format parameter
	to gimp_cursor_new() and _set().

	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimpcurvestool.c
	* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
2004-06-13 02:08:54 +00:00
Philip Lafleur
afb3f5c16c Fixed incorrect logic that caused perfect-but-slow pointer tracking to be
2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
	caused perfect-but-slow pointer tracking to be used in tools that
	don't request exact mode.

	* app/display/Makefile.am:
	* app/display/gimpdisplayshell-appearance.[ch]:
	* app/display/gimpdisplayshell-callbacks.c:
	* app/display/gimpdisplayshell.[ch]:
	* app/display/gimpdisplayshell-preview.[ch]: added
	* app/tools/gimpperspectivetool.c:
	* app/tools/gimprotatetool.c:
	* app/tools/gimpscaletool.c:
	* app/tools/gimpsheartool.c:
	* app/tools/gimptransformoptions.[ch]:
	* app/tools/gimptransformtool.[ch]: Implemented live transformation
	previews, available through tool options. Fixes bug #108172.
2004-06-13 01:37:29 +00:00
Simon Budig
d76b2183aa Make Enter/Return apply the transformation, Backspace/Delete resets the
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/gimptransformtool.c: Make Enter/Return apply the
	transformation, Backspace/Delete resets the transformation.

	* app/tools/gimpcroptool.c: Simplify the key_press callback.
2004-06-12 20:10:40 +00:00
Simon Budig
3fe1753e1a Make the Enter/Return key do the crop action.
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Make the Enter/Return key do
	the crop action.

	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpvectortool.c: Make the _key_press functions
	safe for non-arrow keys.
2004-06-12 19:29:50 +00:00
Simon Budig
3c1b7fe68f renamed the "arrow_key" member to "key_press", since it is now no longer
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/gimptool.[ch]: renamed the "arrow_key" member
	to "key_press", since it is now no longer about just the arrow
	keys.

	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpeditselectiontool.h
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c
	* app/tools/tool_manager.c: Changed accordingly.
2004-06-12 18:41:52 +00:00
Simon Budig
39614b34a6 renamed tool_manager_arrow_key_active to tool_manager_key_press_active.
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/tool_manager.[ch]: renamed
	tool_manager_arrow_key_active to tool_manager_key_press_active.

	* app/display/gimpdisplayshell-callbacks.c: Also dispatch
	GDK_Return/KP_Enter/BackSpace/Delete to the tools "arrow_key"
	member of GimpTool probably should be renamed.

	* app/tools/gimpvectortool.c: Use Enter/Return to convert the
	current path to a selection, use Backspace/Delete to delete the
	currently active anchors in a path.

	Implemented on Jimmacs request - thanks for being a great host  :)
2004-06-12 18:03:48 +00:00
Philip Lafleur
234cb4c61c renamed all "pressure-pressure" variables to "pressure-hardness".
2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
	variables to "pressure-hardness".

	* app/paint/gimpairbrush.c:
	* app/tools/gimppaintoptions-gui.c: changed accordingly.
2004-06-12 12:44:24 +00:00
Sven Neumann
beae166d54 no need request GIMP_MOTION_MODE_EXACT here since the parent class does
2004-06-09  Sven Neumann  <sven@gimp.org>

	* app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need
	request GIMP_MOTION_MODE_EXACT here since the parent class does
	that already.

	* app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
	color picker feature for the ink tool.
2004-06-09 12:14:55 +00:00
Michael Natterer
714d63fcda cursors/Makefile.am cursors/cursor-none.png new empty cursor images.
2004-06-05  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/cursor-none.png
	* cursors/xbm/cursor-none.xbm: new empty cursor images.

	* app/config/gimpdisplayconfig.[ch]
	* app/config/gimprc-blurbs.h
	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c
	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimppainttool.[ch]
	* app/tools/gimpinktool.c
	* app/gui/preferences-dialog.c: applied patches from Philip
	Lafleur which implement hiding the cursor completely for paint
	tools. Changed the name of the config option from
	"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
	to TRUE because this needs the brush outline being visible while
	painting to be really usable. Fixes bug #132163.

	* app/widgets/widgets-enums.h: renamed all GimpCursorType and
	GimpToolCursorType enum values to GIMP_CURSOR_* and
	GIMP_TOOL_CURSOR_*.

	* app/widgets/gimpcursor.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimp*tool.c; changed accordingly.
2004-06-04 23:08:29 +00:00
Sven Neumann
de1ed0a379 allow to move a text layer using the cursor keys.
2004-06-04  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
	move a text layer using the cursor keys.
2004-06-04 17:51:32 +00:00
Sven Neumann
62b59db976 app/display/gimpdisplayshell-scale.c app/gui/info-window.c
2004-06-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
	consistency and better HIG compliance.
2004-06-02 17:56:02 +00:00
Sven Neumann
c509204b7d tools/pdbgen/pdb/image.pdb app/pdb/image_cmds.c reverted changes I did to
2004-06-01  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/image.pdb
	* app/pdb/image_cmds.c
	* app/core/gimpimage.[ch]: reverted changes I did to the image
	unit earlier. As in 2.0, it will continue to not accept pixels.
	This makes the PDB API and the XCF format compatible again and
	fixes bug #142961 (and to some extent bug #137704).

	* app/core/Makefile.am
	* app/core/gimpimage-unit.[ch]: removed these files. The
	convenience accessors defined here aren't commonly used any
	longer.

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell.[ch]: added a unit parameter to
	gimp_display_new(). Made "unit" and "scale" properties of
	GimpDisplayShell.

	* app/actions/image-commands.c
	* app/actions/images-commands.c
	* app/actions/layers-commands.c
	* app/actions/select-commands.c
	* app/actions/view-commands.c
	* app/core/gimp-edit.c
	* app/core/gimp.[ch]
	* app/core/gimptemplate.c
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpstatusbar.c
	* app/file/file-open.c
	* app/gui/gui-vtable.c
	* app/gui/info-window.c
	* app/gui/offset-dialog.c
	* app/gui/resize-dialog.[ch]
	* app/pdb/display_cmds.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimptoolbox-dnd.c
	* tools/pdbgen/pdb/display.pdb: changed accordingly. Use the
	display unit where the image unit was used before.
2004-06-01 22:04:20 +00:00
Sven Neumann
4c03f0156c app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainerentry.[ch]: added new widget
	GimpContainerEntry, a GtkEntry with completion that implements the
	GimpContainerView interface.

	* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
	GimpContainerEntry to select the font.
2004-05-31 17:53:25 +00:00
Sven Neumann
e0ebd94ee9 app/paint/gimpconvolve.c app/paint-funcs/paint-funcs.[ch] reverted last
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/paint/gimpconvolve.c
	* app/paint-funcs/paint-funcs.[ch]
	* app/tools/gimpiscissorstool.c: reverted last change and applied
	new patch instead (bug #72878).
2004-05-31 10:36:06 +00:00
Sven Neumann
727ed840ab app/paint/gimpconvolve.c app/paint-funcs/paint-funcs.[ch] applied a patch
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/paint/gimpconvolve.c
	* app/paint-funcs/paint-funcs.[ch]
	* app/tools/gimpiscissorstool.c: applied a patch from Philip
	Lafleur that fixes RGBA resampling in Convolve tool (bug #72878).
2004-05-31 07:45:50 +00:00
Michael Natterer
afb57d59bf app/paint/gimpbrushcore.c app/paint/gimpdodgeburn.c
2004-05-28  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpbrushcore.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimppaintcore.[ch]
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpinktool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c: code review / cleanup.
2004-05-28 09:34:13 +00:00
Michael Natterer
23cfde41ba removed enum GimpPaintCoreFlags and member GimpPaintCore::flags. Added
2004-05-27  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags
	and member GimpPaintCore::flags. Added "gboolean traces_on_window"
	to GimpPaintCoreClass (defaults to FALSE).

	* app/paint/gimpclone.c: set traces_on_window = TRUE.

	* app/paint/gimpbrushcore.[ch]: added
	"gboolean handles_changing_brush" to GimpBrushCoreClass (defaults
	to FALSE).

	* app/paint/gimpclone.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.c: set handles_changing_brush = TRUE.

	* app/tools/gimppainttool.c: changed accordingly.
2004-05-27 20:48:49 +00:00
Michael Natterer
b9d74b9aa4 added "guint32 time" parameters to GimpPaintCore::paint() and
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: added "guint32 time" parameters
	to GimpPaintCore::paint() and ::interpolate().

	* app/paint/gimpairbrush.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimpsmudge.c: changed accordingly.

	* app/paint/gimpink.c: ditto and use the passed time instead of
	hardcoded dummy values.

	* app/paint/gimppaintcore-stroke.c: pass '0' as time.

	* app/tools/gimppainttool.c: pass the GdkEvent time.
2004-05-26 16:13:53 +00:00
Michael Natterer
5e07ceb851 app/paint/Makefile.am app/paint/gimpink-blob.[ch] app/paint/gimpink.[ch]
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/Makefile.am
	* app/paint/gimpink-blob.[ch]
	* app/paint/gimpink.[ch]
	* app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool
	to be a direct GimpPaintCore subclass without any GUI.

	* app/paint/gimp-paint.c: register GimpInk with the list of paint
	cores.

	* app/tools/Makefile.am
	* app/tools/gimpinkoptions.[ch]
	* app/tools/gimpinktool-blob.[ch]: removed these files.

	* app/tools/gimpinkoptions-gui.[ch]: new files containing only
	the GUI for GimpInkOptions.

	* app/tools/gimpinktool.[ch]: reduced to some few lines which
	implement a simple GimpPaintTool subclass.

	* app/tools/gimp-tools.c: associate the GimpInk paint_core with
	the GimpInkTool.
2004-05-26 15:34:45 +00:00
Sven Neumann
c0783a91dc app/display/gimpdisplayshell-layer-select.c app/display/gimpprogress.c
2004-05-26  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpprogress.c
	* app/gui/brush-select.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/gui/font-select.c
	* app/gui/gradient-select.c
	* app/gui/info-dialog.c
	* app/gui/offset-dialog.c
	* app/gui/palette-select.c
	* app/gui/pattern-select.c
	* app/gui/stroke-dialog.c
	* app/gui/tips-dialog.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpcolordisplayeditor.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpviewabledialog.c: adjusted dialog spacings.
2004-05-26 13:39:23 +00:00
Michael Natterer
552fc7a519 don't do special stuff if a virtual function doesn't exist. Instead, added
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.c: don't do special stuff if a virtual
	function doesn't exist. Instead, added default implementations
	which do the special stuff and call the virtual functions
	unconditionally.

	* app/tools/gimppainttool.c: some stylistic cleanup.
2004-05-26 12:55:10 +00:00
Michael Natterer
080b503fd0 check if the GimpPaintCore really is a GimpBrushCore before catsting and
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_button_press): check
	if the GimpPaintCore really is a GimpBrushCore before catsting and
	fiddling with internaly.
2004-05-26 08:45:59 +00:00
Michael Natterer
9a41a73de8 app/paint/Makefile.am app/paint/gimpbrushcore-kernels.h new GimpPaintCore
2004-05-25  Michael Natterer  <mitch@gimp.org>

	* app/paint/Makefile.am
	* app/paint/gimpbrushcore-kernels.h
	* app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass
	containing all the brush painting specific stuff.

	* app/paint/gimppaintcore-kernels.h: removed this file.

	* app/paint/gimppaintcore.[ch]: removed all brush stuff.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintbrush.[ch]
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.[ch]: changed accordingly. Derive all
	classes which used to derive directly from GimpPaintCore from
	GimpBrushCore now. Lots of cleanup.

	* app/paint/paint-types.h
	* app/paint/gimp-paint.c
	* app/paint/gimppaintcore-stroke.c
	* app/tools/gimppainttool.c
	* tools/kernelgen.c: changed accordingly.
2004-05-25 20:41:09 +00:00
Michael Natterer
1c62ddef4d Long overdue core container cleanup:
2004-05-24  Michael Natterer  <mitch@gimp.org>

	Long overdue core container cleanup:

	* app/core/gimplist.[ch]: added "unique-names" and "sort-func"
	properties and merged the resp. code from GimpDataList into
	GimpList. Removed "policy" parameters from gimp_list_new() and
	added "unique_names". Added new constructor gimp_list_new_weak().
	Made public function gimp_list_uniquefy_name() private.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpdatalist.[ch]: removed. Its functionality is
	entirely in GimpList now.

	* app/core/gimpdata.[ch]: added gimp_data_name_compare() which
	used to live in GimpDataList.

	* app/core/gimp.c
	* app/core/gimpdatafactory.c
	* app/core/gimpimage.c
	* app/core/gimptoolinfo.c
	* app/core/gimpundostack.c
	* app/paint/gimp-paint.c
	* app/tools/gimp-tools.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimpundoeditor.c: changed list creation accordingly.

	Made gimp->templates, gimp->named_buffers, tool_info->presets and
	the image's lists of layers, channels and vectors automatically
	ensure unique names.

	* app/widgets/gimptemplateview.c
	* app/actions/file-commands.c
	* app/actions/templates-commands.c
	* app/actions/tool-options-commands.c: removed calls to
	gimp_list_uniquefy_name().

	* app/core/gimpitem.c: removed major insanity where the items
	themselves where ensuring their unique names. Bah!

	* app/core/gimplayer.c (gimp_layer_name_changed): chain up
	conditionally.

	* app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed
	because there is no need any more to keep the parent
	implementation from being invoked.
2004-05-24 10:49:34 +00:00
Henrik Brix Andersen
58e6a476ab added plug-ins/MapObject/mapobject_apply.c and plug-ins/maze/maze.h. Fixes
2004-05-23 Henrik Brix Andersen <brix@gimp.org>

* po-plugins/POTFILES.in: added plug-ins/MapObject/mapobject_apply.c
and plug-ins/maze/maze.h. Fixes part of bug #142996

* app/config/gimprc-blurbs.h
* plug-ins/gfig/gfig-spiral.c (spiral_button_press)
* plug-ins/gimpressionist/orientation.c (create_orientationpage)
* plug-ins/common/diffraction.c (diffraction_dialog)
* plug-ins/common/bumpmap.c (bumpmap_dialog)
* plug-ins/maze/maze.h
* plug-ins/MapObject/mapobject_apply.c (compute_image)
* app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update)
* plug-ins/print/gimp_main_window.c (create_scaling_frame): marked
strings for translation, corrected small typos. Fixes part of bug
#142996
2004-05-23 12:43:13 +00:00
Michael Natterer
6f1f65d514 made the "visible" property serializable.
2004-05-18  Michael Natterer  <mitch@gimp.org>

	* app/core/gimptoolinfo.c: made the "visible" property serializable.

	* app/tools/gimp-tools.c: store the tools' order and visibility
	in a new config file called "toolrc".
2004-05-18 12:23:56 +00:00
Sven Neumann
2dcc7ccdfd fixed position of vertical line indicating the picked color. Patch from
2004-05-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c: fixed position of vertical line
	indicating the picked color. Patch from William Skaggs and
	Søren Wedel Nielsen; fixes bug #142506.
2004-05-15 13:11:07 +00:00
Sven Neumann
6750667d87 libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal) left-align
2004-05-12  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
	* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
	left-align the label.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/qmask-commands.c
	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell-scale.c
	* app/gui/brush-select.c
	* app/gui/file-new-dialog.c
	* app/gui/info-dialog.c
	* app/gui/info-window.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-import-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptextoptions.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
	by the HIG.
2004-05-12 11:37:21 +00:00
Michael Natterer
de7a940501 app/config/gimpconfig-deserialize.c app/config/gimpscanner.c
2004-05-12  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-edit.c
	* app/core/gimpchannel-combine.c
	* app/core/gimpcontainer.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-combine.c
	* app/core/gimpdrawable.c
	* app/core/gimpgradient.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage.c
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpprogress.c
	* app/gui/info-dialog.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/plug-in/plug-in.c
	* app/tools/gimpdrawtool.c
	* app/tools/tool_manager.c
	* app/widgets/gimpactiongroup.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemfactory.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpwidgets-utils.c
	* app/xcf/xcf-save.c
	* libgimp/gimpexport.c
	* libgimpwidgets/gimphelpui.c
	* libgimpwidgets/gimppixmap.c
	* libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION,
	G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in
	g_warning()s by G_STRFUNC.
2004-05-12 08:13:33 +00:00
Sven Neumann
486ccb33d7 app/tools/gimpmagnifyoptions.[ch] applied a patch from William Skaggs that
2004-05-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmagnifyoptions.[ch]
	* app/tools/gimpmagnifytool.c: applied a patch from William Skaggs
	that changes a misleading option label. Fixes bug #137508.
2004-05-10 17:02:20 +00:00
Michael Natterer
da0de0873f Started making the toolbox configurable. Addresses bug #105764. Not
2004-05-10  Michael Natterer  <mitch@gimp.org>

	Started making the toolbox configurable.
	Addresses bug #105764. Not finished yet.

	* app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible"
	and made it a GObject property.

	* app/tools/gimp-tools.[ch]: added new function
	gimp_tools_get_default_order() which returns a GList of tool
	identifiers.

	* app/actions/tools-actions.c
	* app/actions/tools-commands.[ch]: added actions & callbacks for
	toggling the "visible" boolean and for resetting all tools.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimptoolview.[ch]: new widget which allows to
	toggle a tool's visibility and to reorder the tools.

	* app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash"
	and pack all tool buttons into the same wrap box. Connect to
	"reoder" of the tool container and to "notify::visible" of all
	tool infos and update the toolbox accordingly.

	* app/gui/dialogs-constructors.c: create a GimpToolView for the
	tools list/grid.

	* app/menus/menus.c: register a <Tools> menu for the dialog above.

	* menus/Makefile.am
	* menus/tools-menu.xml: added the menu.
2004-05-10 00:41:57 +00:00
Michael Natterer
6bed69024f removed action "select-by-color".
2004-05-05  Michael Natterer  <mitch@gimp.org>

	* app/actions/select-actions.c: removed action "select-by-color".

	* app/tools/gimpbycolorselecttool.c: add the shortcut here.

	* app/actions/tools-actions.c: added alternative tool actions for
	"by-color-select" and "rotate" which are identical to the ones
	generated from the GimpToolInfo except for their label. Make sure
	they have the same accelerators as the generated ones.

	* menus/image-menu.xml.in: use the alternative actions for
	"<Image>/Select/By Color" and
	"<Layer>/Transform/Arbitrary Rotation...".
2004-05-05 01:17:23 +00:00
Sven Neumann
58bcea08cc added construct properties to make it possible to derive from
2004-05-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: added construct properties to
	make it possible to derive from GimpViewableDialog.

	* app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real
	object, not just a convenience constructor.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: set a smaller border_width of 6 pixels for
	the action area of tool dialogs.

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpimagemaptool.c: set a smaller border_width of 6
	pixels on tool dialogs to make them more compact.
2004-05-05 00:01:19 +00:00
Sven Neumann
97dd0a8e65 app/gui/info-dialog.c app/tools/gimpcolorbalancetool.c
2004-05-05  Sven Neumann  <sven@gimp.org>

	* app/gui/info-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings.

	* app/widgets/gimptexteditor.c: tweaked.
2004-05-04 22:33:52 +00:00
Sven Neumann
6fd0eeac65 app/tools/gimpblendoptions.c app/tools/gimpbucketfilloptions.c
2004-05-04  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpinkoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptooloptions-gui.c
	* app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame
	was used. Put "Pressure Sensitivity" frame into a GtkExpander.
2004-05-04 21:11:06 +00:00
Michael Natterer
29e4cf347b Fix bug #141719:
2004-05-04  Michael Natterer  <mitch@gimp.org>

	Fix bug #141719:

	* app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT()
	instead of ROUND() to round double coords to guide positions.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): pass RINT()-rounded
	coords to gimp_display_shell_update_cursor() instead of implicitly
	truncating by casting to int.
2004-05-04 13:09:39 +00:00
Michael Natterer
c7a7196b56 Treat FG/BG just like all other context properties:
2004-05-04  Michael Natterer  <mitch@gimp.org>

	Treat FG/BG just like all other context properties:

	* app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK
	and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify
	that they are used by GimpPaintOptions (automatically affects all
	paint tools).

	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK
	manually here.

	* app/tools/tool_manager.c (tool_manager_tool_changed): decide
	about the globality of FG and BG at the same place where we decide
	about the brush's, pattern's etc. globality, but hardcode them to
	global = TRUE instead of looking at GimpConfig.

	Fixes bug #141786.
2004-05-04 11:26:22 +00:00
Pedro Gimeno
c8d982c1bf Cleanups. (gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
2004-04-30  Pedro Gimeno  <pggimeno@wanadoo.es>

	* app/tools/gimprectselecttool.c: Cleanups.
	(gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
	bug #138103, which led to bug #140649.

	* app/pdb/procedural_db.c (procedural_db_init_procs): Add missing
	compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset.
2004-04-30 19:14:37 +00:00
Michael Natterer
2a84015e39 stripped the menu paths from the "menu_path". Will be renamed to
2004-04-29  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu
	paths from the "menu_path". Will be renamed to "action_name" or
	something soon...

	* plug-ins/dbbrowser/dbbrowser.c
	* plug-ins/common/plugindetails.c
	* plug-ins/common/uniteditor.c: register under the new
	"Extensions" placeholder.
2004-04-29 13:19:28 +00:00
Michael Natterer
4654280114 Switch from GtkItemFactory to GtkUIManager. The migration is almost
2004-04-29  Michael Natterer  <mitch@gimp.org>

	Switch from GtkItemFactory to GtkUIManager. The migration is
	almost complete, still stuff missing/incomplete, definitely added
	a bunch of new bugs...

	* app/actions/*-commands.[ch]: converted all callback from
	GtkItemFactory callbacks to GtkAction callbacks.

	* app/actions/debug-actions.c
	* app/actions/gradient-editor-actions.c
	* app/actions/help-actions.c
	* app/actions/plug-in-actions.c
	* app/actions/qmask-actions.c
	* app/actions/tool-options-actions.c: various fixes.

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell-appearance.[ch]
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.[ch]: move everything from
	GtkItemFactory to GtkUIManager.

	* app/gui/dialogs.[ch]: added new function dialogs_get_toolbox().
	Needed because the action callbacks don't have a widget parameter
	and sometimes we need a parent window for showing dialogs.

	* app/gui/Makefile.am
	* app/gui/brushes-menu.[ch]
	* app/gui/buffers-menu.[ch]
	* app/gui/channels-menu.[ch]
	* app/gui/colormap-editor-menu.[ch]
	* app/gui/dialogs-menu.[ch]
	* app/gui/documents-menu.[ch]
	* app/gui/error-console-menu.[ch]
	* app/gui/fonts-menu.[ch]
	* app/gui/gradient-editor-menu.[ch]
	* app/gui/gradients-menu.[ch]
	* app/gui/images-menu.[ch]
	* app/gui/layers-menu.[ch]
	* app/gui/palette-editor-menu.[ch]
	* app/gui/palettes-menu.[ch]
	* app/gui/patterns-menu.[ch]
	* app/gui/qmask-menu.[ch]
	* app/gui/templates-menu.[ch]
	* app/gui/vectors-menu.[ch]: removed these files.

	* app/gui/gui.c: create a global UI manager for the image popup
	menu and the toolbox menubar.

	* app/gui/menus.[ch]: removed all GtkItemFactory code.

	* app/gui/image-menu.[ch]
	* app/gui/toolbox-menu.[ch]: removed everything except the trivial
	setup_funcs.

	* app/gui/file-open-menu.c
	* app/gui/file-save-menu.c
	* app/gui/tool-options-menu.c: don't use the macros from menus.h
	any more, they are gone.

	* app/gui/gui-vtable.c
	* app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in
	menu entries.

	* app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/
	gimp_ui_manager_update/g

	* app/widgets/gimpuimanager.[ch]: added API to get an action
	group by name.

	* app/widgets/gimpmenufactory.c: don't choke on the item_factory
	entries being NULL.

	* app/widgets/gimpactiongroup.c: make sure booleans set using
	g_object_set() only have TRUE or FALSE values.

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpdockable.[ch]
	* app/widgets/gimpdocked.[ch]
	* app/widgets/gimpeditor.[ch]
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory
	code and enable the #if 0'ed UI manager stuff.

	* menus/gradient-editor-menu.xml: fixed typos.

	* menus/image-menu.xml: duplicate everything so we have both
	an image menubar and an image popup menu. Badly cries for an
	XSL processor.

	* menus/toolbox-menu.xml: added an "Extensions" placeholder.
2004-04-29 12:52:29 +00:00
Michael Natterer
62dcfaecbf app/actions/qmask-actions.c prepared qmask_actions_update() and the qmask
2004-04-21  Michael Natterer  <mitch@gimp.org>

	* app/actions/qmask-actions.c
	* app/actions/qmask-commands.c: prepared qmask_actions_update()
	and the qmask callbacks to be merged into the image ui manager.

	* app/actions/dialogs-actions.c
	* app/actions/edit-actions.c
	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/layers-actions.c
	* app/actions/plug-in-actions.c
	* app/actions/tools-actions.c
	* app/actions/view-actions.c: fixed lots of typos and buglets
	spotted in my first test run.

	* app/gui/menus.c: register the needed action groups with the
	<Image> menu.

	* app/tools/gimp-tools.c
	* app/tools/gimpdodgeburntool.[ch]
	* app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g.

	* app/widgets/gimpactionfactory.c
	* app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g,
	updated copyright header.

	* menus/image-menu.xml: fixed typos and added the "Filters"
	submenus.
2004-04-21 10:55:45 +00:00
Sven Neumann
5766718d6f libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgets.h
2004-04-20  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived
	from GtkListStore, to be used by GimpIntComboBox and also by the
	image and drawable menus.

	* libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore.

	* app/widgets/gimpenumstore.[ch]: derive from GimpIntStore,
	removed API that is provided by the parent class.

	* app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox,
	removed API that is provided by the parent class.

	* app/gui/resize-dialog.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpstrokeeditor.c: changed accordingly.
2004-04-20 19:06:37 +00:00
Sven Neumann
e2709b97ba avoid unnecessary casts.
2004-04-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpenumstore.[ch]: avoid unnecessary casts.

	* app/widgets/gimpenumcombobox.[ch]: added an API that inserts a
	GtkTreeModelFilter to make items invisible. This is a kludge to
	workaround bug #135875.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimphistogrameditor.c: use the new function to hide
	histogram channels that are not available with the current
	drawable.
2004-04-18 22:38:45 +00:00
Sven Neumann
89cf45541a app/widgets/Makefile.am app/widgets/widgets-types.h removed GimpEnumMenu.
2004-04-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu.

	* app/widgets/gimpenumwidgets.[ch]: moved widget constructors that
	don't use GimpEnumMenu from gimpenummenu.[ch] to these new files.

	* app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget
	using GimpEnumStore; replaces GimpEnumMenu.

	* app/widgets/gimpenumstore.[ch]: added new function
	gimp_enum_store_lookup_by_value().

	* app/widgets/gimppropwidgets.[ch]: replaced
	gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new().

	* app/gui/brush-select.[ch]
	* app/gui/convert-dialog.c
	* app/gui/layers-commands.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
2004-04-18 15:12:42 +00:00
Henrik Brix Andersen
30fb5a7565 resolved conflicting mnemonic. Fixes bug #139868.
2004-04-17 Henrik Brix Andersen <brix@gimp.org>

* app/tools/gimphuesaturationtool.c
(gimp_hue_saturation_tool_dialog): resolved conflicting
mnemonic. Fixes bug #139868.
2004-04-17 02:06:59 +00:00
Sven Neumann
ed4e23096b app/tools/gimpcolorpickertool.c don't use gtk_window_present() to raise
2004-04-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpmeasuretool.c: don't use gtk_window_present() to
	raise the tool dialog since it also moves the focus away from the
	image window. Fixes the problem described in bug #139349.
2004-04-16 13:50:28 +00:00
Sven Neumann
77ae74798d some code cleanup that I forgot to do when applying the patch.
2004-04-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: some code cleanup that I forgot to do
	when applying the patch.
2004-04-16 13:36:14 +00:00
Michael Natterer
2f2301c905 derive it from GtkFileChooser instead of GtkFileSelection.
2004-04-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
	instead of GtkFileSelection.

	* app/gui/file-dialog-utils.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimpthumbbox.c: changed accordingly.

	* app/gui/gradients-commands.c
	* app/gui/vectors-commands.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimptexteditor.c
	* libgimpwidgets/gimpfileentry.c: use file choosers instead of
	file selectors.
2004-04-15 16:28:26 +00:00
Sven Neumann
7849638db3 app/tools/gimpcropoptions.[ch] applied a patch from Jordi Gay that allows
2004-04-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that
	allows to keep the aspect ratio fixed.
2004-04-15 15:17:36 +00:00
Michael Natterer
a30db14bb7 set translate_desc to "Move Layer Mask".
2004-04-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayermask.c (gimp_layer_mask_class_init): set
	translate_desc to "Move Layer Mask".

	* app/tools/gimpeditselectiontool.c: take the undo desc
	from the moved item's class instead of duplicating all
	strings here.
2004-04-15 15:07:30 +00:00
Michael Natterer
18d9161eea Get rid of the "current_context" which was in fact just a bunch of global
2004-04-15  Michael Natterer  <mitch@gimp.org>

	Get rid of the "current_context" which was in fact just a bunch of
	global variables. Instead, pass the needed context all the way
	from the GUI and the PDB to the core. This is a prerequisite for
	macro recording and generally helps separating the various
	subsystems from each other. Work in progress...

	* app/core/gimp.[ch]: removed member "current_context" and
	gimp_[get|set]_current_context().

	* app/core/gimp-edit.[ch]
	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-bucket-fill.[ch]
	* app/core/gimpdrawable-offset.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-crop.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-merge.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage.[ch]
	* app/core/gimpimagefile.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimplayer.[ch]
	* app/core/gimpselection.[ch]
	* app/core/gimptemplate.[ch]
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/pdb/procedural_db.[ch]
	* app/text/gimptext-compat.[ch]
	* app/text/gimptextlayer-transform.[ch]
	* app/gui/brush-select.[ch]
	* app/gui/font-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: added tons of "GimpContext *context"
	parameters and use the passed context instead of
	gimp_get_current_context().

	* app/app_procs.c
	* app/batch.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-ins.c
	* app/text/gimptextlayer.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimptransformtool.c
	* app/vectors/gimpvectors.c
	* app/gui/convert-dialog.c
	* app/gui/drawable-commands.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/offset-dialog.c
	* app/gui/select-commands.c
	* app/gui/vectors-commands.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or
	GIMP_CONTEXT(tool_options) or whatever is the right context
	to the changed core functions.

	* tools/pdbgen/app.pl: pass "GimpContext *context" to all
	generated PDB invokers.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/paint_tools.pdb
	* tools/pdbgen/pdb/palette.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/palettes.pdb
	* tools/pdbgen/pdb/paths.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/patterns.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/text_tool.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: pass the new context
	parameter to the changed core functions.

	* app/pdb/*_cmds.c: regenerated.
2004-04-14 23:37:34 +00:00
Michael Natterer
2e61d12ed4 Moved the calls to floating_sel_relax()/rigor() from various places to two
2004-04-13  Michael Natterer  <mitch@gimp.org>

	Moved the calls to floating_sel_relax()/rigor() from various
	places to two single spots in the core where they are actually
	needed. Fixes bug #138356 (which was caused by the projection
	being triggered in the middle of changing the floating selection's
	size or the size of the drawable it is attached to). This commit
	effectively removes floating selection fiddling from the core's
	public API.

	* app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new
	function which returns TRUE if there is a floating selection
	attached to the drawable.

	* app/core/gimpdrawable.c (gimp_drawable_translate)
	(gimp_drawable_set_tiles_full): if the drawable *has* a floating
	selection, relax/rigor it before/after modifying the drawable.

	* app/core/gimplayer.c (gimp_layer_translate)
	(gimp_layer_set_tiles): if the layer *is* the floating selection,
	relax/rigor it before/after modifying it.

	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/gui/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* tools/pdbgen/pdb/layer.pdb: removed calls to
	floating_sel_rigor()/relax() all over the place. Also removed
	lots of undo groups which are obsolete now.

	* app/pdb/layer_cmds.c: regenerated.
2004-04-13 13:54:54 +00:00
Sven Neumann
68d9b6013c push an undo group only when it's needed. This resurrects text undo
2004-04-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo
	group only when it's needed. This resurrects text undo compression
	that broke when bug #137767 got fixed.
2004-04-10 18:11:00 +00:00
Pedro Gimeno
f7ce875889 Sanitize rectangle and ellipse selection handling (bug #138237 and bug
2004-04-05  Pedro Gimeno  <pggimeno@wanadoo.es>

	Sanitize rectangle and ellipse selection handling (bug #138237
	and bug #138103):

	* app/tools/gimprectselecttool.h
	* app/tools/gimprectselecttool.c (GimpRectSelectTool): new
	member "moved" indicating whether the cursor was moved after
	the click.
	(gimp_rect_select_tool_coords_to_integer): New function for
	consistent conversion of the rectangle FP coords to pixels.
	(gimp_rect_select_tool_button_press,
	gimp_rect_select_tool_button_release,
	gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use
	it instead of fiddling with the FP coordinates. Update "moved"
	and use it to detect whether the selection needs to be cleared.

	* app/tools/gimpellipseselecttool.c
	(gimp_ellipse_select_tool_draw): use the new coords_to_integer
	function.
2004-04-05 08:08:23 +00:00
Michael Natterer
acc72b620e added undo type GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
2004-04-01  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch] (enum GimpUndoType): added undo type
	GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
	GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD.

	* app/core/gimpimage-undo-push.[ch]: added new new function
	gimp_image_undo_push_text_layer_modified() which makes
	modifications of the text_layer's "modified" boolean undoable.

	* app/core/gimpdrawable.[ch]: added new virtual function
	GimpDrawable::push_undo() and moved the actual undo pushing into
	the default implementation gimp_drawable_real_push_undo().

	* app/text/gimptextlayer.c (gimp_text_layer_push_undo): new
	function. Pushes the text_layer's modified state to the undo stack
	after upchaining and sets modified to TRUE.

	(gimp_text_layer_set_tiles): ditto.

	(gimp_lext_layer_apply_region)
	(gimp_text_layer_replace_region): removed because their default
	implementations already call gimp_drawable_push_undo().

	(gimp_text_layer_swap_pixels): removed because swap_pixels() is
	used by undo only and doesn't need to care about the text_layer's
	modified state.

	(gimp_text_layer_render): don't set modified to FALSE here because
	we can't push an undo step here.

	(gimp_text_layer_set): push the modified state to the undo stack
	and set it to FALSE here. Also push the layer's tiles if the
	layer was modified.

	* app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified"
	to the undo stack and set it to FALSE here, too.

	Fixes bug #137767.
2004-04-01 14:51:58 +00:00
Simon Budig
157af2d30c One really should use braces when mixing additions and multiplication and
2004-03-31  Simon Budig  <simon@gimp.org>

	* app/tools/gimptransformtool.c: One really should use braces
	when mixing additions and multiplication and the operator
	precedence is not the desired one...

	I feel stupid...  :-)
2004-03-31 14:21:36 +00:00
Michael Natterer
13b46f4847 fixed condition which triggers the path tool's undo hack. Fixes bug
2004-03-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.c (gimp_vector_tool_button_release):
	fixed condition which triggers the path tool's undo hack.  Fixes
	bug #138086. Also g_object_unref() the undo step.

	Removed trailing whitespace.
2004-03-25 12:46:20 +00:00
Manish Singh
87fba73a12 libgimp/gimp.c close the shm_open fd in the POSIX shm case. We were
2004-03-25  Manish Singh  <yosh@gimp.org>

        * libgimp/gimp.c
        * app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX
        shm case. We were leaking an fd here.
2004-03-25 09:02:28 +00:00
Sven Neumann
c809f21ab5 keep the text editor open as long as the text tool is connected to a text
2004-03-22  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: keep the text editor open as long as
	the text tool is connected to a text layer. Open the text editor
	when a text layer is activated in the layers dialog.
2004-03-22 15:19:19 +00:00
Sven Neumann
7469b06006 preserve the text tool on image changes. Instead connect to the text
2004-03-22  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: preserve the text tool on image
	changes. Instead connect to the text layer's "notify::modified"
	signal and disconnect from the layer when it is modified.
	Fixes bug #137890.
2004-03-22 14:32:47 +00:00
Sven Neumann
2326e1b979 added gimp_undo_type_to_name() a similar function used to live in
2004-03-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpundo.[ch]: added gimp_undo_type_to_name() a similar
	function used to live in gimpimage-undo.[ch].

	* app/core/gimpitemundo.c (gimp_item_undo_new): allow NULL as name
	and generate it from the undo_type then.

	* app/core/gimpimage-undo.[ch]: added gimp_image_undo_push_undu(),
	new function that allows to push an undo on the image.

	* app/text/Makefile.am
	* app/text/text-types.h
	* app/text/gimptextundo.[ch]: added GimpTextUndo, derived from
	GimpItemUndo.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
	use the new code and simply push a text undo here.

	* app/tools/gimptexttool.c: compress text undos by peeking at the
	undo stack. Fixes bug #137766.
2004-03-21 23:14:21 +00:00
Pedro Gimeno
9127a54dec Fixed several off-by-one problems in display:
2004-03-20  Pedro Gimeno  <pggimeno@wanadoo.es>

	Fixed several off-by-one problems in display:

	* app/display/gimpdisplayshell.h (PROJ_ROUND): New macro to apply
	to a float the same rounding method as the one used when rendering.
	(SCALEX, SCALEY): Use PROJ_ROUND instead of truncating.

	* app/display/gimpdisplayshell-transform.c
	(gimp_display_shell_transform_xy): Accept gdouble image coordinates
	even if the returned screen coordinates are integer. Use PROJ_ROUND
	instead of (gint) to apply proper rounding. Fixes bug #137566.

	* app/display/gimpdisplayshell-transform.h
	(gimp_display_shell_transform_xy): changed accordingly.

	* app/display/gimpdisplayshell-draw.c
	* app/tools/gimpdrawtool.c: make sure everywhere that PROJ_ROUND
	is used either directly or through gimp_display_shell_transform_xy,
	instead of using arbitrary rounding methods.
2004-03-20 21:59:41 +00:00
Sven Neumann
584b3ceb9b don't take the image from tool->gdisp, this might be a NULL pointer.
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_create_vectors): don't
	take the image from tool->gdisp, this might be a NULL pointer.

	* app/core/gimpimage-undo-push.c: removed debugging output.
2004-03-20 20:10:05 +00:00
Sven Neumann
20d03407fe avoid to set the unit property with every size change; only set it if it
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_callback):
	avoid to set the unit property with every size change; only set it
	if it actually changed.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
	allow to pass a GParamSpec that identifies a single text property
	to be changed. In this case, don't store a GimpText object on the
	undo stack but only the changed value.

	* app/tools/gimptexttool.c: use the new undo feature to reduce the
	memory footprint of text undo for the common case.

	* app/text/gimptextlayer.c: changed accordingly.
2004-03-20 17:21:48 +00:00
Simon Budig
a08efc86bd Assigned "b" as the default shortcut for the path tool ("Bezier").
2004-03-20  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Assigned "b" as the default shortcut
	for the path tool ("Bezier").

	Fixes bug #137753.
2004-03-20 15:28:28 +00:00
Sven Neumann
fc3846e422 update the text editor when the text changes (for example when undoing
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: update the text editor when the text
	changes (for example when undoing text changes). Push a drawable
	undo when applying text changes to a modified text layer.
2004-03-20 13:26:02 +00:00
Simon Budig
5e47b5a0ed Make it possible to refresh the preview of an undo step.
2004-03-20  Simon Budig  <simon@gimp.org>

	* app/core/gimpundo.[ch]: Make it possible to refresh the preview
	of an undo step.

	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: refresh the preview when
	compressing undos. This ensures that the last preview in the undo
	history always reflects the current state of the image.
2004-03-19 23:42:42 +00:00
Sven Neumann
cbbe4f3871 don't exchange the text_layer's text object but sync it with the text
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-undo-push.c (undo_pop_text_layer): don't
	exchange the text_layer's text object but sync it with the text
	object from the undo step.

	* app/text/gimptextlayer.c (gimp_text_layer_set): in case the
	layer has a mask, push an undo group around the text modifications.

	* app/tools/gimptexttool.c (gimp_text_tool_idle_apply): push a
	text layer undo before applying the text changes.
2004-03-19 23:08:24 +00:00
Sven Neumann
5420154a66 if there's a layer mask, resize it with the layer.
2004-03-19  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.c (gimp_text_layer_render): if there's a
	layer mask, resize it with the layer.

	* app/tools/gimptexttool.c: don't change text_tool->layer before
	calling gimp_text_tool_connect().
2004-03-19 19:26:18 +00:00
Sven Neumann
e9e3e22dae added a confirmation dialog that is shown when the user attempts to modify
2004-03-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: added a confirmation dialog that is
	shown when the user attempts to modify a modified text layer.
2004-03-19 16:29:36 +00:00
Michael Natterer
fddb9ce0e3 app/gui/color-notebook.c (color_notebook_new) app/tools/gimpcroptool.c
2004-03-19  Michael Natterer  <mitch@gimp.org>

	* app/gui/color-notebook.c (color_notebook_new)
	* app/tools/gimpcroptool.c (crop_info_create)
	* app/tools/gimptransformtool.c (gimp_transform_tool_dialog):
	explicitely set a default response for dialog buttons which were
	created using gtk_dialog_add_buttons().
2004-03-19 10:15:56 +00:00
Sven Neumann
d7dbf81ab0 cleaned up text tool logic.
2004-03-18  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: cleaned up text tool logic.
2004-03-18 20:55:00 +00:00
Sven Neumann
17679a610b added a missing call to gimp_image_flush().
2004-03-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_bucket_fill):
	added a missing call to gimp_image_flush().

	* app/tools/gimptexttool.c: propagate text changes to the tool
	options.

	* app/text/gimptextlayer.c: made "text", "auto-rename" and
	"modified" properties of the text layer and copy them when
	duplicating a text layer.

	* app/text/gimptextlayer-xcf.[ch]: added utility functions to
	convert the new properties to flags to be saved in the XCF file.

	* app/xcf/xcf-load.c
	* app/xcf/xcf-private.h
	* app/xcf/xcf-save.c: load and save text layer properties.
	Disabled warnings about unknown properties for stable branches.
2004-03-18 15:27:23 +00:00
Sven Neumann
b7965325e6 look ahead in the queue of pending changes and compress changes to the
2004-03-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_apply): look ahead in
	the queue of pending changes and compress changes to the same
	property. Fixed a couple of smaller issues.

	* app/widgets/gimpwidgets-utils.c: corrected indentation.
2004-03-16 00:16:52 +00:00
Michael Natterer
59b77c35c2 emit "update" signals from the drawable before and after setting tiles and
2004-03-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.c (gimp_drawable_set_tiles_full): emit
	"update" signals from the drawable before and after setting tiles
	and offsets.

	* app/core/gimpdrawable-offset.c (gimp_drawable_offset)
	* app/core/gimpdrawable-transform.c (gimp_drawable_transform_paste)
	* app/core/gimpimage-undo-push.c (undo_pop_layer_mod, _channel_mod)
	* app/text/gimptextlayer.c (gimp_text_layer_render)
	* app/tools/gimptransformtool.c (gimp_transform_tool_doit):
	removed calls to gimp_drawable_update().

	* app/core/gimpdrawable-offset.c (gimp_drawable_offset): don't
	push an undo step before calling gimp_drawable_set_tiles()
	but simply pass push_undo == TRUE and the undo_desc.
2004-03-15 20:05:31 +00:00
Michael Natterer
1ef5fa93ca added "offset_x" and "offset_y" parameters to GimpDrawable::set_tiles().
2004-03-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.[ch]: added "offset_x" and "offset_y"
	parameters to GimpDrawable::set_tiles().

	(gimp_drawable_set_tiles): removed the "GimpImageType" parameter.

	(gimp_drawable_set_tiles_full): new function adding type, offset_x
	and offset_y parameters.

	(gimp_drawable_real_set_tiles): set the drawable's offsets from
	the offset parameters and its size from the passed TileManager's
	size. Emit "size_changed" accordingly.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimplayer.c
	* app/text/gimptextlayer.c
	* app/tools/gimptransformtool.c: changed accordingly: removed
	calls to gimp_viewable_size_changed() and all sorts of hackish
	assignments of the drawable's width/height/offset_x/offset_y
	properties.
2004-03-15 19:34:35 +00:00
Michael Natterer
7977603648 don't call gimp_image_flush().
2004-03-15  Michael Natterer  <mitch@gimp.org>

	* app/text/gimptextlayer.c (gimp_text_layer_render): don't call
	gimp_image_flush().

	* app/tools/gimpxttool.c (gimp_text_tool_apply): call it here
	instead.

	Now that we have a common place that exchanges drawable->tiles,
	we can abstract away boundary invalidation for this operation:

	* app/core/gimpdrawable.c (gimp_drawable_real_set_tiles):
	call gimp_drawable_invalidate_boundary() before setting
	the new tiles.

	* app/core/gimpchannel.c (gimp_channel_set_tiles)
	* app/core/gimpdrawable-transform.c (gimp_drawable_transform_paste)
	* app/core/gimpimage-undo-push.c (undo_pop_layer_mod)
	* app/core/gimplayer.c (gimp_layer_scale) (gimp_layer_resize)
	(gimp_layer_flip) (gimp_layer_rotate) (gimp_layer_transform)
	* app/text/gimptextlayer.c (gimp_text_layer_render): removed
	calls to gimp_drawable_invalidate_boundary() from all functions
	which finally call gimp_drawable_real_set_tiles().

	* app/tools/gimptransformtool.c (gimp_transform_tool_doit): no
	need to set channel->bounds_known to FALSE, because
	gimp_drawable_set_tiles() already did this.
2004-03-15 17:53:55 +00:00
Sven Neumann
63bb032f70 app/tools/gimpcolorpickertool.c app/tools/gimpcroptool.c
2004-03-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c: don't set tool dialogs transient
	to the image window. Fixes bug #128833.
2004-03-14 22:16:12 +00:00
Sven Neumann
f67c16ec60 removed all idle handling here. Changes to the text-layer's text object
2004-03-14  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.[ch]: removed all idle handling here.
	Changes to the text-layer's text object all applied synchronously.

	* app/display/gimpdisplayshell-dnd.c
	* app/text/gimptextlayer-transform.c: removed now obsolete calls
	to gimp_text_layer_flush().

	* app/tools/gimptexttool.[ch]: queue up changes to the proxy text
	object and apply them in one go from a low-priority idle handler.
	This is basically what GimpTextLayer used to do.
2004-03-14 18:48:00 +00:00
Sven Neumann
0993486a0a app/tools/gimptextoptions.[ch] introduced a proxy GimpText object that is
2004-03-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]
	* app/tools/gimptexttool.[ch]: introduced a proxy GimpText object
	that is tied to the GimpTextOptions for the lifetime of the text
	tool. Brings us one step closer to text undo...
2004-03-14 17:54:23 +00:00
Michael Natterer
2498c6659e Completed the fix for bug #136702:
2004-03-13  Michael Natterer  <mitch@gimp.org>

	Completed the fix for bug #136702:

	* app/core/gimpitem.[ch]: added "gboolean supersample" and
	"gint recursion_level" to GimpItem::transform().

	* app/core/gimpitem-linked.[ch]	(gimp_item_linked_transform): ditto.

	* app/core/gimpdrawable-transform.[ch]: added "recursion_level"
	parameters and removed the RECURSION_LEVEL #define.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/vectors/gimpvectors.c: changed accordingly.

	* app/tools/gimptransformoptions.[ch]: added new property
	"recursion_level" which is not serializable and has no GUI. Pretty
	useless, but it's IMHO better to hardcode the default value here
	than in gimpdrawable-transform.c

	* app/tools/gimptransformtool.c: changed accordingly.

	* tools/pdbgen/pdb/transform_tools.pdb: hardcode "recursion_level"
	to 3.

	* app/pdb/transform_tools_cmds.c: regenerated.
2004-03-13 17:45:58 +00:00
Sven Neumann
27fc81be2a override the "gradient_repeat" property inherited from GimpPaintOptions
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpblendoptions.c: override the "gradient_repeat"
	property inherited from GimpPaintOptions and set the default to
	GIMP_REPEAT_NONE. Seems more appropriate for the blend tool.
2004-03-13 15:48:32 +00:00
Sven Neumann
c179f9acaf added new virtual function GimpDrawable::set_tiles().
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdrawable.[ch]: added new virtual function
	GimpDrawable::set_tiles().

	* app/core/gimpchannel.c
	* app/core/gimplayer.c: push an undo before chaining up in
	set_tiles().

	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-convert.c
	* app/tools/gimptransformtool.c: use gimp_drawable_set_tiles()
	instead of fiddling with the drawable's tile manager directly.
2004-03-13 13:56:09 +00:00
Sven Neumann
beaed82ce8 for consistency, changed the label from "Supersample" to "Supersampling".
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c (gimp_transform_options_gui): for
	consistency, changed the label from "Supersample" to "Supersampling".
2004-03-13 11:41:57 +00:00
Raphael Quinet
59dfdac9b1 added new "supersample" property to GimpTransformOptions and added
2004-03-13  Raphael Quinet  <quinet@gamers.org>

	* app/tools/gimptransformoptions.[ch]: added new "supersample"
	property to GimpTransformOptions and added corresponding check
	button in the option dialog for the transform tools.

	* app/core/gimpdrawable-transform.[ch],
	* app/core/gimpdrawable.c,
	* app/tools/gimptransformtool.c: new "gboolean supersample"
	parameter added to gimp_drawable_transform_tiles_affine() and
	gimp_drawable_transform_affine().

	* tools/pdbgen/pdb/transform_tools.pdb: ditto.  For the PDB calls,
	the supersample parameter is set to FALSE for "rotate" and "shear"
	and set to TRUE for "perspective", "scale" and "transform_2d".

	* app/pdb/transform_tools_cmds.c: regenerated.

	The new "supersample" option lets the user decide if the
	transformations should use supersampling (RECURSION_LEVEL 3) or
	not.  This fixes both bug #136702 and bug #109817.  Hopefully for
	good, this time.
2004-03-13 11:24:25 +00:00
Raphael Quinet
40825ad048 added missing semicolon that was breaking the build.
2004-03-13  Raphael Quinet  <quinet@gamers.org>

	* app/tools/gimptexttool.c (gimp_text_tool_set_layer): added
	missing semicolon that was breaking the build.
2004-03-13 09:04:37 +00:00
Sven Neumann
4634ee2244 bugfix.
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_set_layer): bugfix.
2004-03-13 03:57:01 +00:00
Sven Neumann
285b58de41 use a GimpSizeEntry for the font size.
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]: use a GimpSizeEntry for the
	font size.

	* app/tools/gimptexttool.c: set the size entry's resolution to the
	image resolution. Fixes bug #118356.
2004-03-13 03:19:53 +00:00
Sven Neumann
07a92fe591 keep a pointer on the active text layer and let the tool follow the active
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: keep a pointer on the active text
	layer and let the tool follow the active layer. Fixes bug #124970.

	* app/gui/layers-commands.c: changed accordingly.
2004-03-13 00:47:31 +00:00
Sven Neumann
dc652db2f5 app/tools/gimpcurvestool.c app/tools/gimpinktool.c print debug output to
2004-03-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimpinktool.c
	* app/tools/gimptool.c: print debug output to stderr.
2004-03-12 13:50:36 +00:00
Sven Neumann
8827ea203a always connect the "text_changed" signal so text layers can be edited
2004-03-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_editor): always connect
	the "text_changed" signal so text layers can be edited again.
2004-03-12 00:36:17 +00:00
Sven Neumann
97d533410d set the color of the new text from the context foreground color.
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_create_text):
	set the color of the new text from the context foreground color.
2004-03-11 21:05:36 +00:00
Sven Neumann
fb2d9928a8 redid the color handling. Still not perfect, but it is somewhat cleaner.
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]: redid the color handling.
	Still not perfect, but it is somewhat cleaner.
2004-03-11 20:52:49 +00:00
Sven Neumann
21f26743c1 made gimp_config_sync() and gimp_config_connect() also work on objects of
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-utils.c: made gimp_config_sync() and
	gimp_config_connect() also work on objects of different types.
	Properties with the same name and the same type are synced /
	connected.

	* app/core/gimpcontext.[ch]: added convenience functions to get/set
	the font by name.

	* app/tools/gimptextoptions.[ch]: don't hold a GimpText object
	that duplicates properties like font and color which are in
	GimpContext already. Instead added all text properties that are
	controlled from the text tool options.  Handling of the foreground
	color is somewhat broken and needs a GimpContext wizard (Mitch!).

	* app/text/gimptext.c: blurbs are not any longer needed now that
	the property widgets are created from the GimpTextOptions.

	* app/tools/gimptexttool.c: changed accordingly.

	* app/widgets/gimptexteditor.[ch]: use an internal GtkTextBuffer
	and emit "text-changed" when it changes.
2004-03-11 18:47:37 +00:00
Sven Neumann
9ff5123e63 connect notify::preview using g_signal_connect_object(). Fixes bug
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_initialize):
	connect notify::preview using g_signal_connect_object().
	Fixes bug #136850.
2004-03-11 12:36:10 +00:00
Simon Budig
70671753ae app/base/cpu-accel.c app/display/gimpdisplayshell-dnd.c
2004-03-10  Simon Budig  <simon@gimp.org>

	* app/base/cpu-accel.c
	* app/display/gimpdisplayshell-dnd.c
	* app/tools/gimpvectortool.c
	* app/vectors/gimpbezierstroke.c
	* app/vectors/gimpvectors-import.c: Removed, disabled or
	conditionalized some debug output.

	There still is debug output when pushing/popping the move tool
	via space bar. Mitch wanted to look at that.
2004-03-10 15:10:34 +00:00
Michael Natterer
79e13a1ca0 app/tools/gimpdrawtool.c app/tools/gimpselectiontool.c
2004-03-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptool.c
	* app/tools/gimptransformtool.c: minor cleanup.
2004-03-10 12:45:11 +00:00
Michael Natterer
860f3d46be don't reinitialize the tool when the image becomes dirty but just cancel
2004-03-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c (tool_manager_image_dirty): don't
	reinitialize the tool when the image becomes dirty but just cancel
	it (fixes bug #131965). Also, only cancel the tool if the tool is
	operating on one of the dirtied image's displays (fixes bug #12253).
2004-03-10 12:25:15 +00:00
Michael Natterer
c5efb31dec redid my last layer_mask vs. layer move fix by reordering the whole
2004-03-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_button_press): redid my
	last layer_mask vs. layer move fix by reordering the whole
	function: now we first check if we can pick a path, guide or layer
	and bail out early if we can't; do the actual init_edit_selection()
	calls in a trivial unconditional switch() after that picking
	check. Removes code duplication and makes the whole function less
	nested and weird.

	Cleaned up the whole file a bit.
2004-03-09 13:24:15 +00:00
Hans Breuer
2036638f73 updated
2004-03-07  Hans Breuer  <hans@breuer.org>

	* themes/Default/images/makefile.msc
	  app/*/makefile.msc plug-ins/makefile.msc : updated
2004-03-07 23:13:51 +00:00
Sven Neumann
dd4a8fff00 compute the slider positions in the expose event handler so that the
2004-03-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c: compute the slider positions in the
	expose event handler so that the sliders get positioned correctly
	when the dialog is resized.
2004-03-05 14:22:02 +00:00
Michael Natterer
c9a1455e54 #include "widgets/gimppropwidgets.h"
2004-03-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcurvestool.c: #include "widgets/gimppropwidgets.h"
2004-03-05 10:03:07 +00:00
Sven Neumann
0ef0afea3a app/tools/gimpcurvestool.c app/tools/gimplevelstool.c added buttons to
2004-03-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c: added buttons to toggle the
	histogram scale from the tool dialogs. Fixes bug #136227.
2004-03-05 01:31:33 +00:00
Michael Natterer
f3df250a74 if we pick a layer to move and this layer has a mask which is being edited
2004-03-04  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_button_press): if we
	pick a layer to move and this layer has a mask which is being
	edited (active), start moving the mask, not the layer.
2004-03-04 21:01:26 +00:00
Sven Neumann
e21dc0ee93 marked new strings for translation.
2004-03-04  Sven Neumann  <sven@gimp.org>

	* app/config/gimprc-blurbs.h: marked new strings for translation.

	* libgimpwidgets/gimpstock.h: added #defines for missing icons.
	This allows us to replace them later without changing the API.

	* app/gui/dialogs-constructors.c
	* app/gui/dialogs-menu.c
	* app/gui/gradient-editor-commands.c
	* app/gui/image-menu.c
	* app/gui/toolbox-menu.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c
	* app/widgets/gimppaletteeditor.c: use the new stock icon names
	instead of abusing GTK+ and GIMP tool stock icons.

	* app/gui/preferences-dialog.c (prefs_dialog_new): added icons
	to the new check buttons.
2004-03-04 16:10:57 +00:00
Michael Natterer
ba265516a1 app/config/gimpcoreconfig.[ch] added boolean properties "global-brush",
2004-03-04  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpcoreconfig.[ch]
	* app/config/gimprc-blurbs.h: added boolean properties
	"global-brush", "global-pattern" etc.

	* app/gui/preferences-dialog.c: added GUI for them to the
	"Tool Options" page.

	* app/tools/tool_manager.c (tool_manager_tool_changed): honor the
	new prefs options when copying the new tool's properties.
	Fixed bug #122519.
2004-03-04 14:04:22 +00:00
Michael Natterer
dade4a8430 app/tools/gimpeditselectiontool.c compress undo steps only if the redo
2004-03-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimplayertreeview.c: compress undo steps only
	if the redo stack is empty.
2004-03-02 14:33:31 +00:00
Sven Neumann
ad26c89bbb changed the upper limit for the supersampling depth from 10 to 6 (as a
2004-02-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpblendoptions.c: changed the upper limit for the
	supersampling depth from 10 to 6 (as a workaround for bug #133266).
2004-02-29 15:02:04 +00:00
Michael Natterer
4ae2c548d6 cleanup.
2004-02-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c: cleanup.

	* app/tools/gimplevelstool.c (gimp_levels_tool_dialog): added 2px
	spacing between the pick buttons and their entries.
2004-02-25 15:56:50 +00:00
Michael Natterer
0d3e3625c3 moved "shell_desc" from GimpImageMapTool to GimpImageMapToolClass and
2004-02-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.[ch]: moved "shell_desc" from
	GimpImageMapTool to GimpImageMapToolClass and added
	"load_dialog_title" and "save_dialog_title". Create the
	load/save buttons in gimp_image_map_tool_initialize() and
	remember them in the GimpImageMapTool struct. Moved the
	whole load/save button/dialog logic into private functions.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: changed accordingly, removed
	load/save callbacks, inlined the load/save functions into
	GimpImageMapTool's virtual function implementations.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: changed accordingly.
2004-02-25 13:55:45 +00:00
Sven Neumann
0a309fe940 app/tools/gimpcurvestool.[ch] removed obsoleted variables.
2004-02-25  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimplevelstool.h: removed obsoleted variables.
2004-02-25 12:31:18 +00:00
Sven Neumann
c66053676c removed obsolete includes 2004-02-25 10:28:09 +00:00
Sven Neumann
c1de6345a7 app/tools/gimpcurvestool.[ch] app/tools/gimpimagemapoptions.[ch]
2004-02-25  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimpimagemapoptions.[ch]
	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimplevelstool.[ch]: moved the settings file dialog
	that was duplicated in the curves and levels tools to the
	GimpImageMapTool class. Store the last used filename in the
	GimpImageMapOptions (proper fix for bug #135059).
2004-02-25 10:23:43 +00:00
Dave Neary
879e24fec9 Revert to 1.2 behaviour of hiding rather than destroying the curves
2004-02-24  Dave Neary  <bolsh@gimp.org>

        * app/tools/gimpcurvestool.c: Revert to 1.2 behaviour of hiding
        rather than destroying the curves load/save dialog. This makes
        the last selected curve be selected when the dialog is
        re-opened, and fixes bug #135059.

        Also append G_DIR_SEPARATOR_S to the end of the filename we
        build while creating the dialog, rather than ".".
2004-02-24 22:09:28 +00:00
Simon Budig
00c35dad74 don't access the array before checking if the index is within the valid
2004-02-23  Simon Budig  <simon@gimp.org>

	* app/tools/gimpinktool-blob.c: don't access the array before
	checking if the index is within the valid bounds...
2004-02-23 20:12:35 +00:00
Sven Neumann
5077aa4c85 Let all GimpImageMap tools remember the state of the preview toggle (bug
2004-02-22  Sven Neumann  <sven@gimp.org>

	Let all GimpImageMap tools remember the state of the preview toggle
	(bug #135059):

	* app/tools/Makefile.am
	* app/tools/gimpimagemapoptions.[ch]
	* app/tools/tools-types.h: added new GimpToolOptions class to hold
	the preview setting.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.[ch]
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimpposterizetool.c
	* app/tools/tools-types.h: use the new class.
2004-02-22 14:28:53 +00:00
Simon Budig
331f982322 added "use_offsets" parameter to gimp_draw_tool_draw_boundary() for
2004-02-21  Simon Budig  <simon@gimp.org>

	* app/tools/gimpdrawtool.[ch]: added "use_offsets" parameter
	to gimp_draw_tool_draw_boundary() for consistency.

	* app/tools/gimpeditselectiontool.c: Changed accordingly.

	* app/tools/gimppainttool.c: when drawing straight lines draw
	the brush preview at the end of the line.
2004-02-21 16:06:56 +00:00
Sven Neumann
cec5c6ab31 put the color bars into an event box and draw the sliders on the event box
2004-02-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.[ch]: put the color bars into an event
	box and draw the sliders on the event box window.

	* app/widgets/gimpcolorbar.[ch]: removed support for input events
	which is no longer needed. For consistency, renamed "channel"
	property to "histogram-channel".

	* app/widgets/gimphistogrambox.c: changed accordingly.

	* app/widgets/gimpenummenu.[ch]: added new function
	gimp_enum_stock_box_set_child_padding().

	* app/tools/gimpcurvestool.[ch]: let the graph widget expand with
	the dialog plus some other dialog tweaks.

	* app/widgets/gimphistogrameditor.c: let the channel menu shrink
	as in the other dialogs.

	* libgimpwidgets/gimpcolorselect.c (gimp_color_select_image_fill):
	allocate temporary buffer on the stack.
2004-02-21 12:25:09 +00:00
Sven Neumann
924acb2b0d app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-02-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolorbar.[ch]: added new widget GimpColorBar.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimphistogrambox.[ch]: use GimpColorBar widgets.

	* app/widgets/gimpcolorframe.[ch]: fixed typos.
2004-02-19 19:56:04 +00:00
Sven Neumann
7b7b978e8f follow some of the levels tool dialog changes for consistency.
2004-02-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c (gimp_curves_tool_dialog): follow
	some of the levels tool dialog changes for consistency.
2004-02-19 14:10:54 +00:00
Sven Neumann
200cca7f36 more dialog tweaking, fixed positioning of slider triangles.
2004-02-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c: more dialog tweaking, fixed
	positioning of slider triangles.
2004-02-19 02:23:32 +00:00
Sven Neumann
1abda66f8e readded some code that was accidentally forgotten with the last commit 2004-02-19 00:06:30 +00:00
Sven Neumann
5f147b8e91 applied patch from Dave Neary that removes gray point pickers for
2004-02-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c (gimp_levels_tool_dialog): applied
	patch from Dave Neary that removes gray point pickers for
	individual channels (bug #125303). Let the levels widgets expand
	with the dialog.
2004-02-18 23:52:31 +00:00
Simon Budig
097801d7a7 app/config/gimpguiconfig.[ch] Added new GUI option: snapping distance
2004-02-18  Simon Budig  <simon@gimp.org>

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: Added new GUI option: snapping distance

	* app/gui/preferences-dialog.c: add a preferences widget

	* app/tools/gimpmovetool.c
	* app/display/gimpdisplayshell.c: use it for snapping.
2004-02-18 20:31:11 +00:00
Sven Neumann
fb1213290f tile-cache.c tile-private.h removed trailing whitespace, added some
2004-02-18  Sven Neumann  <sven@gimp.org>

        * tile-cache.c
        * tile-private.h
        * tile.[ch]: removed trailing whitespace, added some newlines,
        let tile_is_valid() return a gboolean instead of a gint.

        * app/core/gimpimage-projection.c
        * app/core/gimpimage-undo-push.c
        * app/paint/gimppaintcore.c
        * app/tools/gimpinktool.c: use the return value from tile_is_valid()
        as a boolean.
2004-02-18 18:57:43 +00:00
Simon Budig
40ac20ff92 app/display/gimpdisplayshell.c Adjusted snapping distance to 8 pixels,
2004-02-18  Simon Budig  <simon@gimp.org>

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: Adjusted snapping distance
	to 8 pixels, probably should be a preferences option.

	* app/tools/gimppainttool.c: Do not center the start and end
	of a straight line to the center of an image-pixel unless
	the brush mode is GIMP_BRUSH_HARD. Fixes bug #134410.
2004-02-18 18:37:49 +00:00
Sven Neumann
9f654edabf use limits from libgimpbase instead of arbitrary numbers. Don't allow a
2004-02-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c (crop_info_create): use limits from
	libgimpbase instead of arbitrary numbers. Don't allow a crop width
	or height smaller than 1 (or GIMP_MIN_IMAGE_SIZE actually).
2004-02-16 12:21:27 +00:00
Simon Budig
ce5e592e23 make a similar fix as in my last commit for snapping the guides.
2004-02-13  Simon Budig  <simon@gimp.org>

	* app/core/gimpimage-guides.[ch]: make a similar fix as in my
	last commit for snapping the guides.

	* app/tools/gimpmovetool.c: use the fixed version.
2004-02-13 14:04:41 +00:00
Michael Natterer
8091f46f71 call gimp_image_colormap_changed() after installing the colormap.
2004-02-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-convert.c (gimp_image_convert): call
	gimp_image_colormap_changed() after installing the colormap.

	* app/tools/gimphistogramoptions.h: fixed typedef of
	GimpHistogramOptionsClass.
2004-02-12 14:09:35 +00:00
Michael Natterer
cfd6fb0a8e ignore double clicks so we don't grab the pointer away from the curves
2004-02-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogramview.c (gimp_histogram_view_button_press):
	ignore double clicks so we don't grab the pointer away from the
	curves dialog. Fixes bug #132356.

	* app/tools/gimpcurvestool.c (curves_graph_events): ignore button
	press and release events from all buttons except the first one.
2004-02-12 13:12:56 +00:00
Sven Neumann
ecdf62b5ce derive the text tool from GimpTool directly. Doesn't look like we are
2004-02-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: derive the text tool from GimpTool
	directly. Doesn't look like we are going to use draw_tool
	functionality for 2.0.
2004-02-12 00:03:42 +00:00
Sven Neumann
d893018056 repaired broken text tool logic (bug #124969).
2004-02-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: repaired broken text tool logic
	(bug #124969).
2004-02-11 14:44:01 +00:00
Sven Neumann
4005559c72 set GIMP_CONTEXT_FONT_MASK. Fixes bug #133067.
2004-02-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_register): set
	GIMP_CONTEXT_FONT_MASK. Fixes bug #133067.
2004-02-10 02:15:41 +00:00
Sven Neumann
f3c8c2ad83 don't activate the iscissors tool if it's already active (bug #132351).
2004-02-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpiscissorstool.c (gimp_iscissors_tool_button_press):
	don't activate the iscissors tool if it's already active
	(bug #132351).
2004-02-08 22:28:21 +00:00
Sven Neumann
bfed965df9 implemented so that double-clicking a text layer now only activates the
2004-02-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_set_layer): implemented
	so that double-clicking a text layer now only activates the text
	tool but also set the layer's text on the tool options.
2004-02-08 22:09:57 +00:00
Sven Neumann
d298be7a8c put overly picky sanity checks into #ifdef GIMP_UNSTABLE ... #endif so we
2004-02-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptoolcontrol.c (gimp_tool_control_activate)
	(gimp_tool_control_halt): put overly picky sanity checks into
	#ifdef GIMP_UNSTABLE ... #endif so we won't get these harmless
	tool warnings from the stable version (bug #121074).
2004-02-08 21:46:30 +00:00
Hans Breuer
5cbb416a91 new file to keep common definitions for the msc build use common
2004-02-07  Hans Breuer  <hans@breuer.org>

	* gimpdefs.msc : new file to keep common definitions for the msc build
	* **/makefile.msc : use common defintions, e.g. GIMP_VER
	* Makefile.am : add the former to EXTRA_DIST
2004-02-07 23:01:33 +00:00
Michael Natterer
bfe203c2e2 removed all drawing functions. The file was still too large.
2004-02-07  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.[ch]: removed all drawing functions.
	The file was still too large.

	* app/display/Makefile.am
	* app/display/gimpdisplayshell-draw.[ch]: new files containing
	the drawing functions.

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-handlers.c
	* app/tools/gimpmovetool.c: changed #includes accordingly.

	* app/display/gimpdisplay-handlers.c
	(gimp_display_size_changed_handler): added some #if 0'ed code I'm
	not sure about. Actually, some of the handlers in this file could
	need the same code, so it could be abstracted as
	gimp_display_stop_draw() or something. Please have a look.
2004-02-07 00:16:52 +00:00
Michael Natterer
b48b110e3e don't try to CLAMP() the passed in rectangle to valid image/drawable
2004-02-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimprectselecttool.c
	(gimp_rect_select_tool_rect_select): don't try to CLAMP() the
	passed in rectangle to valid image/drawable coordinates manually
	when auto-shrinking the selection. Instead, use
	gimp_rectangle_intersect(). Also honor the active drawable's
	offsets. Fixes bug #133467.
2004-02-05 11:11:22 +00:00
Sven Neumann
b49e39e8ed app/core/gimpchannel.c app/tools/gimptexttool.c app/vectors/gimpvectors.c
2004-02-04  Sven Neumann  <sven@gimp.org>

	* app/core/gimpchannel.c
	* app/tools/gimptexttool.c
	* app/vectors/gimpvectors.c
	* app/widgets/gimpbufferview.c: removed double semicolons.
2004-02-04 16:52:35 +00:00
Simon Budig
645a1ab652 Store the zoom factor as float, not as a ratio.
2004-01-29  Simon Budig  <simon@gimp.org>

	* app/display/gimpdisplayshell.[ch]: Store the zoom factor as
	float, not as a ratio.

	* app/display/gimpdisplayshell-scale.[ch]: change the API to
	expose the Float instead a weirdly encoded integer. Implement
	functions to get a ratio from the scale factor. Implement a set
	as presets as discussed on the mailinglist. Changed Zoom->Other
	dialog to enable entering a float.

	* app/display/gimpdisplayshell-title.c
	* app/display/gimpnavigationview.c
	* app/gui/image-menu.c
	* app/gui/info-window.c
	* app/tools/gimpmagnifytool.c: changed accordingly.

	* app/core/gimp.[ch]
	* app/display/gimpdisplay.[ch]
	* app/gui/gui-vtable.c
	* app/widgets/widgets-enums.h: Made the various display-creating
	functions accept a float for the scale. Introduce a new
	GimpZoomType: GIMP_ZOOM_TO. Generally adjust the API to use
	floats instead of weird integers.

	* app/core/gimp-edit.c
	* app/core/gimptemplate.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/file/file-open.c
	* app/gui/image-commands.c
	* app/gui/view-commands.[ch]
	* tools/pdbgen/pdb/display.pdb
	* app/widgets/gimpimageview.c
	* app/widgets/gimptoolbox-dnd.c: changed accordingly

	* app/pdb/display_cmds.c: regenerated
2004-01-29 22:22:29 +00:00
Sven Neumann
4591bc1a8d app/tools/gimpcurvestool.c app/tools/gimpinkoptions.c removed explicit
2004-01-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimpinkoptions.c
	* app/tools/gimplevelstool.c: removed explicit grabs. The pointer
	is already implicitely grabbed while the button is pressed.
2004-01-29 13:59:14 +00:00
Michael Natterer
b2606b5128 Re-enabled filling the whole selection using the bucket fill tool. Fixes
2004-01-27  Michael Natterer  <mitch@gimp.org>

	Re-enabled filling the whole selection using the bucket fill
	tool. Fixes bug #132649.

	* app/tools/gimpbucketfilloptions.[ch]: added boolean property
	"fill-selection" and a GUI for it.

	* app/tools/gimpbucketfilltool.c: changed accordingly.
2004-01-27 15:26:11 +00:00
Sven Neumann
0fd5669948 app/tools/gimpcurvestool.c use dark_gc instead of text_aa_gc to draw the
2004-01-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/widgets/gimphistogramview.c: use dark_gc instead of
	text_aa_gc to draw the histogram and curves grid lines. dark_gc is
	slightly lighter, looks better and fixes bug #132565.
2004-01-26 16:45:01 +00:00
Simon Budig
9d8df85168 do nothing in _button_press when the tool is in the VECTORS_FINISHED
2004-01-26  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: do nothing in _button_press when
	the tool is in the VECTORS_FINISHED state.
	Fixes bug #132508.
2004-01-25 23:51:18 +00:00
Michael Natterer
00c525abbc fiddle with the passed channel index only for GRAYA drawables, not for all
2004-01-24  Michael Natterer  <mitch@gimp.org>

	* tools/pdbgen/pdb/color.pdb (levels, curves): fiddle with the
	passed channel index only for GRAYA drawables, not for all GRAY
	drawables. Fixes bug #132322.

	* tools/pdbgen/pdb/color.pdb: regenerated.

	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimplevelstool.[ch]: fixed the same bug here. It never
	occured because the "channel" field was accidentially initialized
	with the correct value and never changed after.
2004-01-24 18:35:49 +00:00
Michael Natterer
613e328f13 added boolean return value to GimpTool::initialize(). Returning FALSE
2004-01-21  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]: added boolean return value to
	GimpTool::initialize(). Returning FALSE means the tool could not
	be initialized and doesn't want to receive button events.
	Return TRUE from the default implementation.

	* app/tools/tool_manager.[ch]: added boolean return value to
	tool_manager_initialize_active(). Don't set the tool's display or
	drawable if initialize() returns FALSE.

	* app/display/gimpdisplayshell-callbacks.c: don't send button
	events to the tool if initialize() returns FALSE.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: return FALSE for NULL and indexed
	drawables.

	* app/tools/gimpimagemaptool.c: always return TRUE because our
	subclasses already checked if the active drawable is OK.

	* app/tools/gimptransformtool.c: return FALSE for layers with
	masks. Fixes bug #132089. Some random cleanups.
2004-01-21 16:07:48 +00:00
Michael Natterer
73d258eb3d renamed info_dialog_popdown() to info_dialog_hide() and
2004-01-21  Michael Natterer  <mitch@gimp.org>

	* app/gui/info-dialog.[ch]: renamed info_dialog_popdown() to
	info_dialog_hide() and info_dialog_popup() to info_dialog_present().
	Added info_dialog_show() which just shows the dialog without
	calling gtk_window_present().

	* app/gui/info-window.c
	* app/gui/view-commands.c
	* app/tools/gimptransformtool.c: changed accordingly.

	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: use info_dialog_show() so the dialog
	doesn't grab the focus away from the canvas. Fixes bug #132041.
2004-01-21 11:16:57 +00:00
Michael Natterer
1eee624d25 if there is a floating selection, anchor it before adding the text layer.
2004-01-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_create_layer): if there
	is a floating selection, anchor it before adding the text layer.
	Fixes bug #127451.

	Also fixed some issues with undo. Addresses, but does not fix
	bug #124969 and bug #130985.
2004-01-19 17:21:53 +00:00
Sven Neumann
6d506d51bb include "libgimpbase/gimpbase.h" where needed; removed now unnecessary
2004-01-19  Sven Neumann  <sven@gimp.org>

	* app/*/*.c: include "libgimpbase/gimpbase.h" where needed; removed
	now unnecessary inclusions of "file/file-utils.h".
2004-01-19 01:54:11 +00:00
Sven Neumann
a70698c4d9 removed file_utils_filename_to_utf8() ...
2004-01-19  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: removed file_utils_filename_to_utf8() ...

	* libgimpbase/gimputils.[ch]: ... and added it here as
	gimp_filename_to_utf8(). Added some docs that promise less than
	the current implementation holds so that we can change the
	implementation later.

	* app/*/*.c: use gimp_filename_to_utf8() where
	file_utils_filenames_to_utf8() has been used before.

	* libgimpbase/gimpbase.def: changed accordingly.

	* configure.in: reset GIMP_INTERFACE_AGE.
2004-01-19 01:08:43 +00:00
Sven Neumann
2eafd75021 code cleanup; draw in the expose_event handler only.
2004-01-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.[ch]: code cleanup; draw in the
	expose_event handler only.
2004-01-18 23:23:48 +00:00
Michael Natterer
65c83a6c57 use gimp_drawable_bytes_with_alpha().
2004-01-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpinktool.c (ink_set_paint_area): use
	gimp_drawable_bytes_with_alpha().
2004-01-18 20:37:41 +00:00
Sven Neumann
4a234e4421 do a proper fix for bug #131680.
2004-01-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c (crop_recalc): do a proper fix for bug
	#131680.
2004-01-16 16:13:56 +00:00
David Odin
04d7e139c4 bloc some signals before destroying the info dialog box, to prevent
* app/tools/gimpcroptool.c: bloc some signals before destroying the
info dialog box, to prevent accessing to freed memory fixes bug #131680
2004-01-16 15:09:52 +00:00
Michael Natterer
0af39061b6 Fixed bug #78732 (don't paste off screen):
2004-01-15  Michael Natterer  <mitch@gimp.org>

	Fixed bug #78732 (don't paste off screen):

	* app/display/gimpdisplayshell-transform.[ch]: added new function
	gimp_display_shell_untransform_viewport() which returns the
	visible rectangle of the image in image coordinates.

	* app/core/gimp-edit.[ch] (gimp_edit_paste): added viewport
	parameters and changed positioning of the pasted layer as follows:

	- if there is a selection, center on the selection (just as before).
	- if there is no viewport, center on the active drawable.
	- if the viewport intersects with the active drawable, center
	  on the intersection.
	- if the viewport does *not* intersect with the active drawable,
	  center on the active drawable (off-screen, but better than pasting
	  something that will be invisible due to floating selection clipping).
	- if there is no active drawable, center on the viewport.
	- if there is no active drawable and no viewport, center on the image.

	* app/widgets/gimpbufferview.c (gimp_buffer_view_paste_clicked)
	(gimp_buffer_view_paste_into_clicked)
	* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_buffer)
	* app/gui/edit-commands.c (edit_paste_cmd_callback)
	(edit_paste_into_cmd_callback): ask the shell for the viewport
	and pass it to gimp_edit_paste().

	* app/display/gimpdisplayshell-dnd.c
	(gimp_display_shell_drop_drawable): center the created layer on
	the viewport.

	* app/tools/gimpmovetool.c (gimp_move_tool_button_release): use
	gimp_display_shell_untransform_viewport() (its code was taken from
	here).

	* tools/pdbgen/pdb/edit.pdb: pass "no viewport" to gimp_edit_paste().

	* app/pdb/edit_cmds.c: regenerated.
2004-01-15 14:36:43 +00:00
Tor Lillqvist
18485018b3 Add new function file_utils_filename_to_utf8(), which is to be used when
2004-01-14  Tor Lillqvist  <tml@iki.fi>

	* app/file/file-utils.[ch]: Add new function
	file_utils_filename_to_utf8(), which is to be used when converting
	file names (which are kept in the on-disk encoding) to UTF-8 for
	passing to GTK, or to g_print() etc.

	* app/*/*.c: Call file_utils_filename_to_utf8(). Should fix most
	of the warnings generated by non-UTF8 pathnames. See #130118.

	* libgimpbase/gimpenv.b: Document that gimp_directory() etc return
	strings in the on-disk encoding.

	* libgimpmodule/gimpmodule.c: Convert filenames to UTF-8 (using
	g_filename_to_utf8()) before passing to g_print().
2004-01-14 02:03:37 +00:00
Michael Natterer
3bee156b6e Allow invoking the text tool by double clicking a text layer in the layers
2004-01-13  Michael Natterer  <mitch@gimp.org>

	Allow invoking the text tool by double clicking a text layer in
	the layers dialog, just like the path tool is invoked when double
	clicking a path.

	* app/tools/gimptexttool.[ch]: added empty
	gimp_text_tool_set_layer() stub. Sven, your turn...

	* app/gui/layers-commands.[ch]: added layers_text_tool() which
	invokes the text tool on text layers and falls back to
	layers_edit_layer_query() otherwise.
	Added layers_text_tool_cmd_callback() for the layers menu.

	* app/gui/layers-menu.c: added "Text Tool" menu item and hide
	it for layers which are no text layers.

	* app/gui/dialogs-constructors.c (dialogs_layer_list_view_new):
	use layers_text_tool() as "activate" function.
2004-01-13 19:08:16 +00:00
Michael Natterer
9eaace417f renamed gimp_histogram_nchannels() to gimp_histogram_n_channels().
2004-01-13  Michael Natterer  <mitch@gimp.org>

	* app/base/gimphistogram.[ch]: renamed gimp_histogram_nchannels()
	to gimp_histogram_n_channels().

	* app/core/gimpdrawable-histogram.c: removed silly double negation
	logic. Cleanup.

	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimphistogramview.c: adjust the GimpHistogramChannel
	for GRAYA images to make sure we pick alpha from the right slot.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: removed the same hack here and call
	gimp_histogram_view_set_channel() with the correct enum value.

	* tools/pdbgen/pdb/color.pdb (levels, curves, histogram): fiddle
	with enum values here too so GRAY* drawables produce the correct
	results.

	Fixed precondition checks and set "success" in a uniform way all
	over the place.

	Use gimp_drawable_calculate_histogram() instead of duplicating its
	code here.

	(started with a patch from Pedro Gimeno. Fixes bug #109078)

	* app/pdb/color_cmds.c: regenerated.
2004-01-13 11:51:45 +00:00
Michael Natterer
856c4eeedb Enabled/fixed moving of channels and layer masks (was something between
2004-01-12  Michael Natterer  <mitch@gimp.org>

	Enabled/fixed moving of channels and layer masks (was something
	between disabled and broken before).

	* app/tools/gimpeditselectiontool.h (enum EditType): added new
	values EDIT_CHANNEL_TRANSLATE and EDIT_LAYER_MASK_TRANSLATE.

	* app/tools/gimpmovetool.c (gimp_move_tool_button_press): look at
	the type of the active drawable and invoke GimpEditSelectionTool
	accordingly.

	(gimp_move_tool_cursor_update): don't show the "bad" cursor when
	the active drawable is a channel or layer mask.

	* app/tools/gimpeditselectiontool.c: changed/enabled moving of
	channels and layer masks to work similar to selection mask moving:

	- Show only the item's outline while moving and do the actual move
	  on button_release.
	- Fixed/generalized some code to cope with the fact that we move
	  the linked layers/vectors *while* moving but the moved channel
	  itself *after* moving.
	- Draw the channel's/mask's bounding box instead of its boundary
	  if the boundary is empty (if all its values are either below or
	  above HALF_WAY).
2004-01-12 14:13:24 +00:00
Michael Natterer
84458f5b95 removed GimpTool::cursor_update() implementation (which was there only to
2004-01-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c: removed GimpTool::cursor_update()
	implementation (which was there only to stop drawing the brush
	preview when the mouse leaves the canvas). Instead, look at
	shell->proximity in GimpTool::oper_update() and just don't start
	drawing the preview if proximity is FALSE.

	* app/display/gimpdisplay.c (gimp_display_delete): set
	gdisp->shell to NULL *before* gtk_widget_destroy()ing the shell so
	our tool callbacks don't dispatch stuff while the shell is in the
	middle of being destroyed.

	Both changes fix bug #129374, though the latter is the fix for the
	real problem.
2004-01-02 17:36:45 +00:00
Simon Budig
c1350d177a Fixed missing undo step when moving (components of) the path. Don't add an
2003-12-31  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: Fixed missing undo step when
	moving (components of) the path. Don't add an undo step when
	nothing changes.

	Also rephrased the help strings in the statusbar to be shorter
	and encourage the user to try shift. Fixes bug #124025.
2003-12-31 02:10:09 +00:00
Sven Neumann
d9ee8e8c30 fixed table packing.
2003-12-31  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_gui): fixed
	table packing.
2003-12-31 00:42:35 +00:00
Simon Budig
e95b38e66c Do not move anchors in edit mode.
2003-12-30  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Do not move anchors in edit mode.

	Fixes bug #124973.
2003-12-30 22:22:54 +00:00
Michael Natterer
2bfb425ce1 update the crop dialog in crop_recalc(), not in gimp_crop_tool_draw().
2003-12-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c: update the crop dialog in
	crop_recalc(), not in gimp_crop_tool_draw().
2003-12-19 21:03:22 +00:00
Simon Budig
7914b59223 Removed private statusbar gdisplay pointer. Now help texts are only shown
2003-12-19  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: Removed private statusbar
	gdisplay pointer. Now help texts are only shown on the gdisp
	of the tool. Fixes bug #128209
2003-12-19 19:23:37 +00:00
Michael Natterer
37a9a0838d restore the cap_style and join_style properties for the XOR GdkGC to the
2003-12-17  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpcanvas.c (gimp_canvas_gc_new): restore the
	cap_style and join_style properties for the XOR GdkGC to the
	values GimpDrawTool's GC used to have. Fixes the result of
	gdk_draw_segments().

	* app/tools/gimpfuzzyselecttool.c (gimp_fuzzy_select_tool_motion):
	CLAMP the threshold to its possible values when setting it in the
	selection options.

	(gimp_fuzzy_select_tool_button_release): restore the original
	threshold after selecting.
2003-12-17 12:59:06 +00:00
Hans Breuer
1baa2d4581 [ I've postponed my reservations against pangoft2/fontconfig/freetype2
2003-12-12  Hans Breuer  <hans@breuer.org>

	[
	 I've postponed my reservations against pangoft2/fontconfig/freetype2
	 usage, so The Gimp should now build with msvc without patching it.
	]

	* app/makefile.msc app/text/makefile.msc : use $(PANGOFT2_CFLAGS) etc.

	* libgimpthumb/makefile.msc : (new file)
	* makefile.msc : added libgimpthumb

	* libgimpthumb/gimpthumbnail.c : include gimpwin32-io.h
	* libgimpthumb/gimpthumb-utils.c : don't compare size pointer
	with GIMP_THUMB_SIZE_FAIL but *size

	* plug-ins/makefile.msc : handle libgimpoldpreview

	* plug-ins/common/decompose.c : define cbrt() if not __GLIBC__

	* plug-ins/common/winclipboard.c : make it compile without gimpcompat.h

	* plug-ins/imagemap/imagemap_csim_lex.c : its a generated file
	but still win32/msvc has no unistd.h

	* plug-ins/pygimp/makefile.msc : (new file) to use the binary you
	need to patch glib, see bug #98737

	* plug-ins/libgimpoldpreview.c : use <libgimp/gimp.h> instead of "gimp.h"

	* **/Makefile.am : added makefile.msc to EXTRA_DIST
2003-12-13 01:35:19 +00:00
Michael Natterer
2d8df2555f app/tools/gimpblendoptions.c (gimp_blend_options_gui)
2003-12-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpblendoptions.c (gimp_blend_options_gui)
	* app/tools/gimpcoloroptions.c (gimp_color_options_gui)
	* app/tools/gimpinkoptions.c (gimp_ink_options_gui): removed calls
	to gtk_frame_set_shadow_type (frame, GTK_SHADOW_ETCHED_IN) because
	that's the default anyway.
2003-12-12 11:41:08 +00:00
Michael Natterer
b59f5e9057 call gimp_color_options_new, not gimp_histogram_options_new.
2003-12-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcurvestool.c (gimp_curves_tool_register): call
	gimp_color_options_new, not gimp_histogram_options_new.
2003-12-12 10:53:41 +00:00
Sven Neumann
7478a4d12a use GimpHistogramOptions instead of GimpColorOptions and connect the
2003-12-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c: use GimpHistogramOptions instead of
	GimpColorOptions and connect the options to the histogram view.
2003-12-12 00:17:04 +00:00
Michael Natterer
a1c3265e09 added a hack that allows to render the histogram in a brighter color.
2003-12-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogramview.[ch]: added a hack that allows to
	render the histogram in a brighter color. Fixed initial range for
	views that are not selectable.

	* app/tools/gimpcurvestool.[ch]: replaced the GtkDrawingArea by a
	bright GimpHistogramView and render the curves tool controls on
	top of the histogram. Fixes bug #71633.
2003-12-11 23:35:17 +00:00
Michael Natterer
e72b406a5f applied (modified) patch from Ed Halley which adds "quintile marks". Fixes
2003-12-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphistogramview.[ch]: applied (modified) patch
	from Ed Halley which adds "quintile marks". Fixes bug #129050.
	Render the histogram on a base_gc background and use text_gc and
	text_aa_gc for rendering the histogram and the helper lines.
	Fixed rendering of the 1px border around the histogram. Removed
	separate drawing of baseline, left and right helper lines and draw
	a rectangle which marks the entire area of possible values. Fixed
	size_request calculation. Added missing getters. Cleanup.

	* app/tools/gimpcurvestool.c: use the same color scheme as the
	histogram.

	* app/tools/gimpcurvestool.c (curves_load,save_callback)
	* app/tools/gimplevelstool.c (levels_load,save_callback):
	gtk_window_present() the file dialog if it is already visible.
2003-12-11 13:57:03 +00:00
Sven Neumann
e5f0ed85e2 an XOR line was being drawn twice; spotted by Marco Munari.
2003-12-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c (gimp_crop_tool_draw): an XOR line was
	being drawn twice; spotted by Marco Munari.
2003-12-08 09:52:58 +00:00
Michael Natterer
cbfbc2b269 changed the range of the "lightness" parameter to [-100..+100], where -100
2003-11-18  Michael Natterer  <mitch@gimp.org>

	* app/base/colorize.[ch]: changed the range of the "lightness"
	parameter to [-100..+100], where -100 results in pure black and
	+100 in pure white. Default to lightness == 0 so the initial
	transform changes just the colors while keeping the original
	lightness.

	* app/tools/gimpcolorizetool.[ch]: changed accordingly. Reordered
	the scales to be in HSL order.
2003-11-18 16:06:47 +00:00
Michael Natterer
56863fac49 support '|'-separated lists of dialog identifiers and raise any of them if
2003-11-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]
	(gimp_dialog_factory_dialog_raise): support '|'-separated lists of
	dialog identifiers and raise any of them if it is already open, or
	the first dialog in the list otherwise.

	* app/gui/dialogs-commands.c (dialogs_create_dockable_cmd_callback):
	removed the same functionality here.

	* app/gui/edit-commands.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimptoolbox-indicator-area.c: pass lists of dialog
	identifiers to gimp_dialog_factory_dialog_raise().
2003-11-18 12:28:15 +00:00
Michael Natterer
976816a5f4 app/gui/file-dialog-utils.[ch] app/gui/file-open-dialog.c
2003-11-17  Michael Natterer  <mitch@gimp.org>

	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradients-commands.c
	* app/gui/vectors-commands.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimptexteditor.c
	* libgimpwidgets/gimpfileselection.c: don't access the "ok_button"
	and "cancel_button" members of GtkFileSelection. Instead, connect
	to GtkDialog::response(). Feels better and reduces code which
	depends on the to-be-deprecated GtkFileSelection. Changed border
	widths to match the 6px border width of other GIMP dialogs.
	File selections in plug-ins will follow...
2003-11-17 18:29:59 +00:00
Hans Breuer
b23682bf8e still unacceptable patched to compile without FT2, see bug #113681
2003-11-16  Hans Breuer  <hans@breuer.org>

	* app/text/*.c : still unacceptable patched to compile
	without FT2, see bug #113681

	* **makefile.msc : updated

	* app/config/gimpconfig-dump.c : include gimpwin32-io.h

	* app/plug-in/plug-ins.c : don't depend on g_print handling
	%s with NULL pointers, it doesn't anymore with glib cvs at
	least not on win32

	* app/widgets/gimppropwidgets.c
	  libgimpbase/gimputils.c
	  libgimpwidgets/gimpmemsizeentry.c :
	sorry about the mess, need to work-around a stupi not able
	to cast from guint64 to double

	* app/widgets/gimppropwidgets.c (gimp_prop_memsize_entry_new) :
	avoid 'overflow in floating-point constant arithmetic' by disabling
	an imho alays questionable g_return_val_if_fail() for _MSC_VER only

	* libgimpmodule/gimpmodule.def : sorted

	* libgimpwidgets/gimpfileselection.c : removed unused S_ISDIR
	definition

	* app/gui/themes.c : filenames in rc files need to be escaped
2003-11-16 21:20:14 +00:00
Michael Natterer
2ed4be61fe remove unused variables.
2003-11-16  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimprectselecttool.c
	(gimp_rect_select_tool_button_release): remove unused variables.
2003-11-16 20:13:42 +00:00
Daniel Rogers
cf5b620d5e app/tools/gimpellipseselecttool.c app/tools/gimprectselectool.c Includes
2003-11-15  Daniel Rogers  <daniel@phasevelocity.org>
        * app/tools/gimpellipseselecttool.c
        * app/tools/gimprectselectool.c
        * app/tools/gimprectselect.h: Includes changes from Sven.
        Fixes a bug with alt-draging ellipse and rect selections
        on small pixel areas.
2003-11-15 23:39:37 +00:00
Manish Singh
ee2bfb69b5 add gimp_int_option_menu_set_sensitive and
2003-11-14  Manish Singh  <yosh@gimp.org>

        * libgimpwidgets/gimpwidgets.[ch]: add
        gimp_int_option_menu_set_sensitive and gimp_int_radio_group_set_active,
        tweak docs.

        * app/gui/convert-dialog.c
        * app/gui/layers-commands.c
        * app/tools/gimpcolorbalancetool.c
        * app/tools/gimpcurvestool.c
        * app/tools/gimplevelstool.c
        * app/widgets/gimpcontainerpopup.c
        * app/widgets/gimphistogrameditor.c
        * app/widgets/gimppropwidgets.c
        * app/widgets/gimptemplateeditor.c
        * app/widgets/gimptexteditor.c: use them.
2003-11-14 23:17:38 +00:00
Simon Budig
832b51b5a8 Since GimpVectorTool is no GimpSelectionTool, it does not make sense to
2003-11-15  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectoroptions.[ch]: Since GimpVectorTool is no
	GimpSelectionTool, it does not make sense to have
	GimpSelectionOptions for it.

	* app/tools/gimpvectoroptions.c
	* app/tools/gimpvectortool.c: Connect the Buttons to the
	Help system and make the to-selection Button modifier
	aware.
2003-11-14 23:10:24 +00:00
Manish Singh
178c225318 add gimp_int_option_menu_set_history as a wrapper for
2003-11-14  Manish Singh  <yosh@gimp.org>

        * libgimpwidgets/gimpwidgets.[ch]: add gimp_int_option_menu_set_history
        as a wrapper for gimp_option_menu_set_history.

        * app/gui/brush-select.c
        * app/gui/resize-dialog.c
        * app/tools/gimpcurvestool.c
        * app/widgets/gimppropwidgets.c
        * app/widgets/gimplayertreeview.c
        * app/widgets/gimpcolorframe.c
        * libgimpwidgets/gimpmemsizeentry.c
        * modules/cdisplay_colorblind.c: use the above.
2003-11-14 19:02:24 +00:00
Michael Natterer
6eb772946b libgimpwidgets/gimpquerybox.c configure the labels in the message dialog
2003-11-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpquerybox.c
	* app/widgets/gimpwidgets-utils.c: configure the labels in the
	message dialog and the query boxes to do automatic word wrapping
	to be HIG compliant.

	* app/app_procs.c
	* app/batch.c
	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-path.c
	* app/config/gimpconfig-utils.c
	* app/config/gimpconfigwriter.c
	* app/config/gimpscanner.c
	* app/core/gimpbrush.c
	* app/core/gimpbrushgenerated.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpdatafactory.c
	* app/core/gimpgradient.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimppalette.c
	* app/core/gimppattern.c
	* app/core/gimpselection.c
	* app/display/gimpdisplayshell.c
	* app/file/file-utils.c
	* app/gui/brush-select.c
	* app/gui/dialogs-commands.c
	* app/gui/drawable-commands.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/font-select.c
	* app/gui/gradient-select.c
	* app/gui/gui.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/palette-select.c
	* app/gui/palettes-commands.c
	* app/gui/pattern-select.c
	* app/gui/preferences-dialog.c
	* app/gui/select-commands.c
	* app/gui/stroke-dialog.c
	* app/gui/tool-options-menu.c
	* app/gui/vectors-commands.c
	* app/gui/view-commands.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins.c
	* app/text/gimptextlayer-xcf.c
	* app/text/gimptextlayer.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimptransformtool.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimphelp.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimptooloptionseditor.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/image.pdb: removed explicit newlines from
	messages. Reduced number of translatable strings by making many
	file error messages the same. Quote single words and filenames
	with 'foo', not "foo". Replaced some more "drawable" by "layer".
	General message cleanup and consistency check.

	* app/pdb/image_cmds.c: regenerated.
2003-11-14 15:33:40 +00:00
Simon Budig
31a72d1bd3 Add two buttons to the Tool Options
2003-11-14 Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectoroptions.c: Add two buttons to the
	Tool Options

	* app/tools/gimpvectortool.c: Use them for stroking a path
	and converting a path to a selection, to make this functionality
	more obvious.
2003-11-14 03:01:52 +00:00
Michael Natterer
1d2c795f2b when trying to activate the previously selected layer after a layer
2003-11-13  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo-push.c (undo_pop_layer): when trying to
	activate the previously selected layer after a layer removal, also
	look at gimage->layer_stack, just as gimp_image_remove_layer()
	does. Should fix regression from 1.2 when there was no avtive
	layer after certain undo operations. Fixes bug #126781.
	Reordered instructions to match gimp_image_remove_layer().

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: although the crash triggering bug
	is fixed, the image_map tools should not crash when invoked
	without active drawable: changed all _initialize() functions to
	silently return if there is no active drawable.

	Changed "drawable" to "layer" in all user visible warnings about
	indexed or non-RGB drawables. Cleanup.
2003-11-13 11:23:01 +00:00
Michael Natterer
78bf44ddb6 update shell->popup_factory only if this is the active display or we will
2003-11-11  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-appearance.c: update
	shell->popup_factory only if this is the active display or we will
	change another display's options when creating a new display.
	Fixes bug #126668.

	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/view-commands.c
	* app/tools/gimpimagemaptool.c: do the same here. Can't really
	happen in these places but it's more correct to have the check
	for the active display.

	* app/display/gimpdisplay.c (gimp_display_flush_whenever): get the
	active display from the user_context, not the current_context.

	* app/gui/image-menu.c (image_menu_update): removed unused code.
2003-11-11 13:09:50 +00:00
Dave Neary
fdd9497989 Removed some code I'd added earlier and forgot to take out again.
2003-11-10  Dave Neary  <bolsh@gimp.org>

        * app/tools/gimpimagemaptool.c: Removed some code I'd added
        earlier and forgot to take out again.
2003-11-10 20:53:03 +00:00
Sven Neumann
058764f4ba app/display/gimpcanvas.[ch] moved GC from the the draw tool to GimpCanvas.
2003-11-10  Sven Neumann  <sven@gimp.org>

	* app/display/gimpcanvas.[ch]
	* app/tools/gimpdrawtool.[ch]: moved GC from the the draw tool to
	GimpCanvas. Added wrappers around GDK drawing functions and do all
	canvas drawing by means of these new functions.

	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpfuzzyselecttool.c: draw using the new GimpCanvas
	functions.
2003-11-10 19:35:56 +00:00
Dave Neary
efea57638f Moved assignment of shell to the place where it will be used, preventing a
2003-11-10  Dave Neary  <bolsh@gimp.org>

        * app/tools/gimpimagemaptool.c: Moved assignment of shell to
        the place where it will be used, preventing a null pointer
        dereference when it's not used. Fixes bug #126524.
2003-11-10 19:30:32 +00:00
Michael Natterer
b62f8e9a75 To be multihead safe, each new window or menu needs to be associated with
2003-11-08  Michael Natterer  <mitch@gimp.org>

	To be multihead safe, each new window or menu needs to be
	associated with a GdkScreen or it will pop up on the default
	screen.

	* libgimpwidgets/gimpquerybox.[ch]
	* app/display/gimpdisplayshell-layer-select.[ch]
	* app/widgets/widgets-types.h
	* app/widgets/gimpitemfactory.[ch]
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimptemplateview.[ch]
	* app/widgets/gimptooldialog.[ch]
	* app/widgets/gimpviewabledialog.[ch]
	* app/gui/channels-commands.[ch]
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/edit-commands.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/image-commands.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/layers-commands.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/templates-commands.[ch]
	* app/gui/vectors-commands.[ch]: added "GtkWidget *parent"
	paramaters to all functions which create menus, popups or windows
	and pass "parent" to gimp_dialog_new() or one of the various
	wrappers around it. As a side effect, this fixes bug #61092.

	* app/widgets/gimpdialogfactory.[ch]: added "GdkScreen *screen"
	instead of "parent" here since there are no possible parent
	windows on startup.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_origin_button_press): added a quick hack to
	send a display to another screen: click the origin button with the
	middle mouse button.

	* app/display/gimpdisplayshell.c
	(gimp_display_shell_screen_changed): don't chain up
	undonditionally (don't crash).

	* libgimpwidgets/gimpdialog.c (gimp_dialog_new_valist): set the
	dialog's screen from a non-GtkWidget parent widget. The rest of
	non-window parent widget handling is still unimplemented.

	* libgimpwidgets/gimpcolorbutton.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimppreview-popup.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpsessioninfo.c
	* app/widgets/gimptoolbox-color-area.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c
	* app/widgets/gimpwidgets-utils.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpnavigationview.c
	* app/gui/module-browser.c
	* app/gui/dialogs-commands.c
	* app/gui/dialogs-constructors.c
	* app/gui/drawable-commands.c
	* app/gui/file-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor-commands.c
	* app/gui/gui-vtable.c
	* app/gui/gui.c
	* app/gui/info-window.c
	* app/gui/palette-import-dialog.c
	* app/gui/palettes-commands.c
	* app/gui/qmask-commands.c
	* app/gui/select-commands.c
	* app/gui/tool-options-commands.c
	* app/gui/view-commands.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c
	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gflare/gflare.c: changed accordingly. Changed all
	menu_position funcs to place the menu on the right screen.
2003-11-08 15:32:38 +00:00
Michael Natterer
efd9a3e14a added "wm_name", "wm_class", "display_name" and "monitor_number" to the
2003-11-07  Michael Natterer  <mitch@gimp.org>

	* libgimpbase/gimpprotocol.[ch]: added "wm_name", "wm_class",
	"display_name" and "monitor_number" to the GPConfig message.
	Increased protocol version number.

	* libgimp/gimp.[ch] (gimp_config): read them from the GPConfig
	message and remember them.
	Added public accessors for the new config values.

	* libgimp/gimpui.c (gimp_ui_init): pass wm_name and wm_class to
	gtk_init() and export the display/screen to use to the
	environment.

	* app/core/gimp.[ch]: added vtable entries to get the values
	from the GUI.

	* app/gui/gui-vtable.c: implement the vtable entries.

	* app/plug-in/plug-in-run.c: fill in the GPConfig values using
	the new Gimp vtable functions.

	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpdisplayshell.c
	* app/gui/about-dialog.c
	* app/gui/channels-commands.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor-commands.c
	* app/gui/gradients-commands.c
	* app/gui/grid-dialog.c
	* app/gui/image-commands.c
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.c
	* app/gui/layers-commands.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-import-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/resize-dialog.c
	* app/gui/splash.c
	* app/gui/stroke-dialog.c
	* app/gui/templates-commands.c
	* app/gui/tips-dialog.c
	* app/gui/vectors-commands.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpdock.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.[ch]
	* libgimpwidgets/gimpfileselection.c
	* libgimpwidgets/gimpquerybox.c
	* libgimpwidgets/gimpunitmenu.c
	* plug-ins/helpbrowser/dialog.c
	* plug-ins/ifscompose/ifscompose.c: replaced all calls to
	gtk_window_set_wmclass() by gtk_window_set_role() and all
	"const gchar *wmclass_name" parameters by "const gchar *role".
	Cleaned up the window role strings.
2003-11-07 17:29:02 +00:00
Michael Natterer
66c5dd8772 removed our own action_area API and use GtkDialog's one. Create all
2003-11-06  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpdialog.[ch]: removed our own action_area API
	and use GtkDialog's one. Create all dialogs without separator.
	Changed almost everything else too. Fixes bug #125143.

	* libgimpwidgets/gimpquerybox.c
	* libgimpwidgets/gimpunitmenu.c: changed accordingly.

	* libgimp/gimpexport.[ch]: ditto. Renamed enum GimpExportReturnType
	to GimpExportReturn.

	* libgimp/gimpcompat.h: added a #define for the old name.

	* themes/Default/gtkrc: increased action_area border to 6 pixels.

	* app/display/gimpdisplayshell-filter-dialog.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpprogress.c
	* app/gui/brush-select.c
	* app/gui/channels-commands.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/gui/file-new-dialog.c
	* app/gui/font-select.c
	* app/gui/gradient-editor-commands.c
	* app/gui/gradient-select.c
	* app/gui/grid-dialog.c
	* app/gui/image-commands.c
	* app/gui/info-window.c
	* app/gui/layers-commands.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-import-dialog.c
	* app/gui/palette-select.c
	* app/gui/pattern-select.c
	* app/gui/preferences-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/resize-dialog.c
	* app/gui/resolution-calibrate-dialog.c
	* app/gui/stroke-dialog.c
	* app/gui/templates-commands.c
	* app/gui/user-install-dialog.c
	* app/gui/vectors-commands.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptooldialog.[ch]
	* app/widgets/gimpviewabledialog.[ch]
	* app/widgets/gimpwidgets-utils.c: changed accordingly and increased
	the dialogs' outer borders to 6 pixels all over the place.

	* plug-ins/*/*.c: changed accordingly. The plug-ins may be
	arbitrarily broken, I tested none of them.
2003-11-06 15:27:05 +00:00
Sven Neumann
0c68062afe use GTK_STOCK_SELECT_FONT stock icon instead of text tool icon.
2003-11-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_gui): use
	GTK_STOCK_SELECT_FONT stock icon instead of text tool icon.

	* app/text/gimpfont.c: fixed default stock id.

	* app/text/gimp-fonts.c (gimp_fonts_load): don't leave gimp busy
	and the fonts container frozen in case of error.
2003-11-05 01:07:56 +00:00
Sven Neumann
ec22027964 register a log handler for the Gimp-Text domain.
2003-11-05  Sven Neumann  <sven@gimp.org>

	* app/app_procs.c: register a log handler for the Gimp-Text domain.

	* app/text/gimpfont.c: code cosmetics.

	* app/text/gimptext-compat.c: removed debugging output.

	Let GIMP work w/o any fonts. Of course you won't get any text
	functionality then:

	* app/text/gimpfontlist.c: don't install any font aliases if no
	fonts were found.

	* app/text/gimptextlayer.c: refuse to render any text layers when
	the GIMP fonts list is empty.

	* app/tools/gimptexttool.c: removed redundant includes.

	* app/tools/gimptextoptions.c: removed the font selection widget.
	This is a temporary regression that will be cured by improving the
	GimpFontView widget.

	* app/widgets/Makefile.am
	* app/widgets/gimpfontselection-dialog.[ch]
	* app/widgets/gimpfontselection.[ch]
	* app/widgets/gimppropwidgets.[ch]: removed the font selection and
	all references to it. Fixes bug #119267.
2003-11-04 23:59:58 +00:00
Sven Neumann
c40a8121bc added a GdkDisplay parameter and added the convenience function
2003-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcursor.[ch] (gimp_cursor_new): added a
	GdkDisplay parameter and added the convenience function
	gimp_cursor_set().

	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimpcurvestool.c
	* app/widgets/gimpdialogfactory.c: changed accordingly.
2003-11-01 20:53:18 +00:00
Sven Neumann
fb6bd70031 removed width and height from the API. It can be set using
2003-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogramview.[ch]: removed width and height
	from the API. It can be set using gtk_widget_size_request(). Set a
	mimimum height of 80 pixels.

	* app/widgets/gimphistogrambox.c: changed accordinly. Reduced size
	of color gradient.

	* app/tools/gimpcurvestool.c: reduced gradient sizes.

	* app/tools/gimplevelstool.c: allow the histogram to expand
	vertically.
2003-11-01 17:39:09 +00:00
Sven Neumann
dcf50dc2a9 Replaced the histogram tool by a histogram dialog:
2003-11-01  Sven Neumann  <sven@gimp.org>

	Replaced the histogram tool by a histogram dialog:

	* themes/Default/images/Makefile.am
	* themes/Default/images/tools/stock-tool-histogram-[16|22].png:
	removed here ...

	* themes/Default/images/stock-histogram-[16|22].png: ,,, and added
	under these new names.

	* libgimpwidgets/gimpstock.[ch]: register the icons as
	GIMP_STOCK_HISTOGRAM and removed the histogram tool stock icons.

	* app/base/gimphistogram.c: don't crash when uncalculated values
	are requested from a GimpHistogram. Allow to reset the histogram
	by calling gimp_histogram_calculate() with a NULL region.

	* app/widgets/gimphistogrambox.[ch]: renamed the GimpHistogramView
	struct member to "view".

	* app/tools/gimpthresholdtool.c: changed accordingly.

	* app/widgets/gimphistogramview.[ch] (gimp_histogram_view_events):
	return TRUE when events were handled.

	* app/tools/Makefile.am
	* app/tools/gimp-tools.c
	* app/tools/gimphistogramtool.[ch]: removed the histogram tool.

	* app/widgets/Makefile.am
	* app/widgets/gimphelp-ids.h
	* app/widgets/widgets-types.h
	* app/widgets/gimphistogrameditor.[ch]: added GimpHistogramEditor.
	Has some rough edges still...

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c
	* app/gui/image-menu.c: register the new dialog instead of the
	histogram tool.
2003-11-01 02:39:34 +00:00
Michael Natterer
e9bab397de some cleanup.
2003-10-31  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c: some cleanup.

	(gimp_move_tool_button_press): removed #if 0'ed experimental cruft
	and the #warning about it.
2003-10-31 11:51:47 +00:00
Michael Natterer
2edd422a35 should actually call gimp_item_flip() on the path to transform. Fixes bug
2003-10-31  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpfliptool.c (gimp_flip_tool_transform): should
	actually call gimp_item_flip() on the path to transform.
	Fixes bug #125895.

	* app/tools/gimptransformtool.c (gimp_transform_tool_notify_type):
	if the transform tool is in the CREATING state, don't skip the
	whole callback but still copy the transform type and direction
	from the options to the tool. Fixes preview of transformed paths.
2003-10-31 09:38:04 +00:00
Michael Natterer
b0fd43dd45 made Dodge/Burn the last paint tool, so Convolve and Smudge are together.
2003-10-30  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_init): made Dodge/Burn the
	last paint tool, so Convolve and Smudge are together.
2003-10-30 17:55:03 +00:00
Sven Neumann
d4b49c0c38 added a missing GimpHistogramChannel parameter. Fixes wrong values in the
2003-10-30  Sven Neumann  <sven@gimp.org>

	* app/base/gimphistogram.[ch] (gimp_histogram_get_count): added a
	missing GimpHistogramChannel parameter. Fixes wrong values in the
	histogram tool.

	* app/base/levels.c
	* app/base/lut-funcs.c
	* app/pdb/color_cmds.c
	* tools/pdbgen/pdb/color.pdb: changed accordingly.

	* app/tools/gimphistogramtool.c: update the histogram statistics
	on channel changes.
2003-10-30 17:48:16 +00:00
Sven Neumann
c590c6aa15 app/display/gimpdisplayshell-callbacks.c
2003-10-28  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimphistogramview.c
	* app/widgets/gimpnavigationpreview.c
	* libgimpwidgets/gimpcolorselect.c
	* libgimpwidgets/gimpoffsetarea.c
	* libgimpwidgets/gimppickbutton.c: use multihead safe variants of
	the unsafe functions gdk_pointer_ungrab(), gdk_keyboard_ungrab()
	and gdk_device_get_core_pointer().

	* plug-ins/libgck/gck/gck.h
	* plug-ins/libgck/gck/gckcolor.c: made libgck multi-head safe.

	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/MapObject/mapobject_preview.c
	* plug-ins/MapObject/mapobject_ui.c: changed accordingly.

	* plug-ins/common/animationplay.c
	* plug-ins/common/curve_bend.c
	* plug-ins/gfig/gfig.c
	* plug-ins/imagemap/imap_preview.c: use multihead safe GDK API.
2003-10-29 20:57:21 +00:00
Michael Natterer
0df20a05f4 call tool_manager_oper_active_update() also on GDK_ENTER_NOTIFY,
2003-10-29  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_tool_events): call
	tool_manager_oper_active_update() also on GDK_ENTER_NOTIFY,
	GDK_LEAVE_NOTIFY, GDK_PROXIMITY_IN and GDK_PROXIMITY_OUT so the
	active tool's state is updated when the current device
	enters/leaves the canvas area.

	* app/tools/gimpmovetool.[ch]: added GimpTool::oper_update() and
	prelight the guide which will be moved there. Prelight the guide
	only while the while the cursor is in the guide's sensitive area,
	not until another guide is selected.
	Feels better and fixes bug #125474.

	Removed "guide_disp" member from the GimpMoveTool because
	GipmTool::oper_update() is called reliably now and we don't need
	to worry about guide prelighting across different displays any
	more.

	(gimp_move_tool_cursor_update): removed guide prelighting code,
	cleaned up and simplified.

	(gimp_move_tool_button_press): never activate the tool after
	calling init_edit_selection(). Fixes more tool control warnings.

	* app/display/gimpdisplay-foreach.[ch]: removed
	gdisplays_check_valid().
2003-10-29 15:03:56 +00:00
Sven Neumann
c0ebe2a8a3 app/text/Makefile.am new files that load and save text layers to/from XCF.
2003-10-27  Sven Neumann  <sven@gimp.org>

	* app/text/Makefile.am
	* app/text/gimptextlayer-xcf.[ch]: new files that load and save
	text layers to/from XCF.

	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* app/text/gimptextlayer.c: removed that code here and use the new
	functions instead.

	* app/text/gimptext-parasite.[ch] (gimp_text_from_parasite): added
	a GError parameter.

	* app/text/gimptextlayer.[ch]: store the name of the parasite that
	the text layer was created from (if read from XCF). Remove the
	parasite when the text layer is edited. If a text layer wasn't
	touched, the original parasite is written back to the XCF file.

	* app/text/gimptextlayout.c (gimp_text_layout_new): handle a NULL
	text string.

	* app/tools/gimptextoptions.c: implement GimpToolOptions::reset
	and save the text across a reset.
2003-10-27 21:50:41 +00:00
Sven Neumann
d533104de7 handle negative float and double values similar to how this is done for
2003-10-26  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-deserialize.c
	(gimp_config_deserialize_fundamental): handle negative float and
	double values similar to how this is done for integers and the
	like.

	* app/config/gimpconfig-params.h: added two new param flags and
	documented all flags in the header file (for now).

	* app/config/gimpconfig-serialize.h: handle the new param flags
	GIMP_PARAM_DEFAULTS and GIMP_PARAM_IGNORE.

	* app/text/text-enums.[ch]
	* app/text/gimptext.[ch]: added some properties that we will need
	sooner or later. Mark the new properties and a lot of the existing
	ones as GIMP_PARAM_DEFAULTS so that their values are not
	serialized unless changed from the default value.

	* app/text/gimptextlayout.c
	* app/tools/gimptextoptions.c: made all length properties in
	GimpText depend on a single unit.
2003-10-26 00:03:16 +00:00
Sven Neumann
190a68b917 added GIMP_COLOR_PICK_MODE_NONE to the GimpColorPickMode enum.
2003-10-25  Sven Neumann  <sven@gimp.org>

	* app/tools/tools-enums.[ch]: added GIMP_COLOR_PICK_MODE_NONE to
	the GimpColorPickMode enum.

	* app/tools/gimpcolorpickeroptions.[ch]: removed "update-toolbox"
	property; the new enum value serves this role better.

	* app/tools/gimpcolorpickertool.c: handle the new enum value.

	* app/tools/gimpcolortool.c: default to GIMP_COLOR_PICK_MODE_NONE.
	Don't set a cursor modifier for this value. Fixes tool cursor for
	levels and curves tools.

	* app/tools/gimppainttool.[ch]: added a function to conveniently
	enable the color picker and set the pick mode at the same time.

	* app/tools/gimpairbrushtool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c: use the new function.

	* app/tools/gimperasertool.c: enabled color picking in the eraser
	tool but set the mode to GIMP_COLOR_PICK_MODE_BACKGROUND.
2003-10-25 19:00:49 +00:00
Sven Neumann
f7db733ee2 make it a two-way connection and added a property_name parameter so it can
2003-10-25  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-utils.[ch] (gimp_config_connect): make it
	a two-way connection and added a property_name parameter so it
	can be used to connect only a certain property.

	* app/tools/gimptexttool.c: changed accordingly.

	* app/tools/gimphistogramoptions.c: use gimp_config_connect().
	Changed the default histogram scale to linear.
2003-10-25 17:25:34 +00:00
Sven Neumann
6c44628a4b app/tools/Makefile.am new tool options class GimpHistogramOptions, derived
2003-10-24  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimphistogramoptions.[ch]: new tool options class
	GimpHistogramOptions, derived from GimpColorOptions.

	* app/tools/gimpcoloroptions.c (gimp_color_options_gui): add
	gimp_histogram_options_gui() when called with GimpHistogramOptions.
	This a bit weird since the class hierarchy is the other way around
	but it makes things easier.

	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c: use GimpHistogramOptions and
	connect the histogram views to the "histogram-scale" property.
	Perhaps not perfect GUI-wise but it let's you choose the histogram
	scale and stores this setting per tool. Fixes bug #125306.

	* app/widgets/gimphistogramview.c: prefixed property names with
	"histogram-" so they match the GimpHistogramOptions property.

	* app/widgets/gimphistogrambox.c: minor cleanup.
2003-10-24 08:12:21 +00:00
Sven Neumann
f299ada6e3 themes/Default/images/Makefile.am
2003-10-24  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-histogram-linear-16.png
	* themes/Default/images/stock-histogram-logarithmic-16.png:
	added placeholders for new icons.

	* libgimpwidgets/gimpstock.[ch]: register the new icons.

	* app/tools/gimphistogramtool.c: made the dialog more compact by
	using a stock-box for the histogram scale.

	* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
	don't invert the histogram view if the full range is selected.

	* app/widgets/gimphistogrambox.c: moved the range widgets below
	the histogram.

	* app/config/gimpconfig-params.h: added macro
	GIMP_CONFIG_INSTALL_PROP_RESOLUTION() that installs a double
	property with the suitable range.

	* app/core/gimptemplate.c
	* app/config/gimpdisplayconfig.c: use it here.
2003-10-24 06:22:53 +00:00
Simon Budig
1f3702a575 Changed the priority of ALT vs. CTRL. Resolves an small issue with
2003-10-22 Simon Budig  <simon@gimp.org>

        * app/tools/gimpvectortool.c: Changed the priority
        of ALT vs. CTRL. Resolves an small issue with (broken)
        window managers that grab ALT. Implements the suggestion
        from Raymond Ostertag in bug #124971.
2003-10-22 20:55:45 +00:00
Sven Neumann
1758feb8f4 changed the default value for "sample_average" to TRUE (for Levels and
2003-10-21  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcoloroptions.c: changed the default value for
	"sample_average" to TRUE (for Levels and Curves tools).

	* app/tools/gimpcolorpickeroptions.c: override the default value
	for "sample_average" and set it back to FALSE (for Color Picker).
2003-10-21 12:45:58 +00:00
Sven Neumann
445d6bfc9f app/widgets/Makefile.am added a simple utility function
2003-10-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimptooldialog.[ch]: added a simple utility function
	gimp_tool_dialog_new() that creates a GimpVieawableDialog based on
	GimpToolInfo and registers it with the toplevel dialog factory.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimplevelstool.c
	* app/tools/gimpmeasuretool.c: use the new functionality; removed
	the shell_identifier since it can be created from the tool name.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.[ch]: removed the shell_identifier
	here as well. Should also be ported to gimp_tool_dialog_new().

	* NEWS: removed stuff that isn't new at all.
2003-10-20 21:27:34 +00:00
Sven Neumann
69be56bd80 don't use InfoDialog; always display pixels and real-world units in the
2003-10-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmeasuretool.[ch]: don't use InfoDialog; always
	display pixels and real-world units in the info window.
2003-10-20 17:36:18 +00:00
Sven Neumann
fb448d8004 app/tools/gimpcropoptions.c revert back to "Current".
2003-10-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcropoptions.c
	* app/tools/gimpmoveoptions.c: revert back to "Current".

	* app/tools/tools-enums.[ch]: removed "Active" from the enum value
	descriptions; it was misleading.
2003-10-19 16:04:01 +00:00
Sven Neumann
28e1ecebfc attach the first radio button as object data to the returned frame.
2003-10-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_enum_radio_frame_new)
	(gimp_prop_boolean_radio_frame_new): attach the first radio button
	as object data to the returned frame.

	* app/tools/gimpmoveoptions.c: change labels and sensitivity of
	the Tool Toggle frame depending on the selected move-type.

	* app/tools/gimpcropoptions.c: use the term "Active Layer" instead
	of "Current Layer". Please object if you dislike this change.
2003-10-19 15:38:10 +00:00
Michael Natterer
ef3ecefd54 changed the "Anti Erase" toggle key from <control> to <alt> because
2003-10-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimperasertool.c (gimp_eraser_options_gui): changed
	the "Anti Erase" toggle key from <control> to <alt> because
	<shift> and <control> are used by straight_line mode and should
	behave consistently across all paint tools.
2003-10-18 17:27:11 +00:00
Michael Natterer
78b6153301 added gimp_container_freeze() / _thaw() around font list reloading.
2003-10-18  Michael Natterer  <mitch@gimp.org>

	* app/text/gimp-fonts.c (gimp_fonts_load): added
	gimp_container_freeze() / _thaw() around font list reloading.

	* app/tools/gimp-tools.c (gimp_tools_init): added missing
	gimp_container_freeze().

	* app/widgets/gimpcontainerview.c: connect to the container's
	"freeze" and "thaw" signals and empty / refill the view
	accordingly. Ignore "add", "remove" and "reorder" signals while
	the container is frozen. Fixes font list sorting after refresh and
	speeds up refreshing of fonts, brushes, patterns etc.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfontview.[ch]: new widget for the font list/grid.

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_FONT_REFRESH.

	* app/gui/dialogs-constructors.c: changed accordingly.

	* app/gui/Makefile.am
	* app/gui/fonts-commands.[ch]
	* app/gui/fonts-menu.[ch]: new files: a menu for the font view.

	* app/gui/menus.c (menus_init): register the new <Fonts> menu.

	* app/gui/preferences-dialog.c (prefs_dialog_new): removed the
	fonts refreshing hack from the "Environment" page.
2003-10-18 16:23:15 +00:00
Dave Neary
fb471dabe0 app/base/color-balance.c app/base/hue-saturation.c
2003-10-16  Dave Neary  <bolsh@gimp.org>

        * app/base/color-balance.c
        * app/base/hue-saturation.c
        * app/composite/gimp-composite-generic.c
        * app/paint-funcs/paint-funcs-generic.h
        * app/tools/gimphuesaturationtool.c
        * libgimpcolor/gimpcolorspace.[ch]: Changed all occurrences of
        gimp_rgb_to_hls_int and gimp_hls_to_rgb_int to
        gimp_rgb_to_hsl_int and gimp_hsl_to_rgb_int respectively. This
        closes bug #124661.
2003-10-16 19:17:08 +00:00
Michael Natterer
a351c16b1e changed labels of the "Tool Toggle" toggles to document that guides can't
2003-10-15  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmoveoptions.c (gimp_move_options_gui): changed
	labels of the "Tool Toggle" toggles to document that guides can't
	be moved in "Move Current Layer or Path" mode. Fixes bug #124693.
2003-10-15 20:49:15 +00:00
Michael Natterer
e78c87b228 new enum GimpColorFrameMode.
2003-10-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.[ch]: new enum GimpColorFrameMode.

	* app/widgets/Makefile.am
	* app/widgets/gimpcolorframe.[ch]: new widget GimpColorFrame which
	shows a picked color in an optionmenu-selectable color space.
	Helps getting rid in InfoDialog.

	* app/gui/info-window.c: use it for the "extended" page. Cleaned
	up that page a lot so it can be made dockable in the next step.

	* app/tools/gimpcolorpickertool.[ch]: use it here too. Don't use
	InfoDialog any more (and do not depend on gui/ any more).
2003-10-15 15:16:50 +00:00
Michael Natterer
e8508ded68 add the new context to gimp->context_list in gimp_context_constructor(),
2003-10-14  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.c: add the new context to gimp->context_list
	in gimp_context_constructor(), not in set_property(). Cleanup.

	* app/tools/gimptextoptions.c: added finalizer so we don't leak
	the options' GtkTextBuffer and GimpText objects. Cleanup.
2003-10-14 16:40:02 +00:00
Sven Neumann
737da42437 removed gimp_config_copy_properties() and added the more intelligent
2003-10-14  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-utils.[ch]: removed
	gimp_config_copy_properties() and added the more intelligent
	gimp_config_sync() instead.

	* app/config/Makefile.am
	* app/config/config-types.h
	* app/config/gimpcoreconfig.[ch]
	* app/config/gimprc-blurbs.h: replaced default image properties
	with a single GimpTemplate object property. Changed the
	set_property function to not replace aggregate objects but call
	gimp_config_sync() instead.

	* app/tools/gimptextoptions.c (gimp_text_options_set_property):
	same change here.

	* app/config/gimpconfig.[ch]: changed return value of
	gimp_config_duplicate() to gpointer to avoid some casts that only
	made the code harder to read.

	* app/widgets/gimptemplateeditor.[ch]: don't keep an internal copy
	here but edit the GimpTemplate passed when the editor was
	constructed.

	* app/gui/preferences-dialog.c: use a GimpTemplateEditor to allow
	editing of the default image paramaters.

	* app/config/gimprc.c
	* app/core/core-types.h
	* app/core/gimp.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-grid.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpimage.c
	* app/core/gimptemplate.[ch]
	* app/gui/file-new-dialog.c
	* app/gui/grid-dialog.c
	* app/gui/info-window.c
	* app/gui/resize-dialog.c
	* app/gui/templates-commands.[ch]
	* app/gui/tool-options-commands.c
	* app/text/gimptextlayer.c
	* app/text/gimptextlayer.c
	* app/tools/gimptexttool.c
	* app/widgets/gimptemplateview.c
	* app/xcf/xcf-load.c: changed accordingly.
2003-10-14 15:20:59 +00:00
Michael Natterer
b19deeb311 Refactored modifier handling of displays and tools. Hopefully finally
2003-10-14  Michael Natterer  <mitch@gimp.org>

	Refactored modifier handling of displays and tools. Hopefully
	finally fixes bug #124135.

	* app/tools/gimptool.[ch] (struct GimpTool): added private members
	"focus_display" and "modifier_state" so tools are aware of their
	modifier state.

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: removed all public modifier_key()
	API and added set_focus_display() and set_modifier_state()
	instead.

	* app/tools/tool_manager.c (tool_manager_select_tool)
	* app/display/gimpdisplay.c (gimp_display_delete): set the
	active_tool's focus_display to NULL.

	* app/display/gimpdisplayshell.[ch] (struct GimpDisplayShell):
	added almost the whole stuff that used to be static variables of
	gimp_display_shell_tool_events(). Cleaned up the struct a bit.

	* app/display/gimpdisplayshell-callbacks.c: removed utility
	function gimp_display_shell_update_tool_modifiers().

	(gimp_display_shell_tool_events):

	- Replaced all calls to gimp_display_shell_update_tool_modifiers()
	  and tool_manager_modifier_key_active() by
	  tool_manager_modifier_state_active().

	- Call tool_manager_focus_display_active() before setting the
	  tool's modifier_state. Set the tool's focus_display to NULL when
	  we get a focus_out event.

	- Don't grab/ungrab the keyboard twice when <space>-selecting the
	  move tool.

	- Removed most static variables and use the new members of
	  GimpDisplayShell. Don't remember any old modifier states since
	  GimpTool does that by itself now.
2003-10-14 11:14:28 +00:00
Sven Neumann
a88e11afb3 app/widgets/gimpdocked.[ch] renamed GimpDockedIface to
2003-10-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdocked.[ch]
	* app/widgets/widgets-types.h: renamed GimpDockedIface to
	GimpDockedInterface.

	* app/display/gimpnavigationview.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpimageeditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimptooloptionseditor.c: changed accordingly.

	* app/config/config-types.h
	* app/config/gimpconfig.[ch]
	* app/config/gimpconfig-deserialize.[ch]
	* app/config/gimpconfig-serialize.[ch]
	* app/config/gimpconfig-utils.[ch]: added a GimpConfig typedef and
	changed the GimpConfig API to take GimpConfig instead of GObject
	pointers.

	* app/config/gimpconfig-dump.c
	* app/config/gimprc.c
	* app/config/test-config.c
	* app/core/gimp-documents.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimp.[ch]
	* app/core/gimpcontainer.c
	* app/core/gimpcontext.c
	* app/core/gimpdocumentlist.c
	* app/core/gimpgrid.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage.c
	* app/core/gimpparasitelist.c
	* app/core/gimptemplate.c
	* app/core/gimptooloptions.c
	* app/core/gimpviewable.c
	* app/gui/grid-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/stroke-dialog.c
	* app/gui/templates-commands.c
	* app/gui/tool-options-commands.c
	* app/paint/gimppaintcore.c
	* app/pdb/gimprc_cmds.c
	* app/text/gimptext-parasite.c
	* app/text/gimptext.c
	* app/text/gimptextlayer.c
	* app/tools/gimp-tools.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptemplateview.c
	* tools/pdbgen/pdb/gimprc.pdb: changed accordingly.
2003-10-11 14:30:18 +00:00
Michael Natterer
da2bd8b91a added GimpScanConvert typedef.
2003-10-09  Michael Natterer  <mitch@gimp.org>

	* app/core/core-types.h: added GimpScanConvert typedef.

	* app/core/gimpscanconvert.h: removed it here.

	* app/core/gimpchannel-select.[ch]: factored out new
	function gimp_channel_select_scan_convert().

	(gimp_channel_select_polygon)
	(gimp_channel_select_vectors): use it.

	(gimp_channel_select_alpha): when called on a layer without alpha,
	don't fail but fake the effect of a fully opaque alpha channel.

	* app/tools/gimpiscissorstool.c: some cleanup.

	(iscissors_convert): fixed my latest cleanup (don't cast the
	tool to a GimpGrawable ;). Don't ignore options->antialias.
2003-10-09 11:30:49 +00:00
Michael Natterer
d734595991 create a channel which the size of the layer, not of the image...
2003-10-06  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpchannel.c (gimp_channel_new_from_alpha): create
	a channel which the size of the layer, not of the image...

	* app/core/gimpchannel-select.c (gimp_channel_select_alpha):
	...and take the layer's offsets into account.

	* app/core/gimpscanconvert.[ch] (gimp_scan_convert_render): added
	off_x and off_y parameters and don't use the passed TileManager's
	offsets.

	* app/core/gimpchannel-select.c
	* app/core/gimpdrawable-stroke.c
	* app/tools/gimpiscissorstool.c: changed accordingly.
2003-10-06 16:43:05 +00:00
Michael Natterer
a20e04bdaf added new virtual functions GimpDrawable::get_active_components(),
2003-10-06  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.[ch]: added new virtual functions
	GimpDrawable::get_active_components(), apply_region() and
	replace_region().

	* app/core/Makefile.am
	* app/core/gimpdrawable-combine.[ch]: new files containing
	apply_region()'s and replace_region()'s default implementation.
	They are identical to the ones removed from GimpImage except that
	they don't mask the selection with itself (bug #107949).

	* app/core/gimpchannel.c
	* app/core/gimplayer.c: implement get_active_components().

	* app/core/gimpchannel.c: implement apply_region() and
	replace_region() and invalidate the channel's boundary
	before upchaining (bug #107949).

	* app/core/gimpimage.[ch]: removed gimp_image_apply_image(),
	gimp_image_replace_image() and gimp_image_get_active_components().

	* app/core/gimpimage-undo-push.c (undo_pop_image): invalidate
	boundary and bounds if the drawable is a channel (bug #107949).

	(undo_pop_mask)
	(undo_pop_channel_mod): finish previous commit :)

	* app/core/gimp-edit.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-stroke.c
	* app/core/gimpimagemap.c
	* app/core/gimplayer-floating-sel.c
	* app/paint/gimppaintcore.c
	* app/tools/gimpinktool.c: changed accordingly.
2003-10-06 14:40:12 +00:00
Michael Natterer
f0372cad0f Treat changes to the selection like changes to any other drawable:
2003-10-06  Michael Natterer  <mitch@gimp.org>

	Treat changes to the selection like changes to any other drawable:

	* app/core/gimpchannel.c
	* app/core/gimpchannel-combine.c: call gimp_drawable_update() after
	changing the channel.

	* app/core/gimpimage.[ch]: added struct GimpImageFlushAccumulator
	with one member "gboolean mask_changed". Connect to "update" of
	the selection and set accum.mask_changed to TRUE in the callback.
	Added default implementation for GimpImage::flush() and emit
	"mask_changed" there.

	Unrelated:
	* app/core/gimpimage.h: removed GimpGuide struct...
	* app/core/gimpimage-guides.h: ...and added it here.

	* app/core/gimpimage-undo-push.c (undo_pop_mask)
	(undo_pop_channel_mod): don't distinguish between selection and
	non-selection channels and just call gimp_drawable_update().

	* app/core/gimpundo.h
	* app/core/gimpimage-undo.c: removed "gboolean mask_changed" from
	the GimpUndoAccumulator struct since we don't have to care about
	that signal explicitly any more.

	* app/display/gimpdisplay-foreach.[ch]: removed gimp_displays_flush().

	* tools/pdbgen/pdb/display.pdb (displays_flush_invoker): call
	gimp_image_flush() on all images so the flush accumulator is
	honored.

	This generalization enables the removal of more special purpose
	code which was needed to treat the selection different:

	* app/core/gimpimage-mask-select.[ch]: removed...

	* app/core/gimpchannel-select.[ch]: ...and added under a new name
	because it's not selection specific any more.

	* app/core/gimpimage-mask.[ch]: removed...

	* app/core/gimpselection.[ch]: ...added the two remaining
	functions here. Removed all calls to gimp_image_mask_changed().

	* app/core/Makefile.am
	* app/core/gimp-edit.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-snap.c
	* app/display/gimpdisplayshell.c
	* app/gui/channels-commands.c
	* app/gui/layers-commands.c
	* app/gui/select-commands.c
	* app/gui/vectors-commands.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpvectorstreeview.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/paths.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/selection_tools.pdb: changed accordingly.

	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpimage-colormap.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/gui/image-menu.c
	* app/paint/gimppaintcore.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpinkoptions.c
	* app/tools/gimpvectortool.c: removed useless and/or obsolete
	#includes.

	* app/pdb/display_cmds.c
	* app/pdb/paths_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/selection_tools_cmds.c: regenerated.
2003-10-06 12:17:11 +00:00
Michael Natterer
afc58a660c HALT the tool with the right display. Fixes some random tool crashes.
2003-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c (tool_manager_image_undo_start): HALT
	the tool with the right display. Fixes some random tool crashes.
2003-10-06 11:07:10 +00:00
Dave Neary
12bdbc33a6 Removed explicit initialisation to GIMP_ALL_HUES, this is set by default
2003-10-04  Dave Neary  <bolsh@gimp.org>

        * app/tools/gimphuesaturationtool.c
        (gimp_hue_saturation_tool_initialize): Removed explicit
        initialisation to GIMP_ALL_HUES, this is set by default the
        first time the tool is opened, and shouldn't be set successive
        times. Fix suggested by edg1@freegates.be in Bugzilla. Fixes
        bug #123731.
2003-10-04 13:45:31 +00:00
Sven Neumann
69f7bd131c app/core/Makefile.am added small wrappers to ease handling of image units
2003-10-01  Sven Neumann  <sven@gimp.org>

	* app/core/Makefile.am
	* app/core/gimpimage-unit.[ch]: added small wrappers to ease
	handling of image units and to hide the core GimpUnit API.

	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpstatusbar.c
	* app/gui/info-window.c:
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimpscaletool.c: use the new functions.

	* app/core/gimp-units.c
	* app/vectors/gimpvectors-export.c: use the core GimpUnit API.

	* app/vectors/gimpvectors.c: no need to include gimpunit.h here.
2003-10-01 17:32:14 +00:00
Michael Natterer
657b49b402 removed "width", "height" and "antialias" from the GimpScanConvert struct
2003-09-30  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpscanconvert.[ch]: removed "width", "height" and
	"antialias" from the GimpScanConvert struct and from
	gimp_scan_convert_new(). Removed gimp_scan_convert_to_channel().
	Added "gboolean antialias" to gimp_scan_convert_render().
	Some general cleanup.

	* app/core/gimpdrawable-stroke.c
	* app/core/gimpimage-mask-select.c
	* app/tools/gimpiscissorstool.c: changed accordingly.

	* app/core/gimpdrawable-stroke.c: renamed
	gimp_drawable_stroke_scanconvert_stroke() to
	gimp_drawable_stroke_scan_convert() and removed the "gboolean
	use_mask_bounds" parameter since we can't decide if it's the
	selection's boundary which is stroked. Instead use
	gimp_channel_is_empty() on the selection which will return FALSE
	while the selection is being stroked.

	* app/paint/gimppaintcore-stroke.c: cleanup.

	(gimp_paint_core_stroke_boundary): don't use "gint i" twice.

	(gimp_paint_core_stroke_vectors): no need to manually close a
	closed stroke.
2003-09-30 18:06:19 +00:00
Michael Natterer
d1ba870458 added a GimpContainer of tool options presets.
2003-09-29  Michael Natterer  <mitch@gimp.org>

	* app/core/gimptoolinfo.[ch]: added a GimpContainer of tool
	options presets.

	* app/core/gimptooloptions.[ch] (gimp_tool_options_set_property):
	silently accept setting the *same* tool_info again.

	(gimp_tool_options_build_filename): is public now.

	* app/tools/gimp-tools.c (gimp_tools_restore,save): load and save
	the presets container.

	* app/gui/tool-options-dialog.[ch]: removed.

	* app/gui/tool-options-commands.[ch]
	* app/gui/tool-options-menu.[ch]: new files implementing a menu
	for the new GimpToolOptionsEditor widget. Has submenus for saving,
	loading, and deleting tool options to/from the
	tool_info->options_presets container.

	* app/gui/Makefile.am
	* app/gui/dialogs-constructors.c
	* app/gui/menus.c: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimptooloptionseditor.[ch]: the tool options dialog
	as proper widget. The "Load" and "Save" buttons still do the same
	stuff as before. Will make them use the new presets since making
	them do something useful was the reason for this whole change.

	* app/widgets/gimphelp-ids.h: added missing help IDs for the tool
	options dialog.
2003-09-29 20:26:09 +00:00
Michael Natterer
2b57062c01 minor cleanups.
2003-09-29  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c: minor cleanups.

	(gimp_crop_tool_modifier_key): s/crop-type/crop-mode/. Fixes tool
	toggling which was broken after my GimpCropMode change.

	(crop_tool_crop_image): replaced parameter "gboolean crop_layers"
	by "GimpCropMode crop_mode". Makes its callers simpler and more
	readable.
2003-09-29 18:06:15 +00:00
Simon Budig
02f375b8d4 Made the preview respect the aspect ratio and resolutions of the image.
2003-09-29  Simon Budig  <simon@gimp.org>

	* app/widgets/gimppreviewrenderervectors.c: Made the preview
	respect the aspect ratio and resolutions of the image. There
	apparently still is an off-by-one error in it.

	* app/tools/gimpvectortool.c: (Hopefully) fixed a crash when a new
	image gets opened with the vectors tool active.
2003-09-29 16:35:30 +00:00
Simon Budig
eb489c44c4 Made these widgets show a preview of the vectors object. Does not work
2003-09-29  Simon Budig  <simon@gimp.org>

	* app/widgets/gimppreviewrenderervectors.c: Made these widgets
	show a preview of the vectors object. Does not work everywhere
	right now, also most probably has scaling issues for non-square
	images.

	* app/tools/gimpdrawtool.c: Fixed Svens fix.
2003-09-29 11:48:15 +00:00
Sven Neumann
30a4f72166 plugged memleaks and added some sanity checks.
2003-09-28  Sven Neumann  <sven@gimp.org>

	* app/core/gimpscanconvert.c (gimp_scan_convert_free)
	(gimp_scan_convert_finish): plugged memleaks and added some sanity
	checks.

	* app/base/pixel-region.c
	* app/core/gimpdrawable-preview.c: removed trailing whitespace.

	* app/tools/gimpdrawtool.c (gimp_draw_tool_on_vectors_curve):
	gimp_stroke_nearest_point_get() doesn't set cur_pos when there are
	no strokes; don't use the uninitialized variable.
2003-09-28 20:13:59 +00:00
Simon Budig
3f76868aee This still is very much in progress. I just want to commit this to avoid
2003-09-27  Simon Budig  <simon@gimp.org>

	This still is very much in progress. I just want to commit this
	to avoid lossage. It kind of works but there definitely is
	code in the wrong place now.

	* app/gui/stroke-dialog.[ch]: New files implementing a dialog
	containing Svens GimpStrokeEditor-Widget.

	* app/gui/Makefile.am: changed accordingly.

	* app/gui/vectors-commands.c: Open the StrokeOptions-Dialog when
	the "stroke" menu entry gets selected.

	* app/vectors/gimpvectors.c: Remove bad #ifdef hacks and use
	Libart/Paintcore-Stroking depending on the type of the stroke_desc
	Parameter.

	* app/core/gimpstrokeoptions.c: Proper handle the Enum-Properties.

	* app/core/gimpscanconvert.[ch]: make the antialias-parameter
	to gimp_scan_convert_new a gboolean.

	* app/tools/gimpiscissorstool.c
	* app/core/gimpdrawable-stroke.c
	* app/core/gimpimage-mask-select.c: Changed accordingly.
2003-09-27 02:34:18 +00:00
Michael Natterer
7d2c75940f don't scan "app/tools/tools-enums.h" for PDB types since the PDB doesn't
2003-09-26  Michael Natterer  <mitch@gimp.org>

	* tools/pdbgen/Makefile.am: don't scan "app/tools/tools-enums.h"
	for PDB types since the PDB doesn't depend on app/tools/ any more.

	* app/tools/tools-enums.h: removed lengthy "skip" vs. "pdb-skip"
	comment. Removed "pdb-skip" from all enums. Renamed GimpCropType
	to GimpCropMode, renamed the enum's values to GIMP_CROP_MODE_*.

	* app/tools/tools-enums.c: regenerated.

	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpcroptool.c: changed accordingly.
2003-09-26 16:20:05 +00:00
Michael Natterer
e13afaf260 Cleaned up all places which pick colors to work consistently: the concept
2003-09-26  Michael Natterer  <mitch@gimp.org>

	Cleaned up all places which pick colors to work consistently: the
	concept of an "active color" has disappeared, instead <ctrl> picks
	the BG color all over the place (fixes bug #122931).

	* app/tools/tools-enums.[ch]: added enum GimpColorPickMode which
	can be one of { FOREGROUND, BACKGROUND }. Reordered enums so
	non-registered ones are at the end of the file. Removed trailing
	whitespace.

	* app/tools/gimpcolorpickeroptions.[ch]: added a "pick-mode"
	property and a GUI for it. Renamed the "update-active" property to
	"update-toolbox".

	* app/tools/gimpcolorpickertool.c: honor the new option. Toggle
	pick-mode on <ctrl>.

	* app/tools/gimpcolortool.[ch]: added pick_mode member and change
	the cursor accordingly.

	* app/widgets/gimpcolormapeditor.[ch]: added "GdkModifierType
	state" to the "selected" signal. Removed the signal's default
	implementation.

	* app/gui/dialogs-constructors.c: fixed the signal handler which
	lives here and set BG if <ctrl> was pressed.

	* app/widgets/gimppaletteeditor.c: removed weird <ctrl> <->
	active_color interaction and pick BG on <ctrl>. Don't change the
	toolbox color when editing a color in the palette.

	* app/widgets/gimptoolbox-color-area.[ch]: made the whole
	active_color stuff private. Will remove these artefacts soon...

	* app/gui/colormap-editor-menu.c
	* app/gui/palette-editor-menu.c: added separate menu entries
	for adding a color from the current FG and BG.

	* app/gui/colormap-editor-commands.c
	* app/gui/palette-editor-commands.[ch]: changed callbacks
	accordingly.

	* cursors/background.xbm
	* cursors/background_mask.xbm
	* cursors/foreground.xbm
	* cursors/foreground_mask.xbm
	* cursors/gimp-tool-cursors.xcf: moved the FG/BG cursor modifiers
	closer to the upper right corner.

	* app/widgets/gimpcursor.c: ignore the cursor modifiers' hotspots
	since they are not relevant and I didn't save the hotspot in the
	updated cursor files for that reason.
2003-09-26 13:33:54 +00:00
Simon Budig
2c212214fe Fixed vectors stroking on GRAY* and INDEXED* layers.
2003-09-23  Simon Budig  <simon@gimp.org>

	* app/core/gimpdrawable-stroke.c: Fixed vectors stroking on
	GRAY* and INDEXED* layers.

	* app/tools/gimpvectortool.c: Made the polygonal mode more
	consistent.
2003-09-22 23:19:22 +00:00
Simon Budig
fa450f09b5 Previous commit got a broken pipe. 2003-09-21 19:09:56 +00:00
Michael Natterer
da6c31af1f moved the call to gimp_color_tool_enable() from GimpTool::initialize() to
2003-09-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcolorpickertool.c: moved the call to
	gimp_color_tool_enable() from GimpTool::initialize() to
	GObject::constructor() so the right cursor is shown before the
	first button_press. Fixes bug #122693.
2003-09-19 12:11:04 +00:00
Simon Budig
1ac86b5a90 Show a little help in the status bar. Maybe the functions I implemented to
2003-09-19  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: Show a little help in the
	status bar. Maybe the functions I implemented to track
	the status of the status bar should live in a parent class.
	Still behaves a little weird, but I need help to fix it and it
	does not crash, so I committed it anyway...  :-)
2003-09-18 23:58:37 +00:00
Simon Budig
66a49483a7 Renamed the modes of the vector tools: - Design (creative stuff: placing
2003-09-18  Simon Budig  <simon@gimp.org>

	* app/tools/tools-enums.h: Renamed the modes of the vector tools:
	    - Design  (creative stuff: placing of new anchors /
	                               moving anchors/segments)
	    - Edit    (technical stuff: inserting/deleting anchors/segments)
	    - Move    (moving strokes/vectors)

	Jimmac: These need icons...  :-)

	* app/tools/tools-enums.c: regenerated

	* app/tools/gimpvectoroptions.c
	* app/tools/gimpvectortool.c: changed accordingly.
2003-09-18 14:54:54 +00:00
Michael Natterer
6b2ca702ad app/paint/Makefile.am removed... ...and added.
2003-09-18  Michael Natterer  <mitch@gimp.org>

	* app/paint/Makefile.am
	* app/paint/paint.[ch]: removed...
	* app/paint/gimp-paint.[ch]: ...and added.

	* app/core/gimp.c: changed accordingly.

	* app/tools/Makefile.am
	* app/tools/tools.[ch]: removed...

	* app/tools/gimp-tools.[ch]: ...and added. Added
	gimp_tools_restore() and gimp_tools_save() and moved the entire
	tool registering and tool_options loading/saving code here. Call
	tool_manager_init() from gimp_tools_init() and tool_manager_exit()
	from gimp_tools_exit().

	* app/tools/tool_manager.[ch]: removed the code which now lives
	in gimp-tools.[ch]. The tool manager now has no knowledge about
	individual tools any more and just handles the active_tool
	and the tool part of tool <-> display interaction.
	Removed tool_manager_get_info_by_type().

	* app/tools/gimpvectortool.c (gimp_vector_tool_register): the
	tool's identifier is "gimp-vector-tool", not "gimp-path-tool".

	* app/app_procs.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/vectors-commands.c
	* app/tools/gimppainttool.c: changed accordingly.
2003-09-18 13:51:10 +00:00
Simon Budig
3b1c873724 app/vectors/gimpstroke.[ch] added the endpoint of the segment to the list
2003-09-18  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpbezierstroke.c: (gimp_stroke_nearest_point_get)
	added the endpoint of the segment to the list of returned values.

	* app/tools/gimpdrawtool.[ch]: (gimp_draw_tool_on_vectors_curve)
	return the endpoint also.

	* app/tools/gimpvectortool.[ch]: Use that to activate the
	to-be-changed anchors when dragging on the curve directly.

	* app/tools/gimpmovetool.[ch]: changed accordingly.
2003-09-18 13:20:40 +00:00
Simon Budig
90bf56c75b Cursor keys now move the currently active anchors, SHIFT and CTRL increase
2003-09-18  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Cursor keys now move the currently
	active anchors, SHIFT and CTRL increase the steps.

	* MAINTAINERS: Added myself in an attack of hubris...
2003-09-18 00:42:26 +00:00
Michael Natterer
b46c0f7f4d initialize undo_type to shut up the compiler.
2003-09-17  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_arrow_key): initialize undo_type to shut
	up the compiler.
2003-09-17 22:00:10 +00:00
Simon Budig
66cc2b98b5 app/vectors/gimpstroke.[ch] Changed gimp_*_anchor_select to accept the
2003-09-17  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpvectors.[ch]: Changed gimp_*_anchor_select to
	accept the selection state as an argument.

	* app/tools/gimpdrawtool.[ch]: Added "exclusive" boolean parameter
	to gimp_draw_tool_on_vectors_handle(), so that you can specify
	that you just get exactly the type of anchor you want to have.

	* app/tools/gimpvectortool.[ch]: Handling of multiple selected
	anchors: Shift-Clicking in Extend mode selects them, you can
	move them together.
2003-09-17 21:49:45 +00:00
Michael Natterer
776bc79292 moved the path tool after the selection tools.
2003-09-17  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools.c (tools_init): moved the path tool after the
	selection tools.
2003-09-17 21:34:43 +00:00
Simon Budig
12a4cc19bc smallish change to enable dragging out of handles again. It is now
2003-09-17  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: smallish change to enable
	dragging out of handles again. It is now dragging handles
	out of anchors, when click/dragging on them in Insert/Delete
	mode. Deletion of nodes now requires the SHIFT modifier.
2003-09-17 13:08:19 +00:00
Michael Natterer
2ce758b846 Added nomis' favorite feature ;)
2003-09-17  Michael Natterer  <mitch@gimp.org>

	Added nomis' favorite feature ;)

	* app/paint/gimppaintcore.[ch]: added gimp_paint_core_cancel()
	which can be called instead of gimp_paint_core_finish().
	It simply copies core->undo_tiles back to the drawable instead of
	pushing them to the undo stack.

	* app/tools/gimppainttool.c (gimp_paint_core_button_release): call
	_cancel() instead of _finish() if the right mouse button is
	pressed.
2003-09-17 12:05:11 +00:00
Michael Natterer
69e11c9af2 added "GimpVectorMode saved_mode" to the GimpVectorTool struct.
2003-09-17  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.[ch]: added "GimpVectorMode saved_mode"
	to the GimpVectorTool struct.

	(gimp_vector_tool_modifier_key): use it to correctly keep track of
	the modifier state.

	* app/tools/gimpselectiontool.c (gimp_selection_tool_modifier_key):
	moved variable to local scope.
2003-09-17 11:16:55 +00:00
Michael Natterer
f4942b7255 cursors/hand.xbm removed.
2003-09-17  Michael Natterer  <mitch@gimp.org>

	* cursors/hand.xbm
	* cursors/hand_mask.xbm: removed.

	* cursors/hand_small.xbm
	* cursors/hand_small_mask.xbm: ...and added under new names.

	* cursors/Makefile.am
	* cursors/gimp-tool-cursors.xcf: changed accordingly.

	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c: removed HAND from the GimpCursorModifier
	enum and added it to the GimpToolCursorType enum. We don't have a
	hand tool but this way the hand cursor (which is in the lower
	right corner) can be used together with other cursor modifiers
	(which are in the upper right corner).

	* app/tools/gimpmovetool.c
	* app/tools/gimpvectortool.c: show cursor modifers with the hand
	cursor where appropriate.
2003-09-17 10:42:26 +00:00
Simon Budig
a2f699f822 Ok, since the obsolete undo step is invalid the undo_event of the image
2003-09-17  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Ok, since the obsolete undo
	step is invalid the undo_event of the image probably should be
	GIMP_UNDO_EVENT_UNDO_EXPIRED. This fixes at least the undo
	history...
2003-09-17 00:20:42 +00:00
Simon Budig
790c11ec98 Restored Mitchs favourite feature :-) (now the cursor indicates if you
2003-09-17  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: Restored Mitchs favourite
	feature :-)  (now the cursor indicates if you hover over
	a vectors object when no other one is active...). Also added
	more descriptive Undo names and RMB-Cancel for the Vectors tool.

	Please note, that the RMB-Cancel is implemented using the Undo
	System. I do not really have a clue on that and so right now
	there is an oddity - the undo-object popped from the undo
	stack does not get removed from e.g. the Undo History Dialog.

	Someone with a clue please have a look at that...  :-)
2003-09-16 23:51:56 +00:00
Michael Natterer
94dddc1820 changed "gboolean move_mask" to "GimpTransformType move_type" and added an
2003-09-16  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmoveoptions.[ch]: changed "gboolean move_mask" to
	"GimpTransformType move_type" and added an "Affect:" stock radio
	box so it offers the same LAYER,SELECTION,PATH choice as the other
	transform tools.

	* app/tools/gimpmovetool.[ch]: honor the new tool option, made
	cursor_update() show more different cursors which describe the
	state of the tool more closely, fixed some cases where the
	GimpeditSelectionTool was invoked with meaningless values
	(like requesting a selection transform when there is no
	selection).

	Changed modifiers:

	- Made <Shift> toggle "move current layer".
	- Made <Control> switch to path moving.
	- <Alt> switched to selection moving as before.

	* app/tools/gimpeditselectiontool.[ch]: added EDIT_VECTORS_TRANSLATE
	operation mode and honor it all over the place. Unified the code
	which transforms layers and vectors since it's essentially the same.

	(gimp_edit_selection_tool_cursor_key): simplified selection moving
	code and added support for moving paths (using <Control>).
2003-09-16 16:23:38 +00:00
Sven Neumann
555038debf app/composite/gimp-composite-generic.c app/composite/gimp-composite-mmx.c
2003-09-16  Sven Neumann  <sven@gimp.org>

	* app/composite/gimp-composite-generic.c
	* app/composite/gimp-composite-mmx.c
	* app/composite/gimp-composite-sse.c
	* app/composite/gimp-composite-sse2.c
	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-path.c
	* app/config/gimpconfig-serialize.c
	* app/core/cpercep.c
	* app/core/gimpunit.c
	* app/gui/palette-import-dialog.c
	* app/gui/plug-in-menus.c
	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c
	* app/pdb/procedural_db.c
	* app/text/gimptextlayout-render.c
	* app/tools/gimpfuzzyselecttool.c
	* app/widgets/gimpcursor.c: some trivial code cleanups: avoid
	casts that discard const qualifiers and avoid useless comparisons
	on unsigned variables. Also reordered qualifiers in function
	declarations (static comes before const).
2003-09-16 13:12:50 +00:00
Simon Budig
e899c701ba Implemented an (unused/untested) gimp_vectors_bounds () that returns the
2003-09-16  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpvectors.[ch]: Implemented an (unused/untested)
	gimp_vectors_bounds () that returns the bounding box of an vectors
	object.

	* app/tools/gimpdrawtool.[ch]: made gimp_draw_tool_on_vectors()
	ignore handles/anchors, since they are not visible when that
	function gets used.
2003-09-15 22:41:25 +00:00
Simon Budig
0e407cba35 fixed bogus gimp_item_set_image (GIMP_ITEM (vectors), NULL);
2003-09-15  Simon Budig  <simon@gimp.org>

	* app/core/gimpimage.c: fixed bogus
	gimp_item_set_image (GIMP_ITEM (vectors), NULL);

	* app/tools/gimpdrawtool.[ch]: added gimp_draw_tool_on_vectors:
	checks if the given coordinate is on any vectors object of the image.

	* app/tools/gimpvectortool.[ch]: Changed the tool modes.
	VECTORS_SELECT_VECTORS now is active when the tool does not
	have a current vectors object or the gdisplay is different
	than the one the tool is drawing on. Also the Move mode now
	uses it, when clicking outside the current vectors object.

	Factored out the sanity check of the internal state
	(gimp_vector_tool_verify_state).
2003-09-15 21:12:10 +00:00
Sven Neumann
b4cc25eb18 removed...
2003-09-15  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdrawable-transform-utils.[ch]: removed...

	* app/core/gimp-transform-utils.[ch]: ...and added under new names
	because these functions are not at all related to GimpDrawable.
	Changed the function names accordingly.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/vectors/gimpstroke.c
	* app/vectors/gimpvectors.c
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

	* app/pdb/transform_tools_cmds.c: regenerated.
2003-09-15 17:41:18 +00:00
Michael Natterer
5b33524acf added new functions gimp_draw_tool_on_vectors_handle() and
2003-09-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.[ch]: added new functions
	gimp_draw_tool_on_vectors_handle() and _on_vectors_curve()
	so they can be used by all GimpDrawTool subclasses.

	* app/tools/gimpvectortool.[ch]: removed the _on_handle() and
	_on_curve() functions here. Connect to "active_vectors_changed" of
	the active_vector's image, so once it has been avtivated, the tool
	follows the path which is selected in the paths dialog.
2003-09-12 16:44:10 +00:00
Michael Natterer
9c13b724d4 app/core/gimpimage-mask-select.c (gimp_image_mask_select_vectors)
2003-09-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask-select.c (gimp_image_mask_select_vectors)
	* app/paint/gimppaintcore-stroke.c (gimp_paint_core_stroke_vectors)
	* app/display/gimpdisplayshell.c (gimp_display_shell_draw_vector)
	* app/tools/gimpdrawtool.c (gimp_draw_tool_real_draw)
	* app/tools/gimptransformtool.c (gimp_transform_tool_draw)
	* app/tools/gimpvectortool.c (gimp_vector_tool_vectors_visible)
	(gimp_vector_tool_draw): all callers of gimp_stroke_interpolate():
	don't leak the returned GimpCoords array and don't crash if it's
	NULL.

	* app/tools/gimpvectortool.[ch]: added VECTORS_SELECT_VECTOR state
	which enables activating any visible GimpVectors on any display.

	(gimp_vector_tool_on_handle)
	(gimp_vector_tool_on_curve): added a GimpVectors parameter so we
	can check for vectors which are not vector_tool->vectors.

	(gimp_vector_tool_oper_update): iterate gdisp->gimage->vectors
	to figure if we are hovering any visible vectors and set
	VECTORS_SELECT_VECTOR.

	(gimp_vector_tool_button_press): catch VECTORS_SELECT_VECTOR and
	start editing the selected vectors. Also make it the image's
	active_vectors.

	(gimp_vector_tool_button_release): removed unneeded call to
	gimp_viewable_invalidate_preview(vectors).

	Random cleanup all over the place.
2003-09-12 10:04:37 +00:00
Michael Natterer
3f437bb73b removed all calls to gimp_tool_control_set_preserve() so the tool doesn't
2003-09-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.c: removed all calls to
	gimp_tool_control_set_preserve() so the tool doesn't get
	confused by the image being dirtied.

	Made it aware of visible vectors:

	(gimp_vector_tool_draw): don't draw the stroke itself if the
	current vectors is visible.

	(gimp_vector_tool_vectors_visible): new callback which just draws
	the stroke itself when the vectors changes visibility.

	(gimp_vector_tool_set_vectors): connect the new callback.
2003-09-12 00:00:23 +00:00
Michael Natterer
c7414c12a0 made gimp_item_linked_get_list() and the GimpItemLinkedMask enum public.
2003-09-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem-linked.[ch]: made gimp_item_linked_get_list()
	and the GimpItemLinkedMask enum public. Hiding them just causes
	code duplication.

	* app/tools/gimpdrawtool.[ch]: added a GList of GimpVectors and a
	GimpMatrix3 transformation matrix for them. Just set them with
	gimp_draw_tool_set_vectors() and gimp_draw_tool_set_transform()
	and chain up in your tools's GimpdrawTool::draw() implementation
	to get the vectors drawn.

	* app/tools/gimpeditselectiontool.c: use
	gimp_item_linked_get_list() instead of traversing image->layers,
	->channels and ->vectors manually to find the linked items.
	Use gimp_draw_tool_set_vectors() and _set_transform() to show
	the linked vectors while moving.

	(gimp_edit_selection_tool_arrow_key): transform all linked items,
	not just the linked layers.
2003-09-11 18:02:39 +00:00
Sven Neumann
6f1a0df89f app/display/Makefile.am app/gui/Makefile.am app/paint/Makefile.am
2003-09-07  Sven Neumann  <sven@gimp.org>

	* app/display/Makefile.am
	* app/gui/Makefile.am
	* app/paint/Makefile.am
	* app/pdb/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* app/xcf/Makefile.am (INCLUDES): removed $(LIBART_CFLAGS) again.
2003-09-07 19:35:10 +00:00
Michael Natterer
8df1badccd removed the last traces of xinput_airbrush.
2003-09-07  Michael Natterer  <mitch@gimp.org>

	* app/tools/airbrush_blob.[ch]: removed the last traces of
	xinput_airbrush.
2003-09-07 15:34:49 +00:00
Michael Natterer
47ba171afd app/display/display-types.h app/tools/tools-types.h
2003-09-07  Michael Natterer  <mitch@gimp.org>

	* app/display/display-types.h
	* app/tools/tools-types.h
	* app/vectors/vectors-types.h
	* app/widgets/widgets-types.h: removed some forgotten cruft.

	* app/vectors/gimpbezierstroke.h
	* app/vectors/gimpstroke.h
	* app/vectors/gimpvectors.h: added class struct typedefs here.
2003-09-07 10:29:10 +00:00
Michael Natterer
7a5f914866 To optimize duplicate and/or wrong image updates away, introduced new
2003-09-06  Michael Natterer  <mitch@gimp.org>

	To optimize duplicate and/or wrong image updates away, introduced
	new policy that a child object must never explicitly update or
	invalidate its parent object (just like the GUI is not updated
	explicitly by the core):

	* app/core/gimpdrawable.[ch]: added new signal
	GimpDrawable::update(). Never update or invalidate the image when
	the drawable is updated or invalidated.

	(gimp_drawable_set_visible): don't gimp_drawable_update() the
	drawable since its pixels have not changed.

	* app/core/gimpimage.[ch]: connect to the "add" and "remove"
	signals of the layers and channels containers. Also connect to the
	"update" and "visibility_changed" signals of all drawables in
	these containers (optimizes away updates issued by drawables which
	are not yet added to the image and updates of the selection
	mask). Also, don't propagate updates to the image if the emitting
	drawable is invisible (optimizes away updates issued by invisible
	drawables).

	(gimp_image_add_layer,channel)
	(gimp_image_remove_layer,channel): don't update the image since
	that's done by our "add" and "remove" handlers now.

	(gimp_image_position_layer,channel): update just the image, not
	the drawable since its pixels have not changed.

	(gimp_image_real_colormap_changed)
	(gimp_image_set_component_visible): always call
	gimp_image_update() *and* gimp_viewable_invalidate_preview() to
	get everything updated, since update and invalidate of images are
	not connected.

	* app/core/gimpimage-undo-push.c (undo_pop_layer,channel): don't
	update the drawable since (a) its pixels don't change and (b) the
	image updates itself upon adding/removing now.

	(undo_pop_layer_mod): replaced gimp_image_update() by
	gimp_drawable_update() (just for consistency with other similar
	functions).

	* app/core/gimplayer.c: connect to "update" of the layer mask and
	issue updates on the layer if the mask update has any effect on
	the projection.
	(gimp_layer_create_mask): don't set the mask's offsets here since
	they may be different when we later add the mask to the layer.

	* app/core/gimplayermask.c (gimp_layer_mask_set_layer): set the
	mask offsets here instead.

	* app/core/gimpchannel.c (gimp_channel_translate): update the
	channel even if push_undo == FALSE.

	* app/paint/gimppaintcore.c (gimp_paint_core_finish)
	* app/tools/gimpinktool.c (ink_finish): invalidate both the
	drawable and the image preview since invalidating the drawable
	doesn't invalidate the image any more.

	* app/text/gimptextlayer.c (gimp_text_layer_render_now): also
	update the new extents of the text layer, not only the old one.

	(gimp_text_layer_render_layout): don't update the drawable since
	gimp_drawable_fill() already updated it.
2003-09-06 20:06:53 +00:00
Michael Natterer
b28c23611b app/display/Makefile.am app/gui/Makefile.am app/paint/Makefile.am
2003-09-06  Michael Natterer  <mitch@gimp.org>

	* app/display/Makefile.am
	* app/gui/Makefile.am
	* app/paint/Makefile.am
	* app/pdb/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* app/xcf/Makefile.am (INCLUDES): add $(LIBART_CFLAGS) here too.
2003-09-06 17:20:02 +00:00
Michael Natterer
a33f06e7e5 removed the _push_undo() and _invalidate() wrappers.
2003-09-04  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch]: removed the _push_undo() and
	_invalidate() wrappers.

	* app/core/gimpimage-mask-select.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimplayer-floating-sel.c
	* app/tools/gimptransformtool.c: changed accordingly.
2003-09-04 11:44:57 +00:00
Simon Budig
36941635a2 Cleanup. Properly freeze/thaw the vectors.
2003-09-04  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Cleanup. Properly freeze/thaw
	the vectors.
2003-09-03 23:00:47 +00:00
Simon Budig
70088acbcd app/vectors/gimpstroke.c Two small hacks to make the editing behave more
2003-09-03  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.c
	* app/vectors/gimpbezierstroke.c: Two small hacks to make the
	editing behave more symmetric (no more a user visible difference
	between extending to the start or to the end of a stroke).

	* app/tools/gimpvectortool.c: Use dashed lines for the connection
	between the anchor and the handles. Looks great IMHO.
2003-09-03 21:35:24 +00:00
Simon Budig
2dec640c62 properly keep track of the active anchor and retrieve that information
2003-09-03  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: properly keep track of the
	active anchor and retrieve that information after a _thaw () so
	that proper editing is possible after an undo. Now the
	vector_tool->cur_* variables are constantly updated in
	_oper_update () so that we don't need to determine them in
	_button_press () again.

	On request by Jimmac and Joao connecting two stroke-ends now
	works by activating one endpoint and clicking on the other
	endpoint in Insert/Delete Mode.
2003-09-03 19:52:46 +00:00
Michael Natterer
008e3e208c removed the _bounds() and _boundary() wrappers.
2003-09-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch]: removed the _bounds() and
	_boundary() wrappers.

	* app/core/gimpdrawable.c
	* app/display/gimpdisplayshell-selection.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptransformtool.c
	* app/xcf/xcf-save.c: changed accordingly.
2003-09-03 17:17:18 +00:00
Sven Neumann
157dc58571 Ctrl only sets the clone source when Shift isn't pressed at the same time
2003-09-03  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpclonetool.c: Ctrl only sets the clone source when
	Shift isn't pressed at the same time (fixes bug #121324).
2003-09-03 16:41:30 +00:00
Michael Natterer
e837849934 removed the _value() and _is_empty() wrappers.
2003-09-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch]: removed the _value() and
	_is_empty() wrappers.

	* app/display/gimpdisplayshell.[ch]: removed
	gimp_display_shell_mask_value() since it is not used.

	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage.c
	* app/core/gimplayer.c
	* app/gui/image-menu.c
	* app/gui/vectors-menu.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptransformtool.c
	* tools/pdbgen/pdb/misc_tools.pdb: changed accordingly.

	* app/pdb/misc_tools_cmds.c: regenerated.
2003-09-03 15:13:19 +00:00
Michael Natterer
1c04c3f601 removed the _clear() wrapper.
2003-09-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask-select.[ch]: removed the _clear() wrapper.

	* app/core/gimpimage-mask.[ch]: changed accordingly. Added
	"const gchar *undo desc" parameter to
	gimp_image_mask_select_vectors().

	* app/core/gimpimage-qmask.c
	* app/gui/vectors-commands.c
	* app/text/gimptext-compat.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimprectselecttool.c
	* app/widgets/gimpvectorstreeview.c
	* tools/pdbgen/pdb/paths.pdb
	* tools/pdbgen/pdb/selection.pdb: changed accordingly. Also
	replaced some wrappers which still exist.

	* tools/pdbgen/pdb/paths.pdb: stroke using gimp_item_stroke().

	* app/pdb/paths_cmds.c
	* app/pdb/selection_cmds.c: regenerated.
2003-09-03 14:22:38 +00:00
Michael Natterer
f47b758f32 removed the _translate() and _stroke() wrappers.
2003-09-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch]: removed the _translate()
	and _stroke() wrappers.

	* app/gui/edit-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimpselectioneditor.c
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/selection.pdb: changed accordingly.

	* app/pdb/edit_cmds.c
	* app/pdb/selection_cmds.c: regenerated.

	* app/core/gimpselection.c: implement GimpItem::scale(), resize(),
	flip() and rotate().

	* app/core/gimpimage-crop.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c: no need to call
	gimp_image_mask_invalidate() and/or gimp_image_mask_changed()
	manually after scale, resize, flip and rotate, since GimpSelection
	updates itself correctly.
2003-09-03 10:19:47 +00:00
Michael Natterer
420d17d286 made all functions which push an undo step virtual and added them all as
2003-09-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpchannel.[ch]: made all functions which push an
	undo step virtual and added them all as default implementations.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpselection.[ch]: new object which is a GimpChannel
	subclass and implements all of its virtual functions, pushes
	an image_mask undo and chains up with "push_undo = FALSE".

	* app/core/gimpimage-mask.[ch]: made most functions simple
	wrappers like gimp_channel_invert(gimp_image_get_mask(gimage));
	so the API stays the same for now.

	* app/core/gimpimage.[ch]: create a GimpSelection object
	as gimage->selection_mask. Removed "gboolean mask_stroking"
	since it is in GimpSelection now.

	* app/xcf/xcf-load.c (xcf_load_channel_props): added an evil hack
	which turns a GimpChannel into a GimpSelection once we figured the
	loaded channel is the selection.

	* app/core/gimplayer.c (gimp_layer_create_mask):
	gimp_channel_clear() takes an additional "const gchar *undo_desc"
	parameter now.

	* app/core/gimpscanconvert.c (gimp_scan_convert_to_channel): set
	mask->bounds_known to FALSE before returning the new channel

	* app/tools/gimpiscissorstool.c (iscissors_convert): no need to
	call gimp_channel_invalidate_boundary() on the channel returned by
	the above function.

	* app/core/gimpchannel.[ch]: removed
	gimp_channel_invalidate_boundary() since it is no longer needed.
2003-09-02 23:07:40 +00:00
Sven Neumann
138bab295b added new function gimp_draw_tool_draw_dashed_line().
2003-09-02  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpdrawtool.[ch]: added new function
	gimp_draw_tool_draw_dashed_line().
2003-09-02 16:13:48 +00:00
Sven Neumann
b20358c07f removed a superfluous call to g_object_ref().
2003-09-02  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpeditselectiontool.c (init_edit_selection): removed
	a superfluous call to g_object_ref().

	* app/vectors/gimpvectors.c (gimp_vectors_copy_strokes): free the
	old list of strokes.
2003-09-02 14:00:38 +00:00
Simon Budig
a6647f2d00 added simplistic undo, needs polishing.
2003-09-01  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: added simplistic undo, needs polishing.
2003-09-01 17:10:55 +00:00
Michael Natterer
c049f82e59 made "tool-info" a G_PARAM_CONSTRUCT_ONLY property.
2003-08-30  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.c: made "tool-info" a G_PARAM_CONSTRUCT_ONLY
	property.

	* app/tools/tool_manager.c (tool_manager_tool_changed): pass it to
	g_object_new() instead of setting it after tool creation.

	* app/tools/gimppainttool.[ch]
	* app/tools/gimptransformtool.[ch]: removed ugly
	"gboolean notify_connected" hacks and connect to the signals in
	GObject::constructor().

	* app/tools/gimppainttool.c (gimp_paint_tool_contstructor): create
	paint_tool->core here from tool->tool_info->paint_info->paint_type.

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c: changed accordingly. Removed lots of
	useless class_init functions. Converted tabs to spaces. Cleanup.
2003-08-30 16:41:35 +00:00
Michael Natterer
2da93d692f app/core/gimpchannel.[ch] (gimp_channel_boundary)
2003-08-30  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpchannel.[ch] (gimp_channel_boundary)
	* app/core/gimpimage-mask.[ch] (gimp_image_mask_boundary)
	* app/core/gimplayer-floating-sel.[ch] (floating_sel_boundary):
	return const BoundSeg arrays because they are cached and not newly
	allocated.

	* app/base/boundary.[ch] (sort_boundary)
	* app/tools/gimpdrawtool.[ch] (gimp_draw_tool_draw_boundary):
	take const BoundSeg arrays.

	* app/core/gimpimage-mask.c (gimp_image_mask_stroke)
	* app/display/gimpdisplayshell-selection.c
	* app/tools/gimpeditselectiontool.c (init_edit_selection):
	changed accordingly.
2003-08-30 14:25:05 +00:00
Michael Natterer
c42641fe89 Fixed & cleaned up paint function registration to work without GUI.
2003-08-30  Michael Natterer  <mitch@gimp.org>

	Fixed & cleaned up paint function registration to work without
	GUI. Finishes core/GUI separation for the paint tools:

	* app/core/gimppaintinfo.[ch]: removed "gchar *pdb_string" all over
	the place since we don't stroke using the PDB any more.
	(gimp_paint_info_new): create paint_info->paint_options here so
	the paint system is fully initialized when there is no GUI.

	* app/paint/paint.c: removed pdb_string stuff here, too.

	* app/core/gimptoolinfo.[ch]: create tool_info->tool_options
	only if tool_info->tool_options_type is not the same type
	as paint_info->paint_options_type (if we are no paint tool).

	* app/core/gimptooloptions.c: removed G_PARAM_CONSTRUCT_ONLY from
	the "tool-info" property. Instead, changed
	gimp_tool_options_set_property to ensure that it is only set once.

	* app/core/gimp.c (gimp_initialize): moved paint_init() after
	data_factory creation (was in gimp_init()), since GimpPaintInfo
	now creates the GimpPaintOptions, which are GimpContexts, which
	need gimp->*_factory to be constructed.

	* app/tools/tool_manager.c: don't create tool_info->tool_options
	here (it's not the job of the tool_manager to set up the core
	paint system correctly, it must be already initialized before any
	tool_manager function is called).

	Made "Stroke Selection" and "Stroke Path" work the same way:

	* app/paint/gimppaintcore-stroke.[ch]: added new function
	gimp_paint_core_stroke_boundary() which strokes without using
	the PDB.

	* app/core/gimpimage-mask.c (gimp_image_mask_stroke): use it
	instead of using the PDB. Enables all available paint options for
	stroke operations. Fixes bug #119411.

	* app/gui/vectors-commands.c (vectors_stroke_vectors)
	* app/core/gimpimage-mask.c (gimp_image_mask_stroke): removed all
	code which tries to figure how to stroke and simply look at the
	active tool's tool_info->paint_info, since it is always set up
	correctly now.
2003-08-30 13:22:20 +00:00
Simon Budig
d401ae3b63 fixed stupid int vs. float error that caused rounding errors when moving
2003-08-30  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: fixed stupid int vs. float
	error that caused rounding errors when moving in a zoomed view.
	Fixed drawing artefact when connecting strokes did not succeed.
2003-08-29 22:40:13 +00:00
Simon Budig
df8ab68d45 further modifier changes. Mail to gimp-devel will follow.
2003-08-29  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.[ch]: further modifier changes.
	Mail to gimp-devel will follow.
2003-08-29 19:55:32 +00:00
Simon Budig
e7d0cfadc7 Do not modify the selection state of the anchors. When extending
2003-08-29  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpbezierstroke.c: Do not modify the selection
	state of the anchors. When extending EXTEND_EDITABLE return
	the anchor created (not the handle at the end of the list)

	* app/tools/tools-enums.h: Added new mode-enum for the vector tool.
	* app/tools/tools-enums.c: regenerated

	* app/tools/gimpvectortool.[ch]: Implemented moving (Shortcuts
	ALT and ALT+CTRL. The whole assignment of modifiers right now
	gets revised. Right now you have to use the Tool options to
	switch between the modes of operation. Connecting strokes now
	works in Insert/Delete mode by clicking on startpoint and
	dragging to target endpoint.

	I will write a mail to gimp-devel when the shortcuts are
	setteled a bit more. Sorry for the inconvenience.
2003-08-29 15:17:06 +00:00
Sven Neumann
417221b6bf move the mnemonic from the old font selection widget to the new one. The
2003-08-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_gui): move the
	mnemonic from the old font selection widget to the new one. The
	old one will die soon. Fixes bug #120963.
2003-08-29 11:19:45 +00:00
Simon Budig
d3879afcb9 libappte2003-08-28 Simon Budig <simon@gimp.org>
* app/tools/gimptransformtool.c: Modified the test when to paint
	the grid or not. It now checks for convexity of the bounding
	polygon.
2003-08-28 13:02:50 +00:00
Simon Budig
08bd7a19b9 app/vectors/gimpstroke.[ch] Implemented function to connect two strokes.
2003-08-27  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpbezierstroke.c: Implemented function to
	connect two strokes.

	* app/tools/gimpvectortool.[ch]: Use it. Right now you have
	to click on one endpoint, and then SHIFT+CTRL+ALT-Click on
	the other endpoint.

	Suggestions on how to solve that more sanely are welcome...
2003-08-27 00:31:20 +00:00
Sven Neumann
ee6dad2eb5 use GIMP_GRADIENT as prefix for the GimpGradientType enum.
2003-08-26  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h: use GIMP_GRADIENT as prefix for the
	GimpGradientType enum.

	* app/core/core-enums.c
	* app/pdb/misc_tools_cmds.c
	* libgimp/gimpenums.h
	* plug-ins/pygimp/gimpenums.py
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* app/core/gimpdrawable-blend.c
	* app/tools/gimpblendoptions.c
	* plug-ins/pygimp/plug-ins/sphere.py
	* plug-ins/script-fu/scripts: changed accordingly.

	* libgimp/gimpcompat.h
	* plug-ins/script-fu/siod-wrapper.c: added compatibility defines
	for the old enum values.
2003-08-26 18:12:42 +00:00
Michael Natterer
17d1fb17f2 it's GIMP_INTERPOLATION_LINEAR, not just GIMP_LINEAR, argh. Fixes part 1
2003-08-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformoptions.c
	(gimp_transform_options_class_init): it's GIMP_INTERPOLATION_LINEAR,
	not just GIMP_LINEAR, argh. Fixes part 1 of bug #120424.
2003-08-26 17:33:25 +00:00
Simon Budig
47571782a7 Intruduce casting macro GIMP_ANCHOR.
2003-08-26  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpanchor.h: Intruduce casting macro GIMP_ANCHOR.

	* app/tools/gimpvectortool.c
	* app/vectors/gimpstroke.c
	* app/vectors/gimpbezierstroke.c
	* app/vectors/gimpvectors-compat.c: Use it for code readibility.
2003-08-26 14:29:10 +00:00
Simon Budig
009766a881 app/vectors/gimpstroke.[ch] Implemented direct moving of the curve. Whee!
2003-08-26  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpbezierstroke.c: Implemented direct moving of the
	curve. Whee!  :-)

	* app/tools/gimpvectortool.[ch]: Use it.
2003-08-26 00:27:03 +00:00
Michael Natterer
ba70ce9a10 changed GimpHelpFunc typedef: - renamed "const gchar *help_data" to "const
2003-08-23  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgetstypes.h: changed GimpHelpFunc typedef:
	- renamed "const gchar *help_data" to "const gchar *help_id".
	- added "gpointer help_data".

	* libgimpwidgets/gimphelpui.[ch]: added "gpointer help_data" to
	gimp_help_connect(). Removed all fiddling with html links and
	treat all help IDs as opaque identifiers.

	* app/core/gimptoolinfo.[ch]: changed "help_data" member to
	"help_id".

	* app/widgets/gimpitemfactory.[ch]: removed the "help_path"
	parameter from gimp_item_factory_new() since we don't fiddle with
	html file paths any more. Simplifies menu item help a lot.
	Renamed "help_data" member of struct GimpItemFactoryEntry to
	"help_id".

	* app/gui/plug-in-menus.c: changed accordingly. 3rd party
	plug-ins' menu item help IDs are now encoded as
	"help_path:help_id".

	* app/gui/file-open-menu.c
	* app/gui/file-save-menu.c: when constructing the <Load> and
	<Save> menus, take the resp. procedures' locale_domain and
	help_path into account. Fixes translation of 3rd party menu items.
	Also do the right thing for load/save procs which are implemented
	as temporary procedures (they are impossible to implement
	currently but it's nice to do the right thing anyway...).

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_MAIN identifier.

	* libgimpwidgets/gimpdialog.[ch]
	* libgimpwidgets/gimpwidgets.[ch]
	* libgimp/gimpui.c
	* app/display/gimpdisplayshell.c
	* app/gui/gui.c
	* app/gui/about-dialog.c
	* app/gui/color-notebook.c
	* app/gui/dialogs-constructors.c
	* app/gui/file-dialog-utils.[ch]
	* app/gui/gradients-commands.c
	* app/gui/help-commands.c
	* app/gui/image-menu.c
	* app/gui/menus.c
	* app/gui/preferences-dialog.c
	* app/gui/tips-dialog.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimphelp.[ch]
	* app/widgets/gimpmenufactory.[ch]
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.[ch]
	* plug-ins/common/CEL.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/gee.c
	* plug-ins/common/gee_zoom.c
	* plug-ins/common/gqbist.c
	* plug-ins/common/spheredesigner.c
	* plug-ins/flame/flame.c
	* plug-ins/fp/fp_gtk.c
	* plug-ins/helpbrowser/helpbrowser.c
	* plug-ins/ifscompose/ifscompose.c
	* plug-ins/imagemap/imap_main.c: changed accordingly. Removed
	trailing whitespace all over the place.
2003-08-23 19:35:05 +00:00
Simon Budig
14d0ec8b2c app/tools/gimpvectortool.c OK, now valgrind is happy.
2003-08-22  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c
	* app/vectors/gimpbezierstroke.c: OK, now valgrind is happy.
2003-08-22 15:20:13 +00:00
Simon Budig
d368e27e5a app/vectors/gimpstroke.c app/vectors/gimpvectors-preview.c
2003-08-22  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.c
	* app/vectors/gimpvectors-preview.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: Added missing checking for NULL
	return values. Hopefully this fixes the crashes others are
	observing.
2003-08-22 13:00:25 +00:00
Michael Natterer
fc20b3ac55 app/display/gimpdisplayshell.c app/gui/brush-select.c
2003-08-22  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c
	* app/gui/brush-select.c
	* app/gui/channels-menu.c
	* app/gui/convert-dialog.c
	* app/gui/file-open-menu.c
	* app/gui/file-save-menu.c
	* app/gui/font-select.c
	* app/gui/gradient-select.c
	* app/gui/gui.c
	* app/gui/image-commands.c
	* app/gui/image-menu.c
	* app/gui/layers-menu.c
	* app/gui/menus.c
	* app/gui/palette-import-dialog.c
	* app/gui/palette-select.c
	* app/gui/palettes-commands.c
	* app/gui/pattern-select.c
	* app/gui/preferences-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/qmask-menu.c
	* app/gui/templates-commands.c
	* app/gui/toolbox-menu.c
	* app/gui/vectors-menu.c
	* app/tools/[all tools].c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpitemfactory.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimphelp-ids.h: added, fixed and updated lots of
	help IDs. Still unfinished.
2003-08-22 01:42:57 +00:00
Sven Neumann
37e2d34afe tools/gimpblendtool.c tools/gimpcroptool.c use
2003-08-22  Sven Neumann  <sven@gimp.org>

	* tools/gimpblendtool.c
	* tools/gimpcroptool.c
	* tools/gimpeditselectiontool.c: use gimp_tool_push_status_coords()
	for the initial status in order to reduce work for translators.
2003-08-22 01:24:58 +00:00
Simon Budig
32499a849d app/vectors/gimpstroke.[ch] added gimp_(bezier_)stroke_open that opens up
2003-08-22  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpbezierstroke.c: added
	gimp_(bezier_)stroke_open that opens up a stroke (possibly
	returns a new one if it falls apart).

	* app/tools/gimpvectortool.[ch]: make it possible to break
	up a stroke by deleting (CTRL-Clicking in Insert/Delete mode)
	the curve between two anchors.
2003-08-22 01:12:26 +00:00
Simon Budig
044ea72c69 added _is_empty () that checks if a stroke is empty.
2003-08-21  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]: added _is_empty () that checks
	if a stroke is empty.

	* app/vectors/gimpbezierstroke.c: Implemented _anchor_delete ()

	* app/vectors/gimpvectors.[ch]: added _stroke_remove ()

	* app/tools/gimpvectortool.[ch]: implemented the deletion of
	anchors. CTRL-Click on the anchor in Insert/Delete mode does
	the trick. Also did some renaming to the Vector tool
	(now Path tool) and set the Tooltip to something sane.

	Folks, I think the new path tool is no longer a regression
	against the 1.2 bezier select tool!
2003-08-21 17:47:12 +00:00
Henrik Brix Andersen
818cbe8279 test gimp_display_shell_get_show_guides() before drawing guide. Fixes
2003-08-21 Henrik Brix Andersen <brix@gimp.org>

* app/tools/gimpmovetool.c (gimp_move_tool_control): test
gimp_display_shell_get_show_guides() before drawing guide. Fixes
guide artefact seen when disabling drawing of guides while a guide
is selected by the move tool.
2003-08-21 17:40:29 +00:00
jaycox
012288a54d paint_core_interpolate now takes care of setting core->last_coords. Don't
* app/paint/gimppaintcore.c: paint_core_interpolate now takes care
	of setting core->last_coords.  Don't reset core->distance in
	paint_core_start (fixes problem with shift-click brush strokes).
	Improved brush placement for stroked selections in
	paint_core_interpolate.
	* app/paint/gimppaintcore-stroke.c: dont need to set
	core->last_coords anymore.
	* app/tools/gimppainttool.c: dont need to set core->last_coords
	anymore.  Set core->distance in gimp_paint_tool_button_press.
2003-08-21 10:44:11 +00:00
Simon Budig
9b5817fc25 Don't allow to create a new stroke when in in Insert/Delete Mode.
2003-08-21  Simon Budig  <simon@gimp.org>

        * app/tools/gimpvectortool.c: Don't allow to create a new stroke
        when in in Insert/Delete Mode.
2003-08-21 00:18:44 +00:00
Simon Budig
2a47fda7f0 Added enum for vector tool operation mode
2003-08-21  Simon Budig  <simon@gimp.org>

        * app/tools/tools-enums.h: Added enum for vector tool operation
        mode

        * app/tools/tools-enums.c: regenerated

        * app/tools/gimpvectoroptions.[ch]: Use new enum.
        Add "Polygonal" Option

        * app/tools/gimpvectortool.c: New Option "Polygonal" that
        places all newly generated handles at the position of their
        anchor, effectively ensuring that only polygons can be created.

        Cleaned up the editing states. It is now possible to move anchors
        in the Insert/Delete mode. Cleaned up the associated cursors.

        Fixed warning when Shift+Ctrl-Clicking on an inactive Anchor.
2003-08-20 22:19:37 +00:00
Simon Budig
52a16ff5a4 Add hooks for insertion of points (and testing if insertion is possible)
2003-08-20  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpstroke.[ch]: Add hooks for insertion of points
        (and testing if insertion is possible)

        * app/vectors/gimpbezierstroke.c: Implement it for BezierStrokes

        * app/tools/gimpvectoroptions.c: Adjusted Options-GUI.

        * app/tools/gimpvectortool.[ch]: Detect if the pointer is over
        the curve. Make it possible to insert points in the curve.
        Select the "Insert/Delete Nodes" mode in the tool options and
        click on the curve.
2003-08-20 17:29:13 +00:00
Michael Natterer
82ac2e384f always look for the active drawable, not for the active layer. Fixes line
2003-08-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c
	(gimp_paint_tool_oper_update,cursor_update): always look for the
	active drawable, not for the active layer. Fixes line and brush
	preview drawing for channels.
2003-08-19 18:04:40 +00:00
Michael Natterer
e9e98af6fb app/config/gimpdisplayconfig.[ch] added "gboolean show_brush_outline".
2003-08-19  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpdisplayconfig.[ch]
	* app/config/gimprc-blurbs.h: added "gboolean show_brush_outline".

	* app/gui/preferences-dialog.c (prefs_dialog_new): added it to the
	"Pointer Movement Feedback" frame.

	* app/tools/gimppainttool.[ch]: connect to
	"notify::show-brush-outline" and toggle brush outline display
	accordingly. Fixes bug #120084.
2003-08-19 17:20:05 +00:00
Michael Natterer
58311491e4 cleaned up GimpTool, GimpDrawTool and vectors_tool->vectors state handling
2003-08-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.c: cleaned up GimpTool, GimpDrawTool
	and vectors_tool->vectors state handling a lot. Still does weird
	things when switching between images and/or displays but it's
	better than before...
2003-08-18 18:05:57 +00:00
Simon Budig
cf4bfb2e35 Minor fix.
2003-08-18  Simon Budig  <simon@gimp.org>

        * app/tools/gimpvectortool.c: Minor fix.
2003-08-17 23:19:09 +00:00
Simon Budig
86e4d32a44 app/vectors/gimpstroke.[ch] Virtualized gimp_bezier_stroke_extend, added
2003-08-17  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpbezierstroke.[ch]: Virtualized
	gimp_bezier_stroke_extend, added gimp_stroke_is_extendable.

	* app/text/gimptext-vectors.c: changed accordingly.

	* app/vectors/gimpvectors.[ch]: added gimp_vectors_anchor_select.

	* app/tools/gimpvectoroptions.[ch]: dummy switch for future
	extensions

	* app/tools/gimpvectortool.[ch]: Major overhaul. Made use of
	gimp_vector_tool_oper_update, cleaned up
	gimp_vector_tool_button_press a lot and finally have a
	working cursor_update. Still buggy, but I wanted to have it
	in CVS.
2003-08-17 02:49:24 +00:00
Michael Natterer
d21a181df8 added GimpTool::oper_update() implementation and moved stuff from
2003-08-16  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c: added GimpTool::oper_update()
	implementation and moved stuff from button_press() and
	cursor_update() there. Fixed the state of the tool to be only
	ACTIVE while button1 is pressed. Cleanup.
2003-08-16 22:15:36 +00:00
Michael Natterer
7d37222b45 call gimp_image_update() after calling gimp_image_add_vectors() so the
2003-08-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.c (gimp_vector_tool_button_press): call
	gimp_image_update() after calling gimp_image_add_vectors() so the
	menus get updated correctly. Fixes bug #119412.
2003-08-14 14:42:08 +00:00
Simon Budig
658407d3e3 Added changing the opacity via cursor keys. Left/Right: +- 1%, UpDown: +-
2003-08-08  Simon Budig  <simon@gimp.org>

        * app/tools/gimppainttool.c: Added changing the opacity via
        cursor keys. Left/Right: +- 1%, UpDown: +- 10%.

        I am just committing this, because jimmac will kill me if I dont...
2003-08-08 07:57:33 +00:00
Simon Budig
10cb43d2fb implemented gimp_stroke_close.
2003-08-02  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpstroke.[ch]: implemented gimp_stroke_close.

        * app/vectors/gimpbezierstroke.c: only extend a stroke if
        it is not closed.

        * app/tools/gimpvectortool.c: ALT-Click on an anchor now
        closes the stroke. Will evolve to the ability to connect
        two strokes.
2003-08-03 01:26:05 +00:00
Hans Breuer
b70d6c3317 renamed GimpOrientationType with Compat postfix to avoid name clashing
2003-07-26  Hans Breuer  <hans@breuer.org>

	* libgimp/gimpcompat.h : renamed GimpOrientationType
	with Compat postfix to avoid name clashing when using
	this header together with libgimp/gimpenums.h

	* app/composite/makefile.msc : (new file)
	  **/makefile.msc : updated

	* libgimp/gimp.c : use static defined _tile<widht|height>
	in this file instead of function call

	* libgimp/gimp.def libgimp/libgimpui.def : moved from former
	to latter : gimp_<brush|font|gradient|pattern>_select_<new|destroy>
	added to former gimp_<brushes|gradients|patterns>_popup

	* app/paint/gimppaintcore.h : removed double semicolon
	which gave msvc error C2059: syntax error : ';'

	* libgimpbase/gimpwin32-io.h : (new file) compatibilty defines
	which were spread over multiple files to make up mostly for
	missing unistd.h

	* app/base/tile-swap.c app/core/gimpimagefile.c
	  libgimpbase/gimpdatafiles.c
	  plug-ins/FractalExplorer/FractalExplorer.c : use new header

	* plug-ins/gflare/gflare.c
	  plug-ins/flame/flame.c
	  plug-ins/FractalExplorer/Dialogs.c :
	removed #ifdef G_OS_WIN32 special casing, not needed anymore
	due to g_file_test() usage

	* app/text/*.* : changes required for build with PangoWin32,
	but not commited ...
2003-07-26 17:37:32 +00:00
Sven Neumann
64c90c6d99 call gimp_image_flush() at the end of gimp_text_tool_create_vectors() 2003-07-24 17:07:05 +00:00
Sven Neumann
2858305cbe set the vectors offset from the text layer's offset.
2003-07-24  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_create_vectors): set
	the vectors offset from the text layer's offset.

	* app/text/gimptext-vectors.c: removed debugging output.
2003-07-24 16:40:22 +00:00
Michael Natterer
827c3f37c4 removed the brush outline members since we have no chance to really cache
2003-07-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.[ch]: removed the brush outline members
	since we have no chance to really cache them without duplicating
	GimpPaintCore's brush change notification code.

	* app/paint/gimppaintcore.[ch]: added the outline here and really
	cache it this time. The paint_core doesn't create or use the
	outline but frees and NULLifies it whenever the brush changes.
2003-07-24 16:35:25 +00:00
Sven Neumann
1f4714a056 more work on glyph decomposition.
2003-07-24  Sven Neumann  <sven@gimp.org>

	* app/text/gimptext-vectors.c: more work on glyph decomposition.

	* app/tools/gimptextoptions.c
	* app/tools/gimptexttool.c: added button to create a path from text.
2003-07-24 13:10:27 +00:00
Michael Natterer
6bccd14760 Argh, this should have gone with my last checkin... 2003-07-22 14:29:06 +00:00
Michael Natterer
075195d16b added "gboolean reverse" to gimp_gradient_get_color_at() so all gradients
2003-07-22  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpgradient.[ch]: added "gboolean reverse" to
	gimp_gradient_get_color_at() so all gradients can be used
	reversed.

	* app/core/gimpdrawable-blend.[ch] (gimp_drawable_blend)
	* app/core/gimppalette-import.[ch] (gimp_palette_import_from_gradient):
	added "gboolean reverse".

	* app/paint/paint-enums.[ch]: removed enum GimpGradientRepeatMode
	since it is identical to GimpRepeatMode, except for the now
	obsolete ONCE_BACKWARD value.

	* app/paint/gimppaintcore.[ch]: removed
	gimp_paint_core_get_color_from_gradient()...

	* app/paint/gimppaintoptions.[ch]: ...and added
	gimp_paint_options_get_gradient_color(), which is much more
	general. Added a "reverse" property to GimpGradientOptions and
	changed the type of the "repeat" property to GimpRepeatMode.

	* app/paint/gimppaintbrush.c: use
	gimp_paint_options_get_gradient_color().

	* app/tools/gimpblendoptions.[ch]: removed the "repeat" property
	since it is in the parent class now.

	* app/gui/gradient-select.c
	* app/gui/palette-import-dialog.c
	* app/widgets/gimpgradienteditor.c
	* app/tools/gimpblendtool.c
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/misc_tools.pdb: changed accordingly.

	* app/tools/gimppaintoptions-gui.c: added a "Reverse" toggle right
	of the gradient preview.

	* app/widgets/gimppreviewrenderergradient.[ch]: added "gboolean
	reverse" member and gimp_preview_renderer_gradient_set_reverse()
	API.

	* tools/pdbgen/pdb/paint_tools.pdb: fixed the paintbrush invoker
	to set GimpPaintOption's "use-fade" and "use-gradient" properties
	correctly.

	* app/pdb/gradients_cmds.c
	* app/pdb/misc_tools_cmds.c
	* app/pdb/paint_tools_cmds.c
	* libgimp/gimpenums.h
	* libgimp/gimpmisctools_pdb.[ch]
	* plug-ins/pygimp/gimpenums.py
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* libgimp/gimpcompat.h
	* plug-ins/script-fu/siod-wrapper.c: removed GimpGradientPaintMode
	here too since it was only exported accidentially (it's not used
	by any external API).

	* plug-ins/script-fu/scripts/3dTruchet.scm
	* plug-ins/script-fu/scripts/alien-glow-arrow.scm
	* plug-ins/script-fu/scripts/alien-glow-bar.scm
	* plug-ins/script-fu/scripts/alien-glow-bullet.scm
	* plug-ins/script-fu/scripts/alien-glow-button.scm
	* plug-ins/script-fu/scripts/alien-glow-logo.scm
	* plug-ins/script-fu/scripts/basic1-logo.scm
	* plug-ins/script-fu/scripts/basic2-logo.scm
	* plug-ins/script-fu/scripts/beveled-button.scm
	* plug-ins/script-fu/scripts/blended-logo.scm
	* plug-ins/script-fu/scripts/burn-in-anim.scm
	* plug-ins/script-fu/scripts/coffee.scm
	* plug-ins/script-fu/scripts/comic-logo.scm
	* plug-ins/script-fu/scripts/coolmetal-logo.scm
	* plug-ins/script-fu/scripts/glossy.scm
	* plug-ins/script-fu/scripts/gradient-bevel-logo.scm
	* plug-ins/script-fu/scripts/gradient-example.scm
	* plug-ins/script-fu/scripts/pupi-button.scm
	* plug-ins/script-fu/scripts/rendermap.scm
	* plug-ins/script-fu/scripts/sphere.scm
	* plug-ins/script-fu/scripts/starscape-logo.scm
	* plug-ins/script-fu/scripts/test-sphere.scm
	* plug-ins/script-fu/scripts/textured-logo.scm
	* plug-ins/script-fu/scripts/title-header.scm
	* plug-ins/script-fu/scripts/weave.scm: pass "reverse" to
	gimp_blend(). Pass FALSE in most cases and added script
	parameters were it makes sense.
2003-07-22 14:24:11 +00:00
Sven Neumann
75306ec3af app/core/gimpdrawable-blend.[ch] app/tools/gimpblendoptions.[ch]
2003-07-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdrawable-blend.[ch]
	* app/tools/gimpblendoptions.[ch]
	* app/tools/gimpblendtool.c
	* tools/pdbgen/pdb/misc_tools.pdb
	* plug-ins/script-fu/scripts/: applied a slightly modified patch
	from Alastair M. Robinson that adds dithering to the blend tool
	(bug #97777).

	* app/pdb/misc_tools_cmds.c
	* libgimp/gimpmisctools_pdb.[ch]: regenerated.
2003-07-21 01:13:35 +00:00
Sven Neumann
3131923268 show CMYK color values.
2003-07-18  Sven Neumann  <sven@gimp.org>

	* app/gui/info-window.c: show CMYK color values.

	* app/tools/gimpcolorpickertool.c: reduced code duplication.
2003-07-18 22:00:36 +00:00
Michael Natterer
486aed8e0d added "gboolean allow_percent" to gimp_param_spec_unit() and to the
2003-07-17  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-params.[ch]: added "gboolean allow_percent"
	to gimp_param_spec_unit() and to the GIMP_CONFIG_INSTALL_PROP_UNIT()
	macro. Changed value validation accordingly.

	* app/config/gimpconfig-types.c (string_to_unit): parse "percent"
	correctly.

	* app/widgets/gimppropwidgets.c (gimp_prop_unit_menu_new): show
	the "Percent" menu entry if the param_spec allows percent.

	* app/config/gimpcoreconfig.c
	* app/core/gimpgrid.c
	* app/core/gimptemplate.c
	* app/text/gimptext.c: pass FALSE to disallow percent.

	* app/paint/gimppaintoptions.c
	* app/tools/gimpselectionoptions.c: pass TRUE. Brings back the
	percent feature for fade_length, gradient_length and fixed_size
	rect/ellipse select.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: don't call the the reset()
	functions from the GUI constructors (and reset the options just
	deserialized from disk). Instead, added set_defaults() functions
	which do everything the old reset() functions did (except
	upchaining) and call set_defaults() from reset() and from the GUI
	constructors.
2003-07-17 15:22:21 +00:00
Michael Natterer
30e041cd79 add a small EPSILON to the brush coordinates before rounding them (fixes
2003-07-16  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_draw): add a small
	EPSILON to the brush coordinates before rounding them (fixes
	off-by-one floating point rounding fnord for "hard edge" painting
	where e.g. (5.0 - (3.0 / 2.0)) was rounded to 3.0 instead of 4.0).

	* app/tools/gimpdrawtool.c (gimp_draw_tool_draw_boundary): use
	RINT() instead of floor() to round the transformed boundary to
	GdkSegments.
2003-07-16 16:19:16 +00:00
Michael Natterer
30934d2395 implemented transforming of paths. Cleaned up initialize() and
2003-07-16  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.[ch]: implemented transforming of
	paths. Cleaned up initialize() and button_press() to activate the
	tool correctly. Use the transform tool's CREATING state *only*
	before the first mouse click (when there is no grid displayed).
	Preview the active path while transforming. Cache the transform
	direction in the GimpTransformTool struct so we can switch it
	while previewing the path. Lots of path transform related changes
	and cleanup.
2003-07-16 14:08:24 +00:00
Sven Neumann
10eee1e7bc don't draw the grid when the bounding box becomes concave.
2003-07-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformtool.c (gimp_transform_tool_draw): don't
	draw the grid when the bounding box becomes concave.
2003-07-16 13:53:08 +00:00
Michael Natterer
8224476afb added utility function gimp_paint_options_get_fade() which calculates an
2003-07-16  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintoptions.[ch]: added utility function
	gimp_paint_options_get_fade() which calculates an opacity
	value from paint_core->pixel_dist.

	* app/paint/gimppaintbrush.c: removed the same code here and use
	gimp_paint_options_get_fade().

	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimpsmudge.c: enabled fade for all paint tools, along
	with a general opacity cleanup:

	Use the opacity from gimp_context_get_opacity() *only* for the
	image_opacity. In particular, *never* use it as initial value for
	calculating the brush_opacity. Instead, start calculating the
	brush_opacity from gimp_paint_options_get_fade() and return early
	if it returns 0.0, if not, multiply tool specific opacity sources
	like the current pressure.

	(This changes the effect of the paint tools for particular opacity
	values, but makes the impact of opacity on the final rendering
	linear and more intuitive)

	* app/tools/gimppaintoptions-gui.c: enabled the "Fade" frame for
	the tools above.

	* app/paint/gimppaintcore.c: purely cosmetic cleanup.
2003-07-16 11:25:37 +00:00
Michael Natterer
562865a092 took the fade options out of GimpGradientOptions and added them to the new
2003-07-15  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintoptions.[ch]: took the fade options out of
	GimpGradientOptions and added them to the new GimpFadeOptions
	struct. Added a GObject::finalize() implementation.

	* app/paint/gimppaintbrush.[ch]: changed accordingly. Made
	gimp_paintbrush_motion() a protected function and renamed it to
	_gimp_paintbrush_motion() added a "gdouble opacity" parameter so
	an initial brush opacity can be passed in by subclasses.

	* app/paint/gimpairbrush.[ch]: derive it from GimpPaintbrush so it
	gets all its rendering features. Removed own rendering code and
	use _gimp_paintbrush_motion(), passing airbrush_options->pressure
	as initial opacity. Removed all static variables.

	* app/tools/gimpairbrushtool.[ch]
	* app/tools/gimppenciltool.[ch]: derive them from GimpPaintbrushTool.

	* app/tools/gimppaintoptions-gui.c: changed accordingly. Added the
	full paintbrush options overkill to the airbrush GUI. Cleanup.

	* app/tools/gimperasertool.c: forgot to remove the "Hard Edge"
	toggle here.
2003-07-15 15:38:24 +00:00
Michael Natterer
070fafb5d1 Argh...
2003-07-14  Michael Natterer  <mitch@gimp.org>

	Argh...

	* app/paint/Makefile.am
	* app/paint/gimppencil.[ch]: added it again as GimpPaintbrush
	subclass and override nothing but the user visible undo name and
	the paint_options type.

	* app/paint/paint.c
	* app/tools/tool_manager.c
	* app/tools/gimppenciltool.c
	* tools/pdbgen/pdb/paint_tools.pdb: reverted my last changes.

	* app/pdb/paint_tools_cmds.c: regenerated.
2003-07-14 17:10:09 +00:00
Michael Natterer
4a30a71c43 oops, forgot this one... 2003-07-14 16:45:39 +00:00
Michael Natterer
e1e943b9fa app/paint/Makefile.am removed.
2003-07-14  Michael Natterer  <mitch@gimp.org>

	* app/paint/Makefile.am
	* app/paint/gimppencil.[ch]: removed.

	* app/paint/gimppenciloptions.[ch]: new files. Does nothing except
	setting the default value of "hard" to TRUE.

	* app/paint/paint.c
	* app/tools/tool_manager.c: changed accordingly.

	* app/tools/gimppenciltool.c
	* tools/pdbgen/pdb/paint_tools.pdb: use the pintbrush core for
	pencil drawing.

	* app/pdb/paint_tools_cmds.c: regenerated.

	* app/tools/gimppaintoptions-gui.c: show all paintbrush options
	except "Hardness" for the pencil tool.
2003-07-14 15:43:21 +00:00
Michael Natterer
78262ef745 removed "gboolean hard" member/property...
2003-07-14  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimperaseroptions.[ch]: removed "gboolean hard"
	member/property...

	* app/paint/gimppaintoptions.[ch]: ...and added it here. Added
	gimp_paint_options_get_brush_mode() utility function.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.h
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c: use the new utility funtion where
	appropriate. Removed trailing whitespace.

	* app/tools/gimpdrawtool.[ch] (gimp_paint_tool_draw_boundary):
	changed offset parameters from gint to gdouble so we can show the
	brush preview at sub-pixel positions.

	* app/tools/gimppainttool.c: use sub-pixel coordinates for the
	brush preview if paint_options->hard is FALSE (doesn't work for
	the pencil yet).

	The new brush preview unveiled that the positioning of even-sized
	brushes if off by 0.5 for soft brush application mode and off by
	1.0 for hard application mode:

	* app/paint/gimppaintcore.[ch] (gimp_paint_core_subsample_mask):
	offset painting by 0.5 pixels on the brushes' even sized axes by
	shuffling the subsample matrices around.

	Added "subsampling" for HARD brush application mode since a pixel
	of an even sized brush can snap to up to four different image
	pixels depending on the sub-pixel coordinates of the stroke.
2003-07-14 14:50:41 +00:00
Michael Natterer
e47e8598af removed double semicolons.
2003-07-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppaintoptions-gui.c: removed double semicolons.
2003-07-14 14:26:42 +00:00
Michael Natterer
5f74672450 check if the active_tool is a GimpDrawTool before casting & accessing its
2003-07-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c: check if the active_tool is a
	GimpDrawTool before casting & accessing its members.
2003-07-14 14:02:34 +00:00
Michael Natterer
84e73fa4d1 removed gimp_display_shell_transform_boundary() again...
2003-07-10  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-transform.[ch]: removed
	gimp_display_shell_transform_boundary() again...

	* app/tools/gimpdrawtool.[ch]: ...and added as
	gimp_draw_tool_draw_boundary(). Removed the GimpDrawToolState enum
	and the "draw_state" member since they were redundant. Cleanup.

	* app/tools/gimpeditselectiontool.c: changed accordingly.

	* app/tools/gimppainttool.[ch]: added a brush preview so we
	finally see where we will paint. Fixes bug #32498. Cleanup.

	* app/tools/tool_manager.c: also look at draw_tool->gdisp, not
	only at tool->gdisp when deciding whether the active tool has to
	be suspended/resumed/halted. Fixes a couple of fnords with the
	line preview and the new brush preview.

	* app/tools/gimpcolortool.c: minor cleanup.
2003-07-10 16:01:45 +00:00
Michael Natterer
5096672060 app/core/gimpbrush.c app/paint/gimppaintcore.c app/tools/gimpcurvestool.c
2003-07-10  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpbrush.c
	* app/paint/gimppaintcore.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimptool.c
	* app/tools/tool_manager.h: removed trailing whitespace.
2003-07-10 12:13:21 +00:00
Michael Natterer
e8a7307a8f added "guchar threshold" parameters all over the place instead of always
2003-07-10  Michael Natterer  <mitch@gimp.org>

	* app/base/boundary.[ch]: added "guchar threshold" parameters all
	over the place instead of always using 127. Made the HALF_WAY
	#define public.
	(find_empty_segs): don't crash if PR->tiles is NULL but treat
	PR->data as the entire buffer so the function can be used on
	PixelRegions of TempBufs.

	* app/core/gimpchannel.c
	* app/core/gimplayer-floating-sel.c
	* app/tools/gimpfuzzyselecttool.c: pass HALF_WAY to
	find_mask_boundary().
2003-07-10 11:59:38 +00:00
Michael Natterer
b14c364490 added new function gimp_display_shell_transform_boundary() which takes an
2003-07-09  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-transform.[ch]: added new function
	gimp_display_shell_transform_boundary() which takes an array of
	BoundSegs and returns an array of GdkSegments.

	* app/tools/gimpeditselectiontool.c: use it.
2003-07-09 22:40:27 +00:00
Sven Neumann
a4f2a2d318 show the alpha value in percent as well (as suggested in bug #116384).
2003-07-08  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcolorpickertool.c: show the alpha value in percent
	as well (as suggested in bug #116384).
2003-07-08 00:20:31 +00:00
Sven Neumann
5c4020edf2 libgimpmath/gimpmathtypes.h moved struct declarations.
2003-07-07  Sven Neumann  <sven@gimp.org>

	* libgimpmath/gimpmathtypes.h
	* libgimpmath/gimpvector.h: moved struct declarations.

	* libgimpmath/gimpmatrix.[ch]: made GimpMatrix3 and GimpMatrix4
	structs instead of typedefs for arrays. Pass them by reference,
	not by value. Added lots of const qualifiers.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-transform-utils.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpdrawable.c
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimplayer.c
	* app/pdb/transform_tools_cmds.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.c
	* app/vectors/gimpvectors.c
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.
2003-07-07 13:50:48 +00:00
Sven Neumann
e78601452c app/gui/edit-commands.c added "Fill with Pattern" menu entry as suggested
2003-07-02  Sven Neumann  <sven@gimp.org>

	* app/gui/edit-commands.c
	* app/gui/image-menu.c: added "Fill with Pattern" menu entry as
	suggested in bug #116365.

	* app/base/temp-buf.c
	* app/base/tile-swap.c
	* app/config/gimpbaseconfig.c
	* app/config/gimpconfig-types.c
	* app/display/gimpdisplayshell-filter-dialog.c
	* app/display/gimpdisplayshell.c
	* app/file/file-utils.c
	* app/paint-funcs/paint-funcs-types.h
	* app/tools/gimpdrawtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.h
	* app/tools/gimptextoptions.c
	* app/paint-funcs/paint-funcs-types.h
	* app/vectors/gimpbezierstroke.c
	* app/vectors/gimpstroke.c
	* app/vectors/gimpvectors.c
	* app/vectors/vectors-types.h
	* libgimp/gimpbrushmenu.c
	* libgimp/gimpmisc.h
	* libgimpmodule/gimpmodule.c: fixed some minor issues found
	compiling with -pedantic.

	* app/pdb/misc_tools_cmds.c
	* tools/pdbgen/pdb/misc_tools.pdb: adapt to the changed order of
	arguments for gimp_image_pick_color().
2003-07-02 18:01:19 +00:00
Jakub Steiner
7e6b71c8fd app/gui/image-menu.c app/gui/plug-in-menus.c app/gui/toolbox-menu.c Added
2003-07-01  Jakub Steiner <jimmac@ximian.com>

* app/gui/image-menu.c
* app/gui/plug-in-menus.c
* app/gui/toolbox-menu.c
* app/tools/gimp*tool.c: Added mnemonics (bug #106991).
  Plug-ins and Script-Fus next.
2003-07-01 16:22:03 +00:00
Sven Neumann
4ebac2e791 app/base/base-enums.h app/paint/paint-enums.h use /*< pdb-skip, skip >*/,
2003-07-01  Sven Neumann  <sven@gimp.org>

	* app/base/base-enums.h
	* app/paint/paint-enums.h
	* app/tools/tools-enums.h: use /*< pdb-skip, skip >*/, updated the
	comment that explains how to use the trigraph sequences.

	* app/tools/tools-enums.c: regenerated.
2003-07-01 10:53:38 +00:00
Michael Natterer
8dd2e80792 Getting rid of some legacy filenames:
2003-06-29  Michael Natterer  <mitch@gimp.org>

	Getting rid of some legacy filenames:

	* app/core/Makefile.am
	* app/core/gimptooloptions.[ch]: new files.

	* app/paint/gimppaintoptions.h: changed #include accordingly.
	#define GIMP_PAINT_OPTIONS_CONTEXT_MASK here.

	* app/tools/paint_options.[ch]
	* app/tools/tool_options.[ch]: removed these files.

	* app/tools/gimppaintoptions-gui.[ch]
	* app/tools/gimptooloptions-gui.[ch]: new files.

	* app/tools/gimppainttool.h: removed GIMP_PAINT_TOOL_OPTIONS_MASK
	define again.

	* app/tools/Makefile.am
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcoloroptions.[ch]
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.[ch]
	* app/tools/gimpinkoptions.c
	* app/tools/gimpmagnifyoptions.[ch]
	* app/tools/gimpmeasureoptions.[ch]
	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpselectionoptions.[ch]
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptextoptions.[ch]
	* app/tools/gimptransformoptions.[ch]
	* app/tools/tool_manager.c
	* app/gui/tool-options-dialog.c: changed accordingly.

	* app/tools/tools.c: moved the vector tool before iscissors.
2003-06-29 20:40:45 +00:00
Michael Natterer
e14e158e70 removed enum GimpContextPropType and enum GimpContextPropMask.
2003-06-28  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.h: removed enum GimpContextPropType and
	enum GimpContextPropMask.

	* app/core/core-enums.[ch]: added them here.

	* app/core/gimptoolinfo.[ch]: replaced "gboolean tool_context"
	member by "GimpContextPropMask context_props" so each tool can
	specify exactly which context properties it wants to have
	persistently remembered.

	* app/tools/tools-types.h: changed typedef GimpToolRegisterCallback
	accordingly.

	* app/tools/tool_manager.[ch] (tool_manager_register_tool): ditto.

	Removed the "global_tool_context" and initialize all tool info
	objects from the user_context after creation. Removed the
	PAINT_OPTIONS_MASK #define and use the new context_props stored in
	tool_info insted.

	* app/tools/gimppainttool.h: #define the common properties of the
	paint tools as GIMP_PAINT_TOOL_OPTIONS_MASK (which is OPACITY |
	PAINT_MODE | BRUSH).

	* app/tools/[all tools].c (gimp_*_tool_register): replaced the
	"use_context" boolean by the actual mask of context properties the
	tools need.
2003-06-28 11:20:37 +00:00
Michael Natterer
d2e66f2aac new function which returns (draw_tool->gdisp != NULL).
2003-06-27  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.[ch] (gimp_draw_tool_is_active): new
	function which returns (draw_tool->gdisp != NULL).
2003-06-27 16:05:05 +00:00
Michael Natterer
e40a5b5370 added an entry for the text tool editor.
2003-06-27  Michael Natterer  <mitch@gimp.org>

	* app/gui/dialogs.c (toplevel_entries): added an entry for the
	text tool editor.

	* app/tools/gimptexttool.c (gimp_text_tool_editor): register
	the editor window with the dialog factory so it becomes
	session-menaged.
2003-06-27 14:26:04 +00:00
Simon Budig
1a80262e7e rewrote gimp_bezier_stroke_extend for the case when the neighbor is not
2003-06-26  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpbezierstroke.c: rewrote gimp_bezier_stroke_extend
        for the case when the neighbor is not really an end point of the
        stroke, but close enough to the end to still be acceptable.

        * app/tools/gimpvectortool.c: Make the tool behave sanely
        and more symetrically (both ends of a stroke behave basically the
        same now), gimp_draw_on_handle () now prefers the anchor passed
        into it via the *ret_anchor parameter over other preferred anchors.
2003-06-26 09:54:56 +00:00
Simon Budig
ca50643729 If an control handle gets converted to an edge simply move it to its next
2003-06-25  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpbezierstroke.c: If an control handle gets
        converted to an edge simply move it to its next anchor.

        * app/tools/gimpvectortool.c: Improved interactive handling
        of vectors. Still work in progress, esp. I am not sure about
        the assignment of the modifier keys. Right now it is:

           Drag (Anchor/Handle): Regular Movement
           Shift-Click (Anchor): select multiple anchors (does not work yet)
           Shift-Drag: (Handle): move opposite handle symmetrically
           Ctrl-Drag (Anchor): Drag out control point
           S-C-Click: (Anchor/Handle): Convert to Edge
2003-06-24 23:11:13 +00:00
Sven Neumann
f30586d112 app/config/gimpconfig.[ch] app/config/gimpconfigwriter.[ch] added support
2003-06-23  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig.[ch]
	* app/config/gimpconfigwriter.[ch]
	* app/config/gimpscanner.[ch]: added support for serializing to
	and deserializing from strings. Had to do some smaller changes to
	the GimpConfig API.

	* app/config/test-config.c: added a simple test for the new
	functions.

	* app/config/gimpconfig-dump.c
	* app/config/gimprc.c
	* app/core/gimp-documents.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimpunits.c
	* app/gui/session.c
	* app/plug-in/plug-in-rc.c
	* app/tools/tool_options.c
	* app/widgets/gimpdevices.c: follow GimpConfig API changes.

	* libgimpbase/gimpparasite.[ch]: declared the return value of
	gimp_parasite_data() as gconstpointer.
2003-06-23 22:02:56 +00:00
Hans Breuer
9768e4beee replace the win9x specific cd .... with the portable cd ..\..\..
2003-06-19  Hans Breuer  <hans@breuer.org>

	* makefile.msc : replace the win9x specific cd ....
	with the portable cd ..\..\..

	* **/makefile.msc : updated

	* plug-ins/xjt/xjt.c plug-ins/common/psd_save.c :
	there is still no unistd.h with msvc build
2003-06-19 09:57:35 +00:00
Sven Neumann
b39f8fb809 expects the tool identifier as a GQuark now.
2003-06-10  Sven Neumann  <sven@gimp.org>

	* app/gui/tools-commands.c (tools_select_cmd_callback): expects
	the tool identifier as a GQuark now.

	* app/gui/image-menu.c: changed accordingly. Removed code that
	used to move the menu entries for the color correction tools to
	the Layers menu. Added the respective menu entries by hand. Added
	a menu entry for arbitrary rotations and one for Select by Color.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: register the color correction
	tools in the Tools menu.

	* app/tools/gimptransformtool.c: added an initialize method and
	moved most initalization code from button_press to this place.
2003-06-10 14:31:53 +00:00
Sven Neumann
bc93e4a041 added "in_toolbox"; defaults to TRUE.
2003-06-06  Sven Neumann  <sven@gimp.org>

	* app/core/gimptoolinfo.[ch]: added "in_toolbox"; defaults to TRUE.

	* app/tools/tool_manager.c: set "in_toolbox" to FALSE for tools
	derived from GimpImageTool.

	* app/widgets/gimptoolbox.c: respect the new flag when constructing
	the toolbox.
2003-06-06 14:58:20 +00:00
Sven Neumann
e23a566f52 removed unneeded includes.
2003-06-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcolortool.c: removed unneeded includes.

2003-06-05  Sven Neumann  <sven@gimp.org>

	* POTFILES.in: added app/tools/gimpcoloroptions.c
2003-06-05 20:42:38 +00:00
Sven Neumann
a6988b2746 simplified by using the functions inherited from GimpColorTool.
2003-06-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c: simplified by using the functions
	inherited from GimpColorTool.
2003-06-05 20:29:03 +00:00
Sven Neumann
b1c437b4f8 use OPAQUE_OPACITY instead of 255.
2003-06-05  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdrawable.c (gimp_drawable_get_color_at):
	* app/core/gimpimage-projection.c (gimp_image_projection_get_color_at):
	use OPAQUE_OPACITY instead of 255.

	* app/core/gimpimage-pick-color.[ch]: factored out code that
	averages over colors so it can be used from GimpImageTool.

	* app/tools/gimpimagemaptool.[ch]: derived from GimpColorTool and
	added a GimpColorTool::pick implementation.

	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcolorpickeroptions.c: add the toggle for
	"sample_merged" in gimp_color_picker_options_gui().

	* app/tools/gimpcolortool.c (gimp_color_tool_cursor_update): check
	if the cursor is over the active drawable or if "sample_merged" is
	active.

	* app/tools/gimplevelstool.c: simplified since all color-picking is
	now handled by the parent classes. Fixes bug #112668.
2003-06-05 18:47:23 +00:00
Sven Neumann
21b4aba939 changed the default radius.
2003-06-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcoloroptions.c: changed the default radius.

	* app/tools/gimpcolortool.[ch]: pass GimpColorOptions to
	gimp_color_tool_enable(). Added gimp_color_tool_disable() and
	gimp_color_tool_is_enabled().

	* app/tools/gimpcolorpickertool.c: changed accordingly.

	* app/tools/gimppainttool.[ch]: derived GimpPaintTool from
	GimpColorTool and removed most color picking code.

	* app/tools/gimpdodgeburntool.c (gimp_dodgeburn_tool_modifier_key)
	* app/tools/gimperasertool.c (gimp_eraser_tool_modifier_key):
	chain up to the parent class.

	* app/tools/gimppaintbrushtool.c: purely cosmetic change.
2003-06-05 15:43:49 +00:00
Sven Neumann
b108d7028b added VOID: ENUM, BOXED, INT.
2003-06-04  Sven Neumann  <sven@gimp.org>

	* app/core/gimpmarshal.list: added VOID: ENUM, BOXED, INT.

	* app/tools/gimpcolortool.[ch]: added a default implementation for
	GimpColorTool::pick. Emit a "picked" signal when a color was
	successfully picked.

	* app/tools/gimpcolorpickertool.c: simplified a lot since
	GimpColorTool does most of the work for us now.
2003-06-04 20:23:36 +00:00
Sven Neumann
9d2cc5f82a reordered arguments.
2003-06-04  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-pick-color.[ch]: reordered arguments.

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimppainttool.c: changed accordingly.
2003-06-04 16:42:46 +00:00
Sven Neumann
737bf44e28 app/tools/Makefile.am app/tools/gimpcoloroptions.[ch] new files that
2003-06-04  Sven Neumann  <sven@gimp.org>

        * app/tools/Makefile.am
        * app/tools/gimpcoloroptions.[ch]
        * app/tools/gimpcolortool.[ch]: new files that implement base
        classes moved out of GimpColorPickerOptions and GimpColorPickerTool.

        * app/tools/gimpcolorpickeroptions.[ch]
        * app/tools/gimpcolorpickertool.[ch]: derive from the new obejcts.

        * app/tools/gimpimagemaptool.h
        * app/tools/gimppainttool.c
        * app/tools/tools-types.h: moved typedefs into the types file.
2003-06-04 15:48:17 +00:00
Michael Natterer
15b9be6a2c added enum GimpTransformType which can be one of { LAYER, SELECTION, PATH
2003-05-31  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools-enums.[ch]: added enum GimpTransformType which
	can be one of { LAYER, SELECTION, PATH }

	* app/tools/gimptransformoptions.[ch]: added a GimpTransformType
	property to GimpTransformOptions. Added a GUI for the new
	option.

	* app/tools/gimpflipoptions.[ch]: derive it from
	GimpTransformOptions and add the GUI here, too.

	* app/tools/gimpfliptool.c
	* app/tools/gimptransformtool.[ch]: added support for transforming
	the selection. Added framework for transforming paths (still
	unimplemented).

	* app/tools/gimpselectionoptions.c: small cleanup.

	* libgimpwidgets/gimpstock.[ch]
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-path-16.png
	* themes/Default/images/stock-path-22.png
	* themes/Default/images/stock-selection-16.png: new icons for the
	new transform options buttons. Simply copied existing ones...
2003-05-30 23:52:24 +00:00
Sven Neumann
f7f09188f2 don't stop the active tool, the tool manager did this already when the
2003-05-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_button_release): don't stop the active
	tool, the tool manager did this already when the edit-selection
	tool was pushed.
2003-05-30 15:50:46 +00:00
Michael Natterer
bbc102f9cf app/display/gimpdisplayshell-callbacks.c app/tools/gimpcolorpickertool.c
2003-05-28  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptextoptions.c
	* app/tools/gimptransformtool.c
	* app/tools/paint_options.c
	* app/tools/tool_manager.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox-color-area.c:
	don't #include "gui/dialogs.h" to get the global factories but use
	gimp_dialog_factory_from_name() instead.
2003-05-28 17:23:54 +00:00
Michael Natterer
8addf4daa6 app/tools/gimpfreeselecttool.[ch] added the possibility to <alt>+drag the
2003-05-27  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpfreeselecttool.[ch]
	* app/tools/gimprectselecttool.[ch]: added the possibility to
	<alt>+drag the whole selection preview line *while* creating the
	selection. Used a modified version of
	http://aeropc5.hut.fi/~mjkorhon/gimp-move-selection.patch (found
	in the mailing list archives). Fixes bug #87688.
2003-05-27 11:52:03 +00:00
Michael Natterer
707e597665 added "gint ref_count" to the TileManager struct.
2003-05-26  Michael Natterer  <mitch@gimp.org>

	* app/base/tile-manager-private.h: added "gint ref_count" to the
	TileManager struct.

	* app/base/tile-manager.[ch]: replaced tile_manager_destroy()
	by tile_manager_ref() and tile_manager_unref().

	* app/core/gimpimage-undo-push.c: ref the tile managers stored in
	the undo system and DON'T destroy them if no undo could be pushed.
	Should fix the remaining crashes with undo disabled like in
	bug #9350.

	(!!!) Note that the tiles passed to gimp_image_undo_push_image()
	and gimp_drawable_push_undo() as well as the tile managers of
	drawables passed to gimp_image_undo_push_[layer|channel]_mod()
	must be unref'ed by the caller now.

	* app/core/gimpdrawable-transform.c (gimp_drawable_transform_paste):
	don't take ownership of the passed tiles but ref them if needed.

	(!!!) Callers must unref the passed tiles themselves now.

	* app/core/gimpbuffer.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage.c
	* app/core/gimpimagemap.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/paint/gimppaintcore.c
	* app/text/gimptextlayer.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimptransformtool-undo.c
	* app/tools/gimptransformtool.c: changed accordingly.
2003-05-26 17:02:06 +00:00
Pedro Gimeno
2f31d12f86 Fix off-by-one when dragging the selection. Fixes the last pending issue
2003-05-26  Pedro Gimeno  <pggimeno@wanadoo.es>

	* app/tools/gimpeditselectiontool.c (selection_transform_segs):
	Fix off-by-one when dragging the selection. Fixes the last pending
	issue of bug #17904. Use temporary variables for clamp values.

	* app/display/gimpdisplayshell-selection.c
	(selection_transform_segs): Perform the clamping that fixes
	bug #110014 here instead of in the callers. Solves a rare case
	that was not properly handled before.
	(selection_render_points, selection_generate_segs): Remove the
	clamping code from here.

	* app/tools/gimpdrawtool.c (gimp_draw_tool_draw_rectangle): More
	clampings to avoid overflow of 16-bit coordinates.
2003-05-25 23:23:34 +00:00
Michael Natterer
dd9a0a4a63 Use g_object_[set|get]_qdata(), not just _data() to speed up tool manager
2003-05-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.[ch] (tool_manager_set,get): Use
	g_object_[set|get]_qdata(), not just _data() to speed up tool
	manager access.

	Removed tool_manager_active_get_help_data() and
	tool_manager_help_func().

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c: use gimp_standard_help_func and
	tool->tool_info->help_data instead. Don't #include "tool_manager.h".
2003-05-25 17:16:59 +00:00
Hans Breuer
89bfbdf66d updated win32 (msvc) build
2003-05-24  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc **/*.def : updated win32 (msvc) build

	* plug-ins/twain/twain.c plug-ins/winsnap/winsnap.c :
	add the extra parameter to gimp_main() calls
2003-05-24 17:00:03 +00:00
Sven Neumann
83a2f4983e app/paint/gimppaintcore.c applied a patch from Henning Makholm
2003-05-23  Sven Neumann  <sven@gimp.org>

	* app/paint/gimppaintcore.c
	* app/tools/gimppainttool.c: applied a patch from Henning Makholm
	<henning@makholm.net> that improves drawing of narrow straight lines
	by moving the endpoints to pixel centers. Fixes bug #84145.
2003-05-23 13:22:38 +00:00
Michael Natterer
487f71ba05 Removed the old paths and the remaining legacy stuff it needed. Fixes bug
2003-05-21  Michael Natterer  <mitch@gimp.org>

	Removed the old paths and the remaining legacy stuff it needed.
	Fixes bug #104471.

	* Makefile.am
	* configure.in
	* pixmaps/*: removed the pixmaps/ directory.

	* app/ops_buttons.[ch]
	* app/path.[ch]
	* app/pathP.h
	* app/path_transform.h
	* app/gui/paths-dialog.[ch]
	* app/tools/gimpbezierselecttool.[ch]: removed these files.

	* app/Makefile.am
	* app/gui/Makefile.am
	* app/tools/Makefile.am: changed accordingly.

	* app/core/core-types.h: removed the Path* types.

	* app/core/gimpimage.[ch]
	* app/core/gimpimage-duplicate.c: removed gimage->paths.

	* app/gui/about-dialog.c: inline wilber2_xpm for now.

	* app/gui/dialogs-constructors.c
	* app/gui/dialogs-menu.c
	* app/gui/dialogs.c
	* app/gui/menus.c: removed the old paths dialog.

	* app/gui/gui.c: removed gui_rotate_the_shield_harmonics() hack
	which was broken anyway.

	* app/tools/gimptransformtool.c: #if 0 path_transform preview stuff.

	* app/tools/gimpiscissorstool.c: removed useless include.

	* app/tools/tools.c: removed the bezier select tool.

	* app/vectors/gimpvectors.c (gimp_vectors_real_stroke_add): use
	g_list_append(), not g_list_prepend() so some ugly side conditions
	of legacy path loading are honored.

	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c: load and save only GimpVectors.
2003-05-21 17:38:14 +00:00
Simon Budig
9c811f25d0 Extended to be able to handle multiple polygons in a sane way.
2003-05-21  Simon Budig  <simon@gimp.org>

	* app/core/gimpscanconvert.[ch]: Extended to be able to handle
	multiple polygons in a sane way.

	* app/core/gimpimage-mask-select.c: Use this to convert
	multiple-stroke vectors objects to selections. Libart rocks!

	* app/tools/gimpiscissorstool.c: Changed accordingly.

	(The previous commit did not run cleanly)
2003-05-21 01:02:37 +00:00
Michael Natterer
49b851780e fixed to work like gimp_hls_to_rgb_int() (does the right thing now for the
2003-05-19  Michael Natterer  <mitch@gimp.org>

	* libgimpcolor/gimpcolorspace.c (gimp_hsl_to_rgb): fixed to work
	like gimp_hls_to_rgb_int() (does the right thing now for the
	saturation == 0 case). Some minor cleanups.

	Implemented "Colorize" as suggested in bug #20509. It's not a
	toggle in the "Hue/Saturation" tool dialog (which would be a gross
	hack IMHO) but a separate tool. Fixes bug #20509.

	* app/base/Makefile.am
	* app/base/base-types.h
	* app/base/colorize.[ch]: the actual mapping function lives
	here. Its algorithm was taken from the "colorify" plug-in.

	* app/tools/Makefile.am
	* app/tools/gimpcolorizetool.[ch]: the tool.

	* app/tools/tools.c: register it.

	* app/gui/dialogs.c: session-manage its dialog.

	* libgimpwidgets/gimpstock.[ch]
	* themes/Default/images/Makefile.am
	* themes/Default/images/tools/stock-tool-colorize-16.png
	* themes/Default/images/tools/stock-tool-colorize-22.png: new
	icons from Jimmac.

	Unrelated:

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: don't #include "tool_manager.h"
2003-05-19 14:21:03 +00:00
Simon Budig
0174bb6d6a Implemented closed paths. Not yet available in a sane manner via the UI.
2003-05-19  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpbezierstroke.[ch]: Implemented closed paths. Not
	yet available in a sane manner via the UI. Added the last missing
	line from gimp_bezier_stroke_interpolate ().

	* app/tools/gimpvectortool.c: Changed accordingly

	* app/vectors/gimpstroke.[ch]
	* app/vectors/gimpvectors.[ch]: removed Tabs.
2003-05-18 23:08:01 +00:00
Michael Natterer
c44bf94c5a app/tools/gimptransformtool.c removed old path undo stuff.
2003-05-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.c
	* app/tools/gimptransformtool-undo.[ch]: removed old path undo stuff.
2003-05-18 10:44:09 +00:00
Michael Natterer
9981c4645c added "gboolean cut_image" parameter so we can float selections without
2003-05-16  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch] (gimp_image_mask_extract): added
	"gboolean cut_image" parameter so we can float selections
	without cutting them from the original drawable.

	* app/gui/select-commands.c
	* tools/pdbgen/pdb/selection.pdb: pass cut_image == TRUE.

	* app/pdb/selection_cmds.c: regenerated.

	* app/tools/tools-enums.[ch]: added SELECTION_MOVE_COPY value
	to the SelectOps enum.

	* app/tools/gimpselectiontool.c: use the new mode when
	<ctrl>+<alt>-dragging a selction (yes, this is evil but there are
	no modifiers left).

	* app/tools/gimpeditselectiontool.[ch]: extended EditType enum by
	EDIT_MASK_COPY_TO_LAYER_TRANSLATE and pass cut_image == FALSE if
	it's passed to init_edit_selection().

	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimprectselecttool.c: pass the new mode to
	GimpEditSelectionTool.
2003-05-16 12:10:47 +00:00
Michael Natterer
a4395cead9 added "gboolean clip_result" to GimpItem::flip().
2003-05-13  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: added "gboolean clip_result" to
	GimpItem::flip().

	* app/vectors/gimpvectors.c
	* app/tools/gimpfliptool.c: changed accordingly.

	* app/core/gimpdrawable.c: implement GimpItem::flip() and
	GimpItem::transform().

	* app/core/gimpchannel.c
	* app/core/gimplayer.c: chain up in flip() and transform() and do
	only the layer/channel specific stuff here.

	* app/core/gimpdrawable-transform.[ch]: fixed indentation.
	(gimp_drawable_transform_tiles_flip): added "gboolean clip_result"
	and warn that it is not yet implemented.
	(gimp_drawable_transform_tiles_affine): when transforming a
	channel set bg_color to transparent. Clip channels (but not layer
	masks) only if the passed tiles have bpp == 1 (the channel is
	unfloated).
	(gimp_drawable_transform_affine): clip all unfloated channels.

	* app/core/gimpitem-linked.[ch]: added gimp_item_linked_get_list()
	utility function to avoind iterating all layers/channels/vectors
	in all functions.

	* app/tools/gimptransformtool.c: clip all unfloated channels.

	The clipping fixes above together fix bug #112858.
2003-05-13 13:57:11 +00:00
Michael Natterer
45334e637e Added support for transforming linked layers, channels and vectors. Fixes
2003-05-12  Michael Natterer  <mitch@gimp.org>

	Added support for transforming linked layers, channels
	and vectors. Fixes bug #86277.

	* app/core/gimpdrawable-transform.[ch]
	(gimp_drawable_transform_tiles_flip): added "gdouble axis" and
	calculate the resulting drawable offset.
	(gimp_drawable_transform_flip): calculate the axis and pass it to
	the function above.
	(gimp_drawable_transform_[tiles_]affine): reordered parameters.

	* app/core/gimpitem.[ch]: added virtual functions GimpItem::flip()
	and GimpItem::transform().

	* app/core/gimpchannel.c
	* app/core/gimplayer.c
	* app/vectors/gimpvectors.c: implement flip() and transform().
	Note that all functions always transform the whole item,
	regardless of a present selection.

	* app/core/Makefile.am
	* app/core/gimpitem-linked.[ch]: new files containing utility
	functions which translate, flip and transform all linked items.

	* app/tools/gimpfliptool.c
	* app/tools/gimptransformtool.c
	* tools/pdbgen/pdb/layer.pdb: use the new gimp_item_linked_*()
	functions to translate, flip and transform all linked items.

	* tools/pdbgen/pdb/transform_tools.pdb: follow
	gimp_drawable_transform_affine() API change.

	* app/pdb/layer_cmds.c
	* app/pdb/transform_tools_cmds.c: regenerated.
2003-05-12 15:56:36 +00:00
Michael Natterer
305dc2ffd7 make sure that active_tool->tool_info is non-NULL before dereferencing it.
2003-05-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c (tool_manager_tool_changed): make sure
	that active_tool->tool_info is non-NULL before dereferencing it.
	(Spotted by Ville Ptsi).
2003-05-12 14:11:37 +00:00
Sven Neumann
2182fb816a initialize scale to please the compiler.
2003-05-09  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmagnifytool.c (gimp_magnify_tool_button_release):
	initialize scale to please the compiler.
2003-05-09 19:57:38 +00:00
Michael Natterer
457368140d added "gboolean push_undo" to GimpItem::translate() and don't push and
2003-05-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: added "gboolean push_undo" to
	GimpItem::translate() and don't push and undo in
	gimp_item_translate().

	* app/core/gimpchannel.[ch]: removed public function
	gimp_channel_translate() and implement GimpItem::translate().

	* app/core/gimpimage-mask.c
	* app/core/gimplayer.c: changed accordingly.

	* app/vectors/gimpvectors.c: actually translate the vectors
	in translate().

	* app/gui/channels-commands.c (channels_new_channel_query): removed
	useless call to gimp_channel_translate().

	* app/tools/gimpeditselectiontool.c
	* tools/pdbgen/pdb/layer.pdb: when translating a linked layer,
	also translate all linked channels and vectors. Cleanup.

	Note that the "linked" behaviour has changed: before this change,
	moving a layer moved all linked layers unconditionally. Now,
	linked layers/channels/vectors are moved *only* if the moved layer
	is also linked (the linked items behave as a group now and moving
	something not in the group does not affect the group).

	* app/pdb/layer_cmds.c: regenerated.
2003-05-09 13:05:37 +00:00
Michael Natterer
882a8eca80 added default implementations for scale() and resize() which just set the
2003-05-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.c: added default implementations for scale()
	and resize() which just set the resulting width/height and offset
	values.

	* app/core/gimpdrawable.c: chain up in scale() and resize().

	* app/vectors/gimpvectors.[ch]: buncha vectors changes/features:

	- Removed unused "linked" and "locked" members.
	- Removed "changed" signal.
	- Added "freeze" and "thaw" signals and functions to emit them.
	- Added "freeze_count" member so we emit only one freeze/thaw pair
	  even when doing nested changes.
	- Added GimpItem::translate() implementation.
	- Actually scale and resize the vectors in scale() and resize().
	- Added undo for scale() and resize().
	- Added freeze()/thaw() pairs around all modifying functions.
	- Changed gimp_vectors_copy_strokes() to work as needed.

	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c: resize and scale all vectors.
	Fixes bug #36491.

	* app/core/gimpimage-undo-push.c (undo_pop_vectors_mod): added
	freeze()/thaw() around the vectors-modifying code. Also restore
	width, height and offsets.

	* app/tools/gimpvectortool.c: connect to "freeze" and "thaw"
	and pause()/resume() vectors drawing accordingly.
2003-05-09 00:38:51 +00:00
Michael Natterer
33b7d779d6 removed "linked" member and API...
2003-05-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayer.[ch]: removed "linked" member and API...

	* app/core/gimpitem.[ch]: ...and added it here.

	* app/core/core-enums.[ch]
	* app/core/gimpimage-undo-push.[ch]: changed layer_linked undo
	types and functions to be item_linked ones.

	* app/tools/gimpeditselectiontool.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb: changed accordingly.

	* app/pdb/layer_cmds.c: regenerated.

	* app/widgets/gimplayertreeview.[ch]: removed "linked" icon and
	functions...

	* app/widgets/gimpitemtreeview.[ch]: and added them here. Setting
	channels or vectors to "linked" does nothing yet.
2003-05-08 20:26:01 +00:00
Michael Natterer
766930db38 added width, height, offset_x and offset_y parameters.
2003-05-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch] (gimp_item_configure): added width,
	height, offset_x and offset_y parameters.

	* app/core/gimpdrawable.c
	* app/vectors/gimpvectors.c: changed accordingly.

	* app/tools/gimpfliptool.c: removed unused variable.
2003-05-08 14:21:39 +00:00
Michael Natterer
c1ab39a5e8 removed gimp_drawable_offsets().
2003-05-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.[ch]: removed gimp_drawable_offsets().

	* app/core/gimpitem.[ch]: added gimp_item_offsets().

	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-histogram.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-mask-select.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-pick-color.c
	* app/core/gimpimage-preview.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpimage.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-transform.c
	* app/display/gimpdisplayshell.c
	* app/gui/channels-commands.c
	* app/gui/layers-commands.c
	* app/paint/gimppaintcore.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptoolbox.c
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/drawable.pdb: changed accordingly.

	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c: regenerated.
2003-05-08 14:06:03 +00:00
Michael Natterer
54878b79ce removed gimp_drawable_width,height().
2003-05-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.[ch]: removed gimp_drawable_width,height().

	* app/core/gimpitem.[ch]: added gimp_item_width,height().

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable-preview.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-preview.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpimage.c
	* app/core/gimpimagemap.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimpscanconvert.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell.c
	* app/gui/channels-commands.c
	* app/gui/layers-commands.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimppaintcore.c
	* app/paint/gimpsmudge.c
	* app/text/gimptextlayer.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptoolbox.c
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/selection.pdb: changed accordingly.

	* app/pdb/drawable_cmds.c
	* app/pdb/selection_cmds.c: regenerated.
2003-05-08 13:12:46 +00:00
Michael Natterer
4136e61ddc More transform virtualization preparation:
2003-05-08  Michael Natterer  <mitch@gimp.org>

	More transform virtualization preparation:

	* app/core/gimpdrawable.[ch]: removed "width", "height", "offset_x"
	and "offset_y"...

	* app/core/gimpitem.[ch]: ...and added them here.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-preview.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-qmask.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/text/gimptext-compat.c
	* app/text/gimptextlayer.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimppreviewrendererdrawable.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb: changed accordingly.

	* app/pdb/layer_cmds.c: regenerated.
2003-05-08 11:52:31 +00:00
Michael Natterer
f3747dbac2 removed GimpToolState (ACTIVE, INACTIVE).
2003-05-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools-enums.[ch]: removed GimpToolState (ACTIVE,
	INACTIVE).

	* app/tools/gimptoolcontrol.[ch]: replaced "GimpToolState state"
	by "gboolean active".

	* app/tools/gimptool.c (gimp_tool_control)
	* app/tools/tool_manager.c (tool_manager_control_active): check
	for gimp_tool_control_is_active() before calling
	gimp_tool_control_halt().
2003-05-06 11:11:15 +00:00
Michael Natterer
1317d1809e added g_return_if_fail (gimp_tool_control_is_active (tool->control)) since
2003-05-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.c (gimp_tool_motion): added
	g_return_if_fail (gimp_tool_control_is_active (tool->control))
	since that's a basic constraint of tool event handling.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimprectselecttool.c (gimp_*_tool_motion):
	removed checks for gimp_tool_control_is_active().
2003-05-06 10:30:34 +00:00
Pedro Gimeno
9e7d814ac8 Cleanups. (gradient_calc_linear_factor): Apply the gradient to both sides
2003-05-05  Pedro Gimeno  <pggimeno@wanadoo.es>

	* app/core/gimpdrawable-blend.c: Cleanups.
	(gradient_calc_linear_factor): Apply the gradient to both sides
	when Repeat is set to Sawtooth Wave. Fixes bug #112106.

	* app/core/gimpdrawable-transform.c
	(gimp_drawable_transform_tiles_affine): Fix copy'n'paste slip in
	coordinates calculation for supersampling code. Transform the
	pixel centers properly. Fixes bug #10466.

	* app/tools/gimpdrawtool.c (gimp_draw_tool_draw_rectangle,
	gimp_draw_tool_draw_arc): Ported the fix for bug #17904 from the
	STABLE branch (off-by-one when drawing the rectangle/ellipse
	previews).

	* app/tools/gimpeditselectiontool.c: Renamed
	gimp_edit_selection_tool_snap to
	gimp_edit_selection_tool_calc_coords, as it is no longer used for
	snapping.
	(gimp_edit_selection_tool_calc_coords): Use floor instead of
	rounding. Callers changed to remove rounding, as it deals with
	gdoubles directly. Thanks to Mitch for the help refining this
	one. Fixes bug #17906.
2003-05-05 18:45:58 +00:00
Michael Natterer
1204865d04 new utility function which takes GimpZoomType and zooms "scalesrc" and
2003-05-05  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-scale.[ch]
	(gimp_display_shell_scale_zoom_fraction): new utility function
	which takes GimpZoomType and zooms "scalesrc" and "scaledest".
	(gimp_display_shell_scale_calc_fraction): new utility function
	which takes an exact double scale factor and calculates "scalesrc"
	and "scaledest".

	(gimp_display_shell_scale): use the first.
	(gimp_display_shell_scale_fit): use the second.

	* app/tools/gimpmagnifytool.[ch]: use the first to click-zoom and
	the second to area-zoom. Fixes bug #112115. Removed zoom_in() and
	zoom_out() utiliy functions. Removed "GimpZoomType op" from the
	GimpMagnifyTool struct. Cleanup.
2003-05-05 14:48:15 +00:00
Michael Natterer
c18b6554b1 app/gui/dialogs.c app/tools/gimphistogramtool.c register their dialogs
2003-05-03  Michael Natterer  <mitch@gimp.org>

	* app/gui/dialogs.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpmeasuretool.c: register their dialogs too.
2003-05-03 09:56:25 +00:00
Michael Natterer
fefaf61b28 added new function gimp_dialog_factory_add_foreign() which adds a dialog
2003-05-02  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added new function
	gimp_dialog_factory_add_foreign() which adds a dialog that was not
	created by the factory itself. Its identifier however must be
	registered with the factory. Connect to all toplevel dialogs'
	"configure_event" and remember the resulting window geometry so we
	get session management for *all* dialogs, not only for those which
	were open on exit.

	* app/gui/dialogs.c: added the "File New" dialog. Added foreign
	entries (without constructor) for all dialogs opened by tools.

	* app/gui/dialogs-constructors.[ch]: added a constructor for
	the file_new dialog.

	* app/gui/file-new-dialog.[ch]: renamed file_new_dialog_create()
	to file_new_dialog_new() and removed the gimage and template
	paramaters. Adder new function file_new_dialog_set() to set
	gimage and template after creation.

	* app/gui/file-commands.c
	* app/gui/templates-commands.c: changed accordingly.

	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimptransformtool.[ch]: added
	"const gchar *shell_identifier" to the tool structs. Register the
	tool dialogs using gimp_dialog_factory_add_foreign().

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimpthresholdtool.c: set "shell_identifier" so the
	dialogs become session managed. Fixes bug #61091.

	* app/tools/gimpcroptool.c: register the crop dialog with the
	dialog factory. Fixes bug #52849.

	* app/tools/gimpcolorpickertool.c: ditto.

	Unrelated:

	* app/tools/gimptool.c: no need to cast the return value of
	g_object_new().
2003-05-02 18:43:15 +00:00
Michael Natterer
d5edd5308e added an API to specify a "snap_offset" and a "snap_width/height". Needed
2003-04-17  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptoolcontrol.[ch]: added an API to specify a
	"snap_offset" and a "snap_width/height". Needed for tools which
	want to snap to a rectangle and/or a position which is not the
	current cursor position.

	* app/display/gimpdisplayshell.[ch]: removed
	gimp_display_shell_find_guide(), gimp_display_shell_snap_point()
	and gimp_display_shell_snap_rectangle().
	Added gimp_display_shell_snap_coords() which works on GimpCoords
	and gets passed the above snap offsets.

	* app/display/gimpdisplayshell-callbacks.c: use the new snap
	function, using the values from GimpToolControl.

	* app/tools/gimpcroptool.c: set snap offsets so the handles can be
	guide-aligned after creating. Fixes bug #110957.

	* app/tools/gimpeditselectiontool.c: removed snapping code (which
	was broken anyway) and set appropriate snap offsets in
	init_edit_selection().
2003-04-17 02:57:33 +00:00
Michael Natterer
8cee4963fb check for GIMP_IS_DISPLAY(gdisp) again.
2003-04-15  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.c: check for GIMP_IS_DISPLAY(gdisp) again.

	* app/tools/gimptool.h: don't #include "gimptoolcontrol.h"

	* app/tools/[all tools].c: #include "gimptoolcontrol.h"
2003-04-15 16:05:52 +00:00
Sven Neumann
032c13098d app/tools/Makefile.am app/tools/gimptoolgui.[ch] removed unused files.
2003-04-15  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimptoolgui.[ch]
	* app/tools/gimptoolmodule.[ch]: removed unused files.
2003-04-15 14:24:03 +00:00
Sven Neumann
0c399e5c93 Removed support for pluggable tools:
2003-04-15  Sven Neumann  <sven@gimp.org>

	Removed support for pluggable tools:

	* configure.in: bumped version number to 1.3.15.

	* Makefile.am
	* libgimpproxy
	* libgimptool
	* plug-ins/Makefile.am
	* plug-ins/plugin-helper
	* plug-ins/tools: removed libgimpproxy, libgimptool and plug-ins
	that used it.

	* tools/Makefile.am
	* tools/gimp-mkproxy: removed tool that used to generate
	libgimpproxy.

	* app/core/core-enums.h
	* app/core/gimpchannel.h
	* app/display/display-types.h
	* app/widgets/widgets-enums.h: removed proxy-skip/resume stuff.

	* app/core/gimpobject.c: use gimp marshallers.

	* app/tools/Makefile.am
	* app/tools/gimptool.h
	* app/tools/tools-enums.[ch]: moved these files back from
	libgimptool.

	* app/tools/gimptool.c
	* app/tools/gimptoolcontrol.h: merged back functionality from
	libgimptool.

	* app/Makefile.am
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/tools-commands.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpbucketfilltool.h
	* app/tools/gimpdrawtool.h
	* app/tools/gimpimagemaptool.h
	* app/tools/gimpinktool.h
	* app/tools/gimptoolmodule.c
	* app/tools/tool_manager.c
	* app/tools/tools-types.h
	* app/tools/tools.c
	* tools/pdbgen/Makefile.am: changed accordingly.
2003-04-15 14:20:19 +00:00
Michael Natterer
1d5d809c93 use a smaller preview size for the gradient popup than for the button.
2003-04-15  Michael Natterer  <mitch@gimp.org>

	* app/tools/paint_options.c (gimp_paint_options_gui): use a smaller
	preview size for the gradient popup than for the button.
2003-04-15 11:11:25 +00:00
Michael Natterer
21cd66d275 made gimp_vector_tool_clear_vectors() private. Connect to the vector's
2003-04-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.[ch]: made
	gimp_vector_tool_clear_vectors() private. Connect to the vector's
	"changed" signal (and do nothing in the callback for now...).
	Alwayws set tool->gdisp in button_press(). Use for() loops to
	iterate strokes. Fixed gimp_vector_tool_set_vectors() to hopefully
	do the right thing in all cases now. s/ptr/list/g. Cleanup.
2003-04-14 14:52:00 +00:00
Simon Budig
740983b06f app/vectors/gimpstroke.[ch] Changed vectors->strokes to a GList and
2003-04-14  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpstroke.[ch]
        * app/vectors/gimpvectors.[ch]: Changed vectors->strokes to a
        GList and removed stroke->next. Implemented stuff for duplicating
        strokes. Duplicating a vector works now.

        * app/tools/gimpvectortool.c: added not-yet-used function to
        determine where a click has been. Refcounting stuff changed.

        * app/core/gimpimage-mask-select.c
        * app/paint/gimppaintcore-stroke.c: Changed accordingly.
2003-04-14 00:37:04 +00:00
Michael Natterer
4799083c69 g_memdup() the segments returned by gimp_image_mask_boundary(). Just
2003-04-13  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c (init_edit_selection):
	g_memdup() the segments returned by gimp_image_mask_boundary().
	Just caching the pointers leads to bug #22375 because the image's
	mask boundary changes while we live-move stuff.

	* app/tools/gimpmovetool.c (gimp_move_tool_button_press): pause
	the selection when starting to move a guide, since we also resume
	it when we're finished.

	(both bugs tracked down by Pedro Gimeno).
2003-04-13 11:43:47 +00:00
Michael Natterer
a4be816fa6 app/widgets/gimpcontainerpopup.[ch] added "preview_size" and
2003-04-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerpopup.[ch]
	* app/widgets/gimpviewablebutton.[ch]: added "preview_size" and
	"preview_border_width" parameters to the constructors and use them
	when creating the popup.

	* app/tools/gimptextoptions.c
	* app/tools/paint_options.c
	* app/widgets/gimptemplateeditor.c: changed accordingly. Create the
	icon popup without borders.
2003-04-12 20:02:16 +00:00
Michael Natterer
f82440ff48 made object properties G_PARAM_READWRITE by default. Added flag
2003-04-12  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-params.h: made object properties
	G_PARAM_READWRITE by default. Added flag GIMP_PARAM_AGGREGATE
	which indicates that an object property is not a reference but a
	real part of its owner.

	* app/config/gimpconfig-deserialize.c: g_object_set_property()
	object properties only if they are not GIMP_PARAM_AGGREGATE.

	* app/config/gimpconfig-utils.c (gimp_config_copy_properties,
	gimp_config_reset_properties): copy and reset GIMP_PARAM_AGGREGATE
	object properties correctly.

	* app/config/gimpconfig-serialize.c: don't call
	gimp_config_writer_open/close() for properties which are handled
	by a GimpConfigIface::serialize_property() implementation.

	* app/core/gimpcontext.c: removed exlicit G_PARAM_WRITABLE from
	object properties since that's the default now. Call
	gimp_config_writer_open/close() when serializing properties.

	* app/core/gimpviewable.c (gimp_viewable_get_property): use
	gimp_viewable_get_stock_id().
	(gimp_viewable_set_stock_id): set stock_id to NULL if the new
	stock_id is the same as viewable_class->default_stock_id.
	Added serialize_property() which skips stock_id serialization
	if it is NULL.

	* app/tools/gimptextoptions.c: made the "text" property
	GIMP_PARAM_AGGREGATE. Added gimp_text_options_set_property()
	(which does nothing).

	* app/widgets/gimptemplateeditor.[ch]: added an optional
	GimpViewableButton to change the template's icon.

	* app/gui/file-new-dialog.c: create it with the icon button so it
	gets some testing.
2003-04-12 19:06:25 +00:00
Michael Natterer
2598142564 added gimp_context_type_to_prop_name().
2003-04-10  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.[ch]: added gimp_context_type_to_prop_name().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewablebutton.[ch]: new widget implementing
	the wheel-scrollable preview button.

	* app/tools/gimptextoptions.c
	* app/tools/paint_options.[ch]: removed the code implementing the
	same and use GimpViewableButton.

	* app/tools/tool_manager.c: added the font to the context
	properties which are remembered per tool. Added an evil hack
	using g_object_set_data() to pass the global_dock_factory to
	tool option GUI constructors.
2003-04-10 10:34:56 +00:00
Michael Natterer
30b303edb8 fixed boolean logic bug introduced by the fix for bug #110173. Spotted by
2003-04-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_button_release): fixed boolean logic bug
	introduced by the fix for bug #110173. Spotted by Pedro Gimeno.
2003-04-09 16:29:58 +00:00
Michael Natterer
d2fbc95c43 added paint_options_container_scrolled() utility function which
2003-04-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/paint_options.[ch]: added
	paint_options_container_scrolled() utility function which
	wheel-scrolls a container. Use it for the brush and pattern
	previews. Added a gradient preview.

	* app/tools/gimpblendoptions.c: removed the gradient preview here.

	* app/tools/gimptextoptions.c: use the new function to scroll
	the font list.
2003-04-08 22:43:20 +00:00
Michael Natterer
bfe98456e4 removed the pattern preview...
2003-04-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpbucketfilloptions.c: removed the pattern preview...

	* app/tools/paint_options.c: ...and added it here so all paint
	tools can use it if needed. Added a pattern preview to the clone
	tool options.
2003-04-08 20:08:37 +00:00
Sven Neumann
0dd49fd559 another patch from Pedro Gimeno that addresses problems displaying the
2003-04-07  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpeditselectiontool.c (selection_transform_segs):
	another patch from Pedro Gimeno that addresses problems displaying
	the selection border (bug #110014).
2003-04-07 16:30:38 +00:00
Sven Neumann
02fec0809b applied a patch from Pedro Gimeno that removes the confusing misfeature of
2003-04-07  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_button_release): applied a patch from
	Pedro Gimeno that removes the confusing misfeature of anchoring
	the floating selection if it wasn't moved (bug #110173).
2003-04-07 13:22:50 +00:00
Michael Natterer
43356fa076 applied a (modified) patch from Pedro Gimeno that fixes bug #110115.
2003-04-07  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c: applied a (modified) patch
	from Pedro Gimeno that fixes bug #110115.
2003-04-07 09:31:28 +00:00
Sven Neumann
fd4743a9c4 themes/Default/images/Makefile.am
2003-04-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-gradient-bilinear-16.png
	* themes/Default/images/stock-gradient-conical-asymmetric-16.png
	* themes/Default/images/stock-gradient-conical-symmetric-16.png
	* themes/Default/images/stock-gradient-linear-16.png
	* themes/Default/images/stock-gradient-radial-16.png
	* themes/Default/images/stock-gradient-shapeburst-angular-16.png
	* themes/Default/images/stock-gradient-shapeburst-dimpled-16.png
	* themes/Default/images/stock-gradient-shapeburst-spherical-16.png
	* themes/Default/images/stock-gradient-spiral-anticlockwise-16.png
	* themes/Default/images/stock-gradient-spiral-clockwise-16.png
	* themes/Default/images/stock-gradient-square-16.png
	* libgimpwidgets/gimpstock.[ch]: added new icons drawn by Jimmac.

	* app/tools/gimpblendoptions.c (gimp_blend_options_gui): use the
	new icons in the gradient type menu.
2003-04-04 21:53:54 +00:00
Michael Natterer
9820b157ba the "color" option's label was saying "Size". Changed it to "Color".
2003-04-04  Michael Natterer  <mitch@gimp.org>

	* app/tools/paint_options.c (pressure_options_gui): the "color"
	option's label was saying "Size". Changed it to "Color".
2003-04-04 10:13:13 +00:00
Michael Natterer
4865105f41 don't forget to resume the selection after cancelling a guide drag.
2003-04-03  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_button_release): don't
	forget to resume the selection after cancelling a guide drag.
	Spotted by Pedro Gimeno.
2003-04-03 17:37:31 +00:00
Sven Neumann
0dad41aec4 use a fixed size for the popup and clamp to a maximum size (should
2003-04-01  Sven Neumann  <sven@gimp.org>

	* app/text/gimpfont.c: use a fixed size for the popup and clamp to
	a maximum size (should actually use GIMP_PREVIEW_MAX_SIZE here).

	* app/text/gimptext.c
	* app/tools/gimptextoptions.c: minor string changes.
2003-04-01 00:35:38 +00:00
Sven Neumann
a8f83bc078 when the user has changed the layer name from the layers dialog, don't
2003-03-31  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.[ch]: when the user has changed the layer
	name from the layers dialog, don't change it with the text any longer.

	* app/tools/gimpmovetool.c: removed redundant include.

	* app/widgets/gimpcontainerpopup.c
	* app/widgets/widgets-enums.[ch]: fixed spelling.
2003-03-31 17:47:00 +00:00
Sven Neumann
a93e91f38e themes/Default/images/Makefile.am
2003-03-31  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-text-dir-ltr-24.png
	* themes/Default/images/stock-text-dir-rtl-24.png: placeholders
	for new icons.

	* libgimpwidgets/gimpstock.[ch]: register the new icons.

	* themes/Default/gtkrc: tweak GtkDialog in "gimp-default-style".

	* app/text/text-enums.[ch]
	* app/text/gimptext.[ch]
	* app/text/gimptextlayout.c: added new enum GimpTextDirection and
	use it instead of PangoDirection.

	* app/widgets/widgets-types.h
	* app/widgets/gimptexteditor.[ch]: made GimpTextEditor a real widget
	and added buttons to switch the text direction.

	* app/tools/gimptextoptions.[ch]
	* app/tools/gimptexttool.c: moved creation of the text editor to the
	text tool options, take care of GimpText::base-direction here.
2003-03-31 15:10:15 +00:00
Michael Natterer
529c5e71c4 added "icon_size" parameters to gimp_enum_stock_box_new[_with_range]().
2003-03-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpenummenu.[ch]: added "icon_size" parameters
	to gimp_enum_stock_box_new[_with_range]().

	* app/tools/gimpcurvestool.c
	* app/widgets/gimppropwidgets.c: changed accordingly.

	* app/widgets/gimpeditor.[ch]: added gimp_editor_add_stock_box().

	* app/widgets/widgets-enums.[ch]: register GimpViewType with
	the type system.

	* app/widgets/gimpcontainerpopup.c: use a stock box for the
	view as list/grid buttons.
2003-03-31 12:09:09 +00:00
Simon Budig
6a29d4773e app/tools/gimpvectortool.[ch] app/vectors/gimpbezierstroke.c
2003-03-29  Simon Budig  <simon@gimp.org>

        * app/tools/gimpvectortool.[ch]
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpstroke.[ch]
        * app/vectors/vectors-types.h: More vector tool stuff. Control
        handles start to behave...
2003-03-29 04:47:44 +00:00
Michael Natterer
f13f80f04a added "position" and "push_undo" parameters to gimp_image_add_[vh]guide().
2003-03-28  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-guides.[ch]: added "position" and "push_undo"
	parameters to gimp_image_add_[vh]guide(). Start with a refcount
	of 1, not 0 (EEK). Added gimp_image_guide_[un]ref(). Added
	"position" parameter to gimp_image_add_guide(). Added new
	function gimp_image_move_guide(). All functions push guide
	undos correctly and call gimp_image_update_guide() so this
	doesn't need to be done by callers.

	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpimage.c
	* app/tools/gimpmeasuretool.c
	* app/xcf/xcf-load.c
	* tools/pdbgen/pdb/guides.pdb: greatly simplyfied all places which
	modify guides: don't fiddle with undo and guide properties
	manually but simply use the API provided.

	* app/tools/gimpmovetool.[ch]: ditto. Changed everything to
	create/move the guide on button_release, not button_press. Enable
	canceling the operation by clicking button3 before releasing
	button1. Keep the guide drawn at its old position until the move
	is finished (fixes bug #75349 and bug #109267).

	* app/pdb/guides_cmds.c: regenerated.
2003-03-28 13:52:01 +00:00
Sven Neumann
4e3b31e989 respect the antialias parameter.
2003-03-28  Sven Neumann  <sven@gimp.org>

	* app/text/gimptext-compat.c: respect the antialias parameter.

	* app/text/gimptext.[ch]
	* app/text/gimptextlayout.c: added autohint property that allows
	to force the use of the Freetype auto-hinter.

	* app/tools/gimptextoptions.c: added check buttons for autohint
	and antialias. You need to patch PangoFT2 if you want to the
	antialias setting to have any effect (see #109370).
2003-03-28 01:35:01 +00:00
Sven Neumann
10faf8d577 added hinting and antialias properties.
2003-03-27  Sven Neumann  <sven@gimp.org>

	* app/text/gimptext.[ch]: added hinting and antialias properties.

	* app/text/gimptextlayout.c: rewrote some parts using the
	PangoFontMap API. Respect hinting and antialias properties.
	(PangoFT2 does not allow to switch antialias off, so that has no
	effect yet.)

	* app/tools/gimptextoptions.c: added a check button that controls
	hinting.
2003-03-27 17:24:53 +00:00
Michael Natterer
af37e71b80 added the scrolled_win to the GimpContainerView struct. Create it in
2003-03-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerview.[ch]: added the scrolled_win
	to the GimpContainerView struct. Create it in init().
	Added gimp_container_view_set_size_request() which adds the
	scrolled_window's scrollbar and frames sizes correctly.

	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpcontainertreeview.[ch]: removed scrolled windows
	here and use the one from the parent_instance. Use the new utility
	function.

	* app/widgets/gimpcontainertreeview.c: enable searching in the
	name column. Grab the focus in button_press.

	* app/widgets/gimpcontainerpopup.[ch]: added a button_box containing
	zoom in/out, view as list/grid and a button to show the permanently
	open dialog. Added more parameters to gimp_container_popup_new().

	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimptextoptions.c
	* app/tools/paint_options.c: changed accordingly.
2003-03-26 14:56:10 +00:00
Sven Neumann
0ca5b099e5 connect the preview on the context's font object with the font property of
2003-03-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c: connect the preview on the
	context's font object with the font property of the text object
	associated to the text tool options.
2003-03-26 01:30:05 +00:00
Sven Neumann
ac014ecf5a fixed the dialog layout I broke 2003-03-26 00:53:25 +00:00
Sven Neumann
10c1e4a7d2 added a gimp_prop_preview on the font property. Doesn't do anything yet
2003-03-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
	gimp_prop_preview on the font property. Doesn't do anything yet
	but has a nice popup...
2003-03-26 00:41:26 +00:00
Michael Natterer
8ed375a4ff added GIMP_CONTEXT_PATTERN_MASK to the context properties which are
2003-03-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c: added GIMP_CONTEXT_PATTERN_MASK to the
	context properties which are remembered per tool options.

	* app/tools/paint_options.[ch]
	* app/tools/gimpblendoptions.c: attach the brush and gradient
	preview to the GtkTable that holds opacity and paint mode.

	* app/tools/gimpbucketfilloptions.c: added a pattern preview
	and popup.
2003-03-25 21:14:48 +00:00
Sven Neumann
28fddfd554 Makefile.am removed this header file.
2003-03-25  Sven Neumann  <sven@gimp.org>

	* Makefile.am
	* gimpintl.h: removed this header file.

	* gimpmiscui.c: include libgimp-intl.h.

	* gimp.c (gimp_main): call setlocale() and bind to the libgimp
	textdomain so that plug-ins don't need to do that explicitely.

	* libgimp/stdplugins-intl.h: added the functionality that used to
	live in gimpintl.h and removed the libgimp related stuff. Got rid
	of the INIT_I18N_UI() macro.

	* plug-ins/*/*.c: removed all occurances of INIT_I18N_UI().
	Plug-ins simply call INIT_I18N() once in their run() function.

	* plug-ins/script-fu/script-fu-intl.h: added the functionality
	that used to live in gimpintl.h and removed the libgimp related
	stuff.

	* app/Makefile.am
	* app/gimp-intl.h: new file that defines the gettext macros for
	the GIMP core.

	* app/*/*.c: include gimp-intl.h instead of libgimp/gimpintl.h.

	* plug-ins/script-fu/scripts/test-sphere.scm: fixed typos.
2003-03-25 16:38:19 +00:00
Sven Neumann
7f22c349db added new functions gimp_enum_menu_set_stock_prefix() and
2003-03-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpenummenu.[ch]: added new functions
	gimp_enum_menu_set_stock_prefix() and
	gimp_enum_option_menu_set_stock_prefix() that allow to
	conveniently add stock icons to enum menus.

	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.c: use the new functions here.
2003-03-24 18:04:11 +00:00
Michael Natterer
c40a6f9920 register GimpPaintApplicationMode with the type system.
2003-03-24  Michael Natterer  <mitch@gimp.org>

	* app/paint/paint-enums.[ch]: register GimpPaintApplicationMode
	with the type system.

	* app/paint/gimppaintoptions.[ch]: replaced "gboolean incremental"
	with "GimpPaintApplicationMode application_mode"

	* app/paint/gimpairbrush.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppencil.c: changed accordingly.

	* tools/pdbgen/pdb/paint_tools.pdb: ditto. Set all paint options
	values using g_object_set().

	* app/widgets/gimppropwidgets.[ch]: added
	gimp_prop_enum_check_button_new() which can represent two
	specified enum values and renders itself "inconsistent" for all
	other values.

	* app/tools/paint_options.c: use it for the "Incremental" toggle.

	* app/pdb/paint_tools_cmds.c
	* tools/pdbgen/enums.pl: regenerated.
2003-03-24 17:58:28 +00:00
Michael Natterer
d1c99beeb4 allow to create a GimpContainerEditor without a popup menu.
2003-03-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainereditor.c: allow to create a
	GimpContainerEditor without a popup menu.

	* app/widgets/gimpcellrendererviewable.c: free the event we
	got from gdk_get_current_event().

	* app/widgets/gimpcontainerview.c: check view->hash_table for
	being non-NULL before using it. Be prepared to be destroyed by as
	a result of calling gimp_context_set_foo(view->context, foo).

	* app/widgets/gimpcontainertreeview.[ch]: added
	tree_view->editable_cells and handle *all* mouse clicks in
	gimp_container_tree_view_button_press() (by returning TRUE). Start
	editing on double-click only. Use gtk_tree_view_set_cursor()
	instead of gtk_tree_selection_select_path() to avoid
	selected/focus confusion when the focus enters the widget. Be
	prepeared to be destroyed as a result of item selection.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainerpopup.[ch]: new GtkWindow derived
	widget which pops up a selection of any GimpContainer/GimpContext
	combo.

	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpitemtreeview.c: add the name cell to
	tree_view->editable_cells so it becomes editable.

	* app/tools/gimpblendoptions.c
	* app/tools/paint_options.c: use the new container popup for
	selecting brushes and gradients.
2003-03-22 16:26:11 +00:00
Michael Natterer
906c5a9f38 removed gdisp->draw_guides and gdisp->snap_to_guides.
2003-03-20  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.[ch]: removed gdisp->draw_guides
	and gdisp->snap_to_guides.

	* app/display/gimpdisplayshell.[ch]: added shell->snap_to_guides.
	Added the state of guide, selection and active_layer visibility to
	the GimpDisplayShellVisibility struct so they can be configured
	separately for fullscreen mode. Update the popup_factory in
	gimp_display_shell_real_scaled() only if this is the active
	display.

	* app/display/gimpdisplayshell-appearance.[ch]: added accessors
	for selection, active_layer and guide visibility.

	* app/display/gimpdisplayshell-selection.[ch]: changed
	accordingly.  Changed the selection and active_layer toggle
	functions to *_set_hidden().

	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/image-menu.c
	* app/gui/view-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/gui/gui.c (gui_display_new): update the menubar_factory
	*after* making the new display the active one.
2003-03-20 11:31:33 +00:00
Simon Budig
aac6a44ff0 app/tools/gimpvectortool.[ch] Fixed crashes and weird problems when the
2003-03-20  Simon Budig  <simon@gimp.org>

        * app/tools/gimpvectortool.[ch]
        Fixed crashes and weird problems when the tool changed images or
        images got closed. Fixes Bug #108318.

        * app/vectors/vectors-types.h: More sane names for the
        GimpAnchorType enum.

        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpstroke.c: changed accordingly.
2003-03-19 23:51:43 +00:00
Michael Natterer
1d7ba472cd added GIMP_UNDO_GROUP_MASK.
2003-03-19  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch]: added GIMP_UNDO_GROUP_MASK.

	* app/tools/gimpeditselectiontool.c: use it for mask moving.
	Made the "undo_desc" strings more specific.

	* app/core/gimpundo.c: add it to the list of undo types for
	which mask previews are created.

	* app/core/gimpimage.c: s/Add Layer to Image/Add Layer/g etc.
2003-03-19 16:58:17 +00:00
Sven Neumann
e6ce8202d3 tweaked the dialog layout a little.
2003-03-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c: tweaked the dialog layout a little.
2003-03-19 12:23:03 +00:00
Michael Natterer
1329e016d2 app/core/gimpimage-mask.[ch] (gimp_image_mask_translate) added "gboolean
2003-03-18  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch] (gimp_image_mask_translate)
	* app/core/gimplayer.[ch] (gimp_layer_translate): added
	"gboolean push_undo" parameters.

	* app/core/gimpimage-crop.c
	* app/core/gimpimage-resize.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/layers-commands.c
	* app/widgets/gimptoolbox.c
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/selection.pdb: changed accordingly.

	* app/pdb/layer_cmds.c
	* app/pdb/selection_cmds.c: regenerated.

	* app/core/gimpimage-undo-push.c (undo_pop_layer_displace): call
	gimp_layer_translate() with "push_undo == FALSE" instead of
	duplicating gimp_layer_translate()'s code. Use GimpItemUndo for
	GIMP_UNDO_MASK.

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_cursor_key): check if the top undo on
	the stack is of exactly the same type as the undo we would push
	and just don't push it then (compresses layer translate undos and
	fixes bug #86362). Changed stuff work with CAPS_LOCK or other
	modifiers pressed.
2003-03-18 16:42:45 +00:00
Michael Natterer
884b3aa7a3 Made drawable/layer properties (visibility, opacity etc.) undoable (fixes
2003-03-17  Michael Natterer  <mitch@gimp.org>

	Made drawable/layer properties (visibility, opacity etc.)
	undoable (fixes bug #73893).

	* app/core/core-enums.[ch]: added undo types/groups for
	visibility, mode, opacity, linked and preserve_trans.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpitemundo.[ch]: new GimpUndo subclass which holds a
	ref'ed GimpItem pointer so (1) this doesn't need to be done by all
	undo steps related to an item and (2) the item the undo step is
	for can be determined from outside the undo system.

	* app/core/gimpimage-undo.[ch]: added gimp_image_undo_push_item()
	which returns a new GimpItemUndo.

	* app/core/gimpimage-undo-push.[ch]: use it for all item related
	undo steps. Removed lots of GimpItem, GimpLayer, GimpDrawable
	and GimpVectors pointers from the private undo structs. Added
	undo push functions for the new undo types added above.

	* app/core/gimpdrawable.[ch] (gimp_drawable_set_visible): added
	"gboolean push_undo" parameter.

	* app/core/gimplayer.[ch] (gimp_layer_set_opacity, _mode,
	_preserve_trans, _linked): added "gboolean push_undo" parameters.

	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimplayer-floating-sel.c
	* app/tools/gimpmovetool.c
	* app/xcf/xcf-load.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplayerlistview.c: changed accordingly.

	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/layer.pdb: ditto. Added '$undo' paramaters to
	the foo_accessors() functions. Removed $func from foo_accesors()
	because we don't manipulate items without using getters/setters
	any longer.

	* app/pdb/channel_cmds.c
	* app/pdb/layer_cmds.c: regenerated.

	* app/widgets/gimpcellrenderertoggle.[ch]: added "clicked" signal
	which carries an additional "GdkModifierType state" parameter as
	in GimpCellRendererViewable .

	* app/widgets/gimpcontainertreeview.c: emit "clicked" from
	the toggle renderer, not "toggled" so the callbacks get the
	modifier state.

	* app/widgets/gimpdrawabletreeview.c: resurrected the "exclusive
	visible by <shift>+click" feature as in 1.2.

	* app/widgets/gimplayertreeview.c: compress layer opacity undos by
	looking at the top of the undo stack and not pushing an undo if
	there already is a GIMP_UNDO_DRAWABLE_OPACITY for the active
	layer.
2003-03-17 18:02:41 +00:00
Sven Neumann
54cdc69c3e set a window type hint of GDK_WINDOW_TYPE_HINT_UTILITY for info windows
2003-03-16  Sven Neumann  <sven@gimp.org>

	* app/gui/info-dialog.c: set a window type hint of
	GDK_WINDOW_TYPE_HINT_UTILITY for info windows (fixes bug #92175).

	* app/tools/gimpcolorpickertool.c: give the color area more space.
2003-03-16 17:40:38 +00:00
Sven Neumann
70c61f66c2 check for gdk-pixbuf-csource and allow to override it by setting the
2003-03-16  Sven Neumann  <sven@gimp.org>

	* configure.in: check for gdk-pixbuf-csource and allow to override
	it by setting the GDK_PIXBUF_CSOURCE environment variable.

	* themes/Default/images/Makefile.am: use the gdk-pixbuf-csource
	executable that was found at configure time.

	* app/base/levels.c: cosmetic change.

	* app/tools/gimplevelstool.c: allow to pick white, gray and black
	point for all channels. Allows for easy white-point balancing.

	* plug-ins/script-fu/scripts/3dTruchet.scm: restore the foreground
	color when the script is done (see bug #108473).
2003-03-16 17:00:40 +00:00
Sven Neumann
85323a3c2a implemented this function which used to be a an empty stub.
2003-03-15  Sven Neumann  <sven@gimp.org>

	* app/base/levels.c (levels_adjust_by_colors): implemented this
	function which used to be a an empty stub.

	* app/tools/gimplevelstool.c: implemented the missing
	functionality behind the color picker buttons I added some time
	ago.
2003-03-15 15:02:36 +00:00
Sven Neumann
1657c4d62b themes/Default/images/Makefile.am
2003-03-14  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-curve-free-16.png
	* themes/Default/images/stock-curve-smooth-16.png: added new icons
	provided by Tuomas Kuosmanen <tigert@gimp.org>.

	* libgimpwidgets/gimpstock.[ch]: register the new icons.

	* app/tools/gimpcurvestool.[ch]: use radio buttons with the new
	curve type icons.
2003-03-14 23:24:37 +00:00
Sven Neumann
edaab6c3b4 app/base/base-enums.[ch] changed CurvesType enum GimpCurveType and
2003-03-14  Sven Neumann  <sven@gimp.org>

	* app/base/base-enums.[ch]
	* app/base/curves.[ch]: changed CurvesType enum GimpCurveType and
	register it with the type system.

	* app/tools/gimpcurvestool.c: use an enum menu here.
2003-03-14 19:58:59 +00:00
Sven Neumann
46c234c774 some cleanup to event handling and drawing code. Doesn't draw outside the
2003-03-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.[ch]: some cleanup to event handling
	and drawing code. Doesn't draw outside the expose_event handler
	any longer but could still be improved.
2003-03-14 13:42:39 +00:00
Sven Neumann
632b7f8ac6 app/display/gimpdisplayshell-callbacks.c app/display/gimpdisplayshell.[ch]
2003-03-11  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.[ch]
	* app/gui/image-menu.c
	* app/gui/view-commands.[ch]: added a fullscreen mode for the
	image display by means of gtk_window_fullscreen/unfullscreen.
	Depends on the window manager implementing _NET_WM_STATE_FULLSCREEN.

	* app/tools/gimpcroptool.c: made gimp_crop_tool_draw() static.

	* app/tools/gimptexttool.[ch]: derive from GimpDrawTool, no real
	changes yet.
2003-03-11 01:22:57 +00:00
Sven Neumann
3f588521ff app/tools/gimpbycolorselecttool.c app/tools/gimpcolorpickertool.c resolved
2003-03-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c: resolved conflicts in tool
	keybindings (bug #107975).
2003-03-10 12:38:47 +00:00
Sven Neumann
65ee44c6ca changed the hue_saturation() function as suggested by Martin Weber in bug
2003-03-07  Sven Neumann  <sven@gimp.org>

	* app/base/hue-saturation.[ch]: changed the hue_saturation()
	function as suggested by Martin Weber in bug #94067.  Changed the
	function signature to use a typed instead of a void pointer.

	* app/tools/gimphuesaturationtool.c (gimp_hue_saturation_tool_map):
	cast the hue_saturation() function pointer to a GimpImageMapApplyFunc
	here.
2003-03-07 18:08:16 +00:00
Sven Neumann
d457b9eb9b app/config/Makefile.am new files featuring a simple config file writer.
2003-03-05  Sven Neumann  <sven@gimp.org>

	* app/config/Makefile.am
	* app/config/gimpconfigwriter.[ch]: new files featuring a simple
	config file writer.

	* app/config/gimpconfig-serialize.[ch]
	* app/config/gimpconfig.[ch]: changed the serialize routines to
	use a GimpConfigWriter instead of passing around a file descriptor
	and the indentation level.

	* app/config/config-types.h
	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-utils.c
	* app/config/gimprc.c
	* app/config/gimpscanner.c
	* app/config/test-config.c
	* app/core/gimp-documents.c
	* app/core/gimp-parasites.c
	* app/core/gimpcontainer.c
	* app/core/gimpcontext.c
	* app/core/gimpdocumentlist.c
	* app/core/gimpparasitelist.c
	* app/gui/test-commands.c
	* app/tools/tool_options.c
	* app/widgets/gimpdevices.c: changed accordingly.

	* libgimpwidgets/gimpwidgets.c: documentation updates.

	* app/core/gimpitem.c: removed a redundant type-check.
2003-03-05 20:21:50 +00:00
Hans Breuer
594bccd558 app/text/makefile.msc (new file) */makefile.msc */*/makefile.msc : updated
2003-03-03  Hans Breuer  <hans@breuer.org>

	* app/text/makefile.msc (new file)
	  */makefile.msc */*/makefile.msc : updated

	* app/core/gimpdata.c : define access() constants
	for G_OS_WIN32 case

	* app/text/gimptext.c : <stdlib.h> for getenv()

	* libgimp/gimp.def libgimp/gimpui.def : updated externals

	* libgimpwidgets/libgimp-glue.c : make dynamic_resolve
	actually work again for 'my' DLL naming convention

	* plug-ins/gap/gap_pdb_calls.c : reflect renaming
	of GIMP_VERTICAL to GIMP_ORIENTATION_VERTICAL
2003-03-03 18:14:31 +00:00
Michael Natterer
9525f64c71 removed useless includes.
2003-03-01  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpblendtool.c: removed useless includes.
2003-03-01 03:06:27 +00:00
Sven Neumann
f050987238 app/config/gimpconfig-deserialize.c transparently serialize and
2003-02-28  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-serialize.[ch]: transparently serialize
	and deserialize object properties that implement the
	GimpConfigInterface.

	* app/config/gimpconfig-utils.c (gimp_config_reset_properties):
	call reset recursively if properties are itself objects that
	implement the GimpConfigInterface.

	* app/config/gimpconfig-dump.c: adapt to API changes.

	* app/config/gimpconfig-params.h: made object properties installed
	using GIMP_CONFIG_INSTALL_PROP_OBJECT() be not writable by default.

	* app/core/gimpcontext.c (gimp_context_class_init): made objects
	properties explicitely writeable.

	* app/tools/gimptextoptions.c: made the GimpText object a property
	of GimpTextOptions and removed lots of special handling which is
	now transparently done by GimpConfigInterface.
2003-02-28 17:01:13 +00:00
Manish Singh
5bc3a7a31d app/tools/gimpbucketfilltool.c app/tools/gimpconvolvetool.c
2003-02-27  Manish Singh  <yosh@gimp.org>

        * app/tools/gimpbucketfilltool.c
        * app/tools/gimpconvolvetool.c
        * app/tools/gimpcroptool.c
        * app/tools/gimpdodgeburntool.c
        * app/tools/gimperasertool.c
        * app/tools/gimpfliptool.c
        * app/tools/gimpfuzzyselecttool.c
        * app/tools/gimpinkoptions.c
        * app/tools/gimpmagnifytool.c
        * app/tools/gimpmovetool.c
        * app/tools/gimprectselecttool.c
        * app/tools/gimpselectiontool.c
        * app/tools/gimptexttool.c
        * app/tools/gimptransformtool.c
        * app/widgets/gimpcellrendererviewable.c
        * app/widgets/gimpcontainertreeview.c: remove unecessary G_OBJECT()
        from g_object_set calls.

        * plug-ins/common/bumpmap.c: use g_signal_handlers_(un)block_by_func
        instead of gtk_signal_handler_(un)block_by_data.
2003-02-28 01:14:30 +00:00
Sven Neumann
b3e5867378 don't insert an extra line-break after a serialized property.
2003-02-26  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-serialize.c (gimp_config_serialize_properties):
	don't insert an extra line-break after a serialized property.

	* app/config/gimpconfig-serialize.c
	* app/config/gimpconfig-dump.c
	* app/gui/tips-parser.c: use g_string_truncate (str, 0) instead of
	assigning an empty string.

	* app/tools/gimptextoptions.c: override the serialize and
	deserialize methods of the GimpConfig interface and save/restore
	the associated GimpText object instead of GimpTextOptions.

	* app/tools/tool_options.c (gimp_tool_options_build_filename):
	don't append ".default" if no extension is given.
2003-02-26 20:34:58 +00:00
Sven Neumann
0ceeeb0254 added a writeable field to GimpData and set it from
2003-02-26  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdata.[ch]: added a writeable field to GimpData and
	set it from gimp_data_set_filename().

	* app/gui/brushes-menu.c
	* app/gui/gradients-menu.c
	* app/gui/palettes-menu.c
	* app/gui/patterns-menu.c
	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpgradienteditor.c: look at data->writeable when
	setting widgets sensitivity.

	* app/gui/user-install-dialog.c (user_install_dialog_create): reduce
	some of the dialog clutter by not showing the directories created for
	plug-ins.

	* app/core/gimpviewable.[ch]: added a default_stock_id to
	GimpViewableClass so we don't need to hold a copy in each instance.
	Added accessor functions to set and get the stock_id.

	* app/core/gimptoolinfo.c
	* app/gui/dialogs-constructors.c
	* app/gui/image-menu.c
	* app/tools/gimpcroptool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpcellrendererviewable.c
	* app/widgets/gimppreview.c
	* app/widgets/gimptoolbox.c: use gimp_viewable_get_stock_id().

	* app/text/gimptextlayer.c: set a text icon as default stock_id.
2003-02-26 18:08:26 +00:00
Michael Natterer
305db405b2 added "gchar *stock_id" to the GimpViewable struct. It is used by the GUI
2003-02-26  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpviewable.[ch]: added "gchar *stock_id" to the
	GimpViewable struct. It is used by the GUI if the get_preview()
	functions return NULL. Default to GTK_STOCK_DIALOG_QUESTION.

	* app/core/gimptoolinfo.[ch]: set the tool's stock_id. Removed
	the cached GdkPixbuf. Don't implement any preview function
	so the GUI uses the stock_id.

	* app/tools/tool_manager.c: removed GdkPixbuf creation, removed
	the #warning about the buggy way we created the pixbuf.

	* app/gui/dialogs-constructors.c
	* app/gui/image-menu.c
	* app/tools/gimpcroptool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimptoolbox.c: use viewable->stock_id instead
	of tool_info->stock_id.

	* app/core/gimpbrush.c
	* app/core/gimpgradient.c
	* app/core/gimpimagefile.c
	* app/core/gimpundo.c: simplified get_preview() implementations:

	- never scale previews up, only down.
	- don't render white or checks backgrounds but simply return
	  TempBufs with alpha and let the preview system do its job.
	- don't add padding but simply return previews smaller than
	  requested.

	* app/display/gimpdisplayshell-render.[ch]: added
	"render_blend_white", a 2d lookup table for blending on white,
	just as the check lookup tables. Added "render_white_buf".

	* app/widgets/gimppreview.[ch]: changed a lot:

	- don't render the preview's border into the buffer.
	- added "GdkGC *border_gc" and draw the preview's border in expose()
	  using gdk_draw_rectangle().
	- added "GdkPixbuf *no_preview_pixbuf" and create it in
	  gimp_preview_real_render() if gimp_viewable_get_preview()
	  returned NULL.
	- factored the actual preview rendering out to
	  gimp_preview_render_to_buffer(). Added configurable background
	  rendering for the preview itself and it's padding area
	  (the area the preview is larger than the buffer returned
	  by gimp_viewable_get_preview()).
	- changed gimp_preview_render_and_flush() to
	  gimp_preview_render_preview() and added "inside_bg" and
	  "outside_bg" parameters.
	- use the new render buffers for blending on white.

	* app/widgets/gimpbrushpreview.c
	* app/widgets/gimpbufferpreview.c
	* app/widgets/gimpdrawablepreview.c
	* app/widgets/gimpgradientpreview.c
	* app/widgets/gimpimagepreview.c
	* app/widgets/gimppalettepreview.c
	* app/widgets/gimppatternpreview.c: don't create large white
	TempBufs to center the previews in but simply set the TempBuf's
	offsets to get them centered. Simplified & cleaned up many preview
	render functions. Pass the correct GimpPreviewBG modes to
	gimp_preview_render_preview().

	* app/widgets/gimpcellrendererviewable.[ch]: new GtkCellRenderer
	class derived from GtkCellRendererPixbuf which knows how
	to use gimp_viewable_get_preview_size() and renders the
	viewable's stock item if no preview can be created.

	* app/widgets/gimpcontainertreeview.c: added a GtkTreeCellDataFunc
	which creates the preview pixbuf if needed so we don't create it
	unconditionally upon item insertion. Fixed preview size assertion
	to use GIMP_PREVIEW_MAX_SIZE, not "64". Block "selection_changed"
	while reordering the selected item.

	* app/widgets/gimpcontainerview.c: cosmetic.

	* app/widgets/gimpimagefilepreview.[ch]
	* app/widgets/gimptoolinfopreview.[ch]
	* app/widgets/gimpundopreview.[ch]: removed because the default
	implementation is good enough.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppreview-utils.c: changed accordingly.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs-menu.c
	* app/gui/dialogs.c
	* app/gui/image-menu.c
	* app/gui/toolbox-menu.c: register grid and tree view variants
	of the document history.

	Unrelated:

	* app/gui/gui.c (gui_exit_finish_callback): disconnect from
	signals earlier.

	* app/gui/user-install-dialog.c: create the "tool-options" subdir
	of the user's ~/.gimp-1.3 directory.
2003-02-26 16:17:10 +00:00
Sven Neumann
f658f1ce22 if in free select mode set width and height in the tool options.
2003-02-25  Sven Neumann  <sven@gimp.org>

	* app/tools/gimprectselecttool.c (gimp_rect_select_tool_motion):
	if in free select mode set width and height in the tool options.

	* app/tools/gimpselectionoptions.c: relaxed the limits for the
	fixed-width and fixed-height properties.
2003-02-25 02:13:03 +00:00
Sven Neumann
9c957fa1d5 added new function gimp_displays_invalidate() which queues a redraw on all
2003-02-21  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplay-foreach.[ch]: added new function
	gimp_displays_invalidate() which queues a redraw on all displays
	by calling gimp_display_shell_expose_full().

	* app/display/gimpdisplayshell-render.c (render_setup_notify):
	invalidate all displays when the transparency type or size changes.

	* app/tools/gimptexttool.c (text_tool_button_press): readded some
	code I accidentally removed in my last commit.

	* app/text/gimptextlayout.c (gimp_text_layout_new): always set the
	font size but make sure it is at least 1.
2003-02-21 21:39:42 +00:00
Michael Natterer
361c288c93 the default value of "clip" is FALSE, not TRUE. Fixes bug #106644.
2003-02-21  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformoptions.c
	(gimp_transform_options_class_init): the default value of "clip"
	is FALSE, not TRUE. Fixes bug #106644.
2003-02-21 12:24:34 +00:00
Sven Neumann
a18fee2912 added a colspan parameter and fixed packing of the stock icon.
2003-02-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch] (gimp_table_attach_stock):
	added a colspan parameter and fixed packing of the stock icon.

	* app/tools/gimpselectionoptions.c
	* app/tools/gimptextoptions.c: improved dialog layout.
2003-02-21 00:42:53 +00:00
Sven Neumann
e105077033 always start with an empty text.
2003-02-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: always start with an empty text.
2003-02-20 17:05:10 +00:00
Sven Neumann
df09eb68d3 trim the string only if necessary.
2003-02-20  Sven Neumann  <sven@gimp.org>

	* libgimpbase/gimputils.c (gimp_utf8_strtrim): trim the string
	only if necessary.

	* app/text/gimptext.c: changed the default text to NULL.

	* app/widgets/gimptexteditor.[ch]: replaced Cancel and OK buttons
	with a single Close button and removed the callback.

	* app/widgets/gimppropwidgets.c: gtk_text_buffer_set_text()
	doesn't like NULL pointers, pass it an empty string instead.

	* app/tools/gimptexttool.c: create a new text layer as soon as the
	user starts editing.
2003-02-20 16:11:23 +00:00
Michael Natterer
c8b4394d71 Reimplemented the undo history:
2003-02-20  Michael Natterer  <mitch@gimp.org>

	Reimplemented the undo history:

	* app/Makefile.am
	* app/undo_history.[ch]: removed.

	Changes/cleanups to the undo system to enable/simplify the new
	undo history implementation:

	* app/core/core-types.h: removed enum undo_event_t. Removed the
	GimpImage parameter from GimpUndoPopFunc and GimpUndoFreeFunc
	because GimpUndo has a GimpImage pointer now (see below).

	* app/core/core-enums.[ch]: added enum GimpUndoEvent. Added an
	enum value for REDO_EXPIRED.

	* app/core/gimpimage.[ch]: added a GimpUndo pointer to the
	"undo_event" signal which needs to be passed for all events except
	UNDO_FREE.

	* app/display/gimpdisplayshell-handlers.c: changed accordingly.

	* app/core/gimpundo.[ch]: added a GimpImage pointer to the
	GimpUndo struct. Removed GimpImage parameters all over the
	place. Added preview stuff. The preview creation needs to be
	triggered explicitly using gimp_undo_create_preview() because the
	GimpUndo can't know when it's possible to create the preview.

	* app/core/gimpimage-undo-push.c
	* app/paint/gimppaintcore-undo.c
	* app/tools/gimptransformtool-undo.c: changed accordingly, cleanup.

	* app/core/gimpundostack.[ch]: ditto. Return the freed undo from
	gimp_undo_stack_free_bottom(). Removed unused container signal
	handlers.

	* app/core/gimpimage-undo.c: free the redo stack the same way old
	undos are freed (from bottom up). Emit "undo_event" with event ==
	REDO_EXPIRED for each removed redo.

	* app/core/gimpmarshal.list: added new marshallers.

	New undo history implementation:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpundoeditor.[ch]
	* app/widgets/gimpundopreview.[ch]: new widgets for the undo
	step previews and the history itself.

	* app/widgets/gimppreview-utils.c: added GimpUndoPreview to the
	list of possible preview types.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs-menu.c
	* app/gui/dialogs.c
	* app/gui/image-menu.c
	* app/gui/toolbox-menu.c: removed the old and added the new undo
	history to the dialog factory and the various dialog menus.

	* app/widgets/gimpdnd.[ch]: don't warn if a GType has no
	corresponding DND type. Instead, return FALSE from the function
	that failed.

	* app/widgets/gimppreview.c: check the return value of gimpdnd
	functions.  Not only add drag sources but also remove them when no
	longer needed.

	* app/widgets/gimpselectioneditor.h: removed unneeded inclusion of
	"gui/gui-types.h".
2003-02-20 12:47:42 +00:00
Sven Neumann
ec825cba0c added a new widget constructor gimp_prop_opacity_entry_new() which is a
2003-02-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added a new widget constructor
	gimp_prop_opacity_entry_new() which is a scale entry with a display
	factor of 100.0.

	* app/tools/paint_options.c: use the new opacity scale for opacity
	controls.
2003-02-19 20:06:38 +00:00
Michael Natterer
8929780522 added gimp_prop_preview_new().
2003-02-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.[ch]: added gimp_prop_preview_new().

	* app/tools/gimpblendoptions.c
	* app/tools/paint_options.c: use it.
2003-02-18 16:52:37 +00:00
Larry Ewing
f23d961468 add a new variable to hold the brush vbox so the we return the correct
2003-02-15  Larry Ewing  <lewing@ximian.com>

	* app/tools/gimpinkoptions.c (gimp_ink_options_gui): add a new
	variable to hold the brush vbox so the we return the correct
	widget.
2003-02-15 21:53:10 +00:00
Michael Natterer
a4a224587b Fixed most of the bugs the Script-Fu logo scripts triggered:
2003-02-14  Michael Natterer  <mitch@gimp.org>

	Fixed most of the bugs the Script-Fu logo scripts triggered:

	* app/core/gimpdrawable-bucket-fill.[ch]
	(gimp_drawable_bucket_fill): added "gboolean do_seed_fill"
	parameter instead of assuming TRUE.
	(gimp_drawable_bucket_fill_full): moved "color" and "pattern"
	parameters to the end.

	* app/tools/gimpbucketfilltool.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimpdrawablelistview.c: changed accordingly.

	* tools/pdbgen/pdb/misc_tools.pdb: only pass TRUE if the selection
	is empty. Restores old PDB behaviour.

	* app/core/gimpimage-undo.c (gimp_image_undo_group_end): return
	early if gimage->undo_on is FALSE. Fixes bogus criticals.

	* app/core/gimpimage.c (gimp_image_add_[layer|channel|vectors]):
	clamp the passed position to sane values before calling
	gimp_container_insert() (Scripts adding layers at wrong indices
	are broken but should not crash the core).

	* tools/pdbgen/pdb/paint_tools.pdb: need to copy the relevant
	paint parameters from the current context now that the paint
	options are contexts themselves.

	* tools/pdbgen/pdb/palette.pdb: removed useless includes.

	(Mostly) fixed text PDB functions:

	* app/text/gimptext-compat.[ch] (text_render): don't set
	text->font_size = -1 but get the size from the PangoFontDescrition.
	(text_get_extents): return the logical_rect, not the ink_rect
	because the size of the created text layer will be the logical_rect.

	* tools/pdbgen/pdb/text_tool.pdb: removed text_fontname_create()
	utility function and the usage of pass_through and implement all
	invokers in-place, using the correct parameters.

	* plug-ins/script-fu/siod-wrapper.c: fixed BG-IMAGE-FILL compat
	define so we can BG fill again. Cleaned up color handling code.

	* plug-ins/script-fu/scripts/coolmetal-logo.scm
	* plug-ins/script-fu/scripts/glossy.scm
	* plug-ins/script-fu/scripts/land.scm
	* plug-ins/script-fu/scripts/lava.scm
	* plug-ins/script-fu/scripts/test-sphere.scm: use new gradient names.

	* app/pdb/misc_tools_cmds.c
	* app/pdb/paint_tools_cmds.c
	* app/pdb/palette_cmds.c
	* app/pdb/text_tool_cmds.c: regenerated.
2003-02-14 22:33:22 +00:00
Michael Natterer
7a6a8d9dbb Moved the undo step implementations to the core and pass around lots of
2003-02-14  Michael Natterer  <mitch@gimp.org>

	Moved the undo step implementations to the core and pass around
	lots of "const gchar *undo_desc". Fixes bug #104367.

	* app/Makefile.am
	* app/undo.[ch]: removed...

	* app/core/Makefile.am
	* app/core/gimpimage-undo-push.[ch]: ...and added here.

	* app/paint/Makefile.am
	* app/tools/Makefile.am
	* app/paint/gimppaintcore-undo.[ch]
	* app/tools/gimptransformtool-undo.[ch]: new files for the
	paint and transform undos.

	* app/core/gimppaintinfo.[ch]: added a blurb.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c
	* app/paint/paint-types.h
	* app/paint/paint.c: pass the blurb when registering the core.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimage.[ch]
	* app/core/gimpimage-mask-select.[ch]
	* app/core/gimpimage-mask.[ch]
	* app/core/gimpimagemap.[ch]
	* app/core/gimplayer-floating-sel.[ch]: added "undo_desc" parameters
	to all undo pushing helper functions.

	* app/undo_history.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-desaturate.c
	* app/core/gimpdrawable-equalize.c
	* app/core/gimpdrawable-invert.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-guides.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-qmask.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-undo.c
	* app/core/gimpitem.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/gui/channels-commands.c
	* app/gui/file-commands.c
	* app/gui/file-open-dialog.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/paths-dialog.c
	* app/gui/select-commands.c
	* app/gui/vectors-commands.c
	* app/text/gimptext-compat.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimpselectioneditor.c
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/guides.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/selection_tools.pdb: changed accordingly: pass
	"undo_desc" strings, changed includes or simply removed inclusion
	of "undo.h". Some random cleanups.

	* tools/pdbgen/pdb/guides.pdb: cleaned up a lot. Fixed
	gimp_image_find_next_guide() to not return guides with
	position < 0 (and made it shorter and readable).

	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/guides_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/selection_tools_cmds.c: regenerated.
2003-02-14 14:14:29 +00:00
Michael Natterer
b600fd8605 changed FOO_UNDO enum values to GIMP_UNDO_FOO.
2003-02-13  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch]: changed FOO_UNDO enum values to
	GIMP_UNDO_FOO.

	* app/undo.[ch]: removed the undo group wrappers.

	* app/undo_history.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-qmask.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-undo.c
	* app/core/gimpimage.c
	* app/core/gimpitem.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/channels-commands.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/paint/gimppaintcore.c
	* app/text/gimptext-compat.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/undo.pdb: changed accordingly. Pass meaningful
	undo names to gimp_image_undo_group_start().

	* app/pdb/layer_cmds.c
	* app/pdb/undo_cmds.c: regenerated.
2003-02-13 11:23:50 +00:00
Michael Natterer
be70105d3b Moved the undo system to the core: Keep GimpUndoStack objects as undo and
2003-02-12  Michael Natterer  <mitch@gimp.org>

	Moved the undo system to the core: Keep GimpUndoStack objects as
	undo and redo stack. Use GimpUndo objects as members of the
	stacks. GimpUndoStack is derived from GimpUndo and keeps undo
	groups, so undo group handling is much simpler than before
	(the whole group is just a single GimpUndo object on the
	stack and not everything between group boundary markers).

	* app/Makefile.am
	* app/undo_types.h: removed.

	* app/config/gimpcoreconfig.[ch]: added "gulong undo_size".
	* app/config/gimprc-blurbs.h: and its blurb.

	* app/core/core-enums.[ch]: added GimpUndoMode and GimpUndoType.

	* app/core/core-types.h: removed UndoType, added GimpUndoAccumulator,
	GimpUndoPopFunc and GimpUndoFreeFunc.

	* app/core/gimpundo.[ch]: do everything the old "Undo" struct did.
	Removed the virtual push() function and added free().

	* app/core/gimpundostack.[ch]: keeps the new undo/redo stacks
	and also acts as undo group.

	* app/core/gimpimage-undo.[ch]: moved the undo apparatus here.

	* app/core/gimpimage.[ch]: removed the old stuff.

	* app/core/gimpmarshal.list: added marshaller needed for GimpUndo.

	* app/undo.[ch]: removed the whole undo mechanism. Only the
	actual undo pushing functions are left.

	* app/undo_history.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/image-menu.c
	* app/gui/preferences-dialog.c
	* app/tools/gimpeditselectiontool.c: changed accordingly.
2003-02-12 17:11:34 +00:00
Sven Neumann
4858a3750b app/Makefile.am app/path_bezier.[ch] app/path_curves.[ch]
2003-02-12  Sven Neumann  <sven@gimp.org>

	* app/Makefile.am
	* app/path_bezier.[ch]
	* app/path_curves.[ch]
	* app/tools/Makefile.am
	* app/tools/gimppathtool.[ch]
	* app/tools/path_tool.[ch]: removed the abandoned path tool
	prototype.
2003-02-12 13:06:13 +00:00
Sven Neumann
b0161a5089 app/tools/Makefile.am removed this unused header file.
2003-02-12  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/path_toolP.h: removed this unused header file.
2003-02-12 12:47:27 +00:00
Sven Neumann
5d402908f8 added new utility functions gimp_config_connect() and
2003-02-10  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-utils.[ch]: added new utility functions
	gimp_config_connect() and gimp_config_disconnect() and documented
	most functions.

	* app/tools/gimptexttool.c (gimp_text_tool_connect): use the new
	GimpConfig utility functions.
2003-02-10 14:13:55 +00:00
Michael Natterer
a071be69ae added a "const gchar *extension" parameter to
2003-02-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_options.[ch]: added a "const gchar *extension"
	parameter to gimp_tool_options_[de]serialize(). Default to
	"default" if NULL is passed.

	* app/tools/tool_manager.[ch]: load the tool_options from the
	default files in tool_manager_restore(), added tool_manager_save()
	which saves the default files.

	* app/app_procs.c: call tool_manager_save() on app exit.

	* app/gui/tool-options-dialog.c: pass "user" when loading/saving
	the user defaults. Changed tooltips of the load & save buttons.
2003-02-10 11:46:10 +00:00
Michael Natterer
b3c941e9d5 take the drawable offset into account when painting (spotted by tigert).
2003-02-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpinktool.c: take the drawable offset into account
	when painting (spotted by tigert).
2003-02-10 11:38:03 +00:00
Michael Natterer
58d780e0c0 connect to GimpTransformOptions' "notify" signal and update grid and path
2003-02-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.[ch]: connect to GimpTransformOptions'
	"notify" signal and update grid and path drawing accordingly.

	* app/tools/gimptransformoptions.c: removed the same stuff here.
	Doesn't depend on the tool_manager any more.

	* app/tools/gimpselectionoptions.c
	* app/tools/paint_options.c: don't #include "tool_manager.h"
2003-02-10 10:08:01 +00:00
Michael Natterer
eb6e907b36 simplified everything a lot by merging the public GimpContextPropType enum
2003-02-09  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.[ch]: simplified everything a lot by
	merging the public GimpContextPropType enum with the internal
	anonymous object property id enum. Removed the internal copy_prop
	functions and handle property copying in a big switch() in
	gimp_context_copy_property(). Removed the separate signal
	connections for each property of the parent context and do the
	same using a single "notify" handler. Emit "notify" signals all
	over the place.  Removed internal arrays which are no longer
	needed due to enum merge and copy_property simplification.
	Removed the array of signal names and use g_signal_name().
	Removed gimp_context_unset_parent() and allow "parent" being NULL
	in gimp_context_set_parent().

	* app/tools/tool_manager.c
	* app/widgets/gimpdevices.c: changed accordingly.

	* libgimptool/gimptooltypes.h: changed GimpToolOptionsGUIFunc to
	return a GtkWidget (the created tool options widget).

	* libgimptool/gimptoolmodule.c: #include <gtk/gtk.h>

	* app/tools/tool_options.[ch]: removed the "main_vbox" from the
	GimpToolOptions struct. Changed gimp_tool_options_gui() to create
	and return the main_vbox.

	* app/tools/tool_manager.c: create the "This Tool has no Options"
	label here if NULL was passed as "options_gui_func". Attach the
	options widget to the tool_options object using
	g_object_set_data().

	* app/gui/tool-options-dialog.c: changed accordingly.

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendoptions.[ch]
	* app/tools/gimpbucketfilloptions.[ch]
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickeroptions.[ch]
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.[ch]
	* app/tools/gimpinkoptions.[ch]
	* app/tools/gimpmagnifyoptions.[ch]
	* app/tools/gimpmeasureoptions.[ch]
	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimpselectionoptions.[ch]
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptextoptions.[ch]
	* app/tools/gimptransformoptions.[ch]
	* app/tools/gimpvectoroptions.[ch]
	* app/tools/paint_options.[ch]: return the options vbox from
	all tool_options_gui functions.
2003-02-09 17:32:52 +00:00
Sven Neumann
bb5d687557 app/text/gimptext.c app/tools/gimpbucketfilloptions.c
2003-02-08  Sven Neumann  <sven@gimp.org>

	* app/text/gimptext.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptextoptions.c: use N_() instead of _() with blurbs
	of object properties. GimpConfig wants the untranslated string as
	well.

	* app/widgets/gimpenummenu.c
	* app/widgets/gimppropwidgets.c: added gettext() calls.

	* app/config/gimpconfig-serialize.c: document the fact that
	gimp_config_serialize_comment() only handles ASCII comments.
2003-02-09 00:22:42 +00:00
Michael Natterer
4bd30b8c3c added gimp_tool_options_[de]serialize() utility functions.
2003-02-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_options.[ch]: added
	gimp_tool_options_[de]serialize() utility functions.

	* app/gui/tool-options-dialog.c: use them, cleanup.
2003-02-08 23:56:16 +00:00
Michael Natterer
d24dac6833 app/tools/transform_options.[ch] removed...
2003-02-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/transform_options.[ch]
	* app/tools/selection_options.[ch]: removed...

	* app/tools/gimpselectionoptions.[ch]
	* app/tools/gimptransformoptions.[ch]: ...and added here.

	* app/tools/Makefile.am
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectoroptions.h: changed accordingly.

	* app/tools/gimpinkoptions.[ch]: renamed "sensitivity" to
	"size_sensitivity". Reordered properties. Added utility
	constructors blob_button_new() and brush_widget_new().

	* app/tools/gimpinktool.c: changed accordingly.
2003-02-08 21:12:03 +00:00
Michael Natterer
7fe80e8dc8 the virtual serialize_property() returning FALSE doesn't mean the
2003-02-08  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-serialize.c (gimp_config_serialize_property):
	the virtual serialize_property() returning FALSE doesn't mean the
	serialization failed but that the function didn't handle the
	property, so don't error but continue with the default
	implementation. Print newlines after properties only if
	indent_level == 0.

	* app/gui/tool-options-dialog.c: added tool options saving/loading
	as quickly hacked proof-of-concept.

	* app/paint/paint-enums.[ch]: added enum GimpInkBlobType.

	* app/tools/gimpinkoptions.[ch]: ported to object properties,
	cleanup.

	* app/tools/gimpinktool.c: changed accordingly.
2003-02-08 15:27:51 +00:00
Michael Natterer
eeec3cedb8 Added object properties for almost all tool_options values and registered
2003-02-07  Michael Natterer  <mitch@gimp.org>

	Added object properties for almost all tool_options values
	and registered lots of enums with the type system:

	Part I (enum and type cleanup):

	* app/core/core-enums.[ch]
	* app/core/core-types.h: removed InternalOrientaionType and
	register GimpOrientationType. Register GimpChannelOps.
	Removed GimpToolOptionsGUIFunc.

	* app/xcf/xcf-private.h: added XcfOrientationType with the
	same values as the old InternalOrientationType

	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c: translate between GimpOrientationType and
	XcfOrientationType.

	* app/core/gimpdrawable-transform-utils.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-guides.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage.h
	* app/display/gimpdisplayshell.c
	* tools/pdbgen/stddefs.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

	* app/pdb/guides_cmds.c
	* app/pdb/transform_tools_cmds.c
	* libgimp/gimpenums.h
	* libgimpproxy/gimpproxytypes.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* libgimptool/gimptoolenums.[ch]: added GimpTransformGridType.

	* libgimptool/gimptooltypes.h: removed GimpToolOptionsResetFunc,
	added GimpToolOptionsGUIFunc.

	Part II (tool options changes):

	* app/config/gimpconfig-utils.c (gimp_config_reset_properties):
	don't reset object properties because they have NULL as default
	value.

	* app/widgets/gimppropwidgets.[ch]: added
	gimp_prop_[enum|boolean]_radio_frame_new(),
	gimp_prop_paint_mode_menu_new() and gimp_prop_scale_entry_new(),
	which are all needed by the new tool options GUI code.

	* app/tools/tool_options.[ch]: removed the "reset_func" since
	the virtual reset() method is used now.

	* app/paint/gimpairbrushoptions.[ch]
	* app/paint/gimpcloneoptions.[ch]
	* app/paint/gimpconvolveoptions.[ch]
	* app/paint/gimpdodgeburnoptions.[ch]
	* app/paint/gimperaseroptions.[ch]
	* app/paint/gimppaintoptions.[ch]
	* app/paint/gimpsmudgeoptions.[ch]: added properties all over the
	place and removed the widget and default_value members from
	the structs. Renamed some values (e.g. s/type/clone_type/).
	Don't #include <gtk/gtk.h>.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore-stroke.c
	* app/paint/gimppaintcore.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c
	* app/paint/paint-types.h
	* app/paint/paint.c: changed accordingly. Don't #include <gtk/gtk.h>.

	* tools/pdbgen/pdb/paint_tools.pdb: changed accordingly.

	* app/pdb/paint_tools_cmds.c: regenerated.

	* app/tools/gimpblendoptions.[ch]
	* app/tools/gimpbucketfilloptions.[ch]
	* app/tools/gimpcolorpickeroptions.[ch]
	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpflipoptions.[ch]
	* app/tools/gimpinkoptions.c
	* app/tools/gimpmagnifyoptions.[ch]
	* app/tools/gimpmeasureoptions.[ch]
	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimptextoptions.c
	* app/tools/paint_options.[ch]
	* app/tools/selection_options.[ch]
	* app/tools/transform_options.[ch]: ditto: added properties and
	removed widget and default_value stuff. Removed most reset functions.
	Use gimp_prop widgets all over the place, renamed some values
	as above.

	* app/tools/Makefile.am
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectoroptions.c: changed accordingly. Ported
	the paint_options GUI constructors to gimp_prop widgets.

	* app/widgets/gimpselectioneditor.c
	* app/gui/tool-options-dialog.c: changed accordingly.
2003-02-07 17:12:21 +00:00
Sven Neumann
7aaff76971 libgimpbase/Makefile.am added new files that hold the new
2003-02-05  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimputils.[ch]: added new files that hold the new
	gimp_utf8_strtrim() routine; it might be useful in more places.

	* libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories):
	silently ignore directories in the path that can't be opened.

	* app/core/gimpobject.c (gimp_object_set_name_safe): use
	gimp_utf8_strtrim().

	* app/widgets/gimpwidgets-utils.[ch]
	* app/tools/gimptextoptions.c: try to make the text tool options
	look more like all other tool options. Still needs work; I'll
	leave this up to Mitch ...

        This byte --> <-- is the millionth in this file!
2003-02-05 22:15:39 +00:00
Sven Neumann
01cd65071c replaced with an UTF-8 safe rewrite.
2003-02-05  Sven Neumann  <sven@gimp.org>

	* app/core/gimpobject.c (gimp_object_set_name_safe): replaced with
	an UTF-8 safe rewrite.

	* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock): hacked
	to allow being used with non-existent stock_ids (for prototyping).

	* app/widgets/gimpenummenu.c: set the radio button mode correctly.

	* app/widgets/gimpfontselection.c: tweaked spacing.

	* app/tools/gimptextoptions.c: added controls for justification and
	indentation. Removed letter-spacing control for now.

	* app/text/gimptextlayer.[ch]: rerender the text layer from a low
	priority idle function.
2003-02-05 18:23:58 +00:00
Michael Natterer
f8c7174bcb app/paint/gimpairbrush.c app/paint/gimpclone.c app/paint/gimpconvolve.c
2003-02-05  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpinktool.c
	* app/tools/gimppainttool.c
	* app/tools/paint_options.c: use GIMP_CONTEXT(tool_options)
	instead of gimp_get_current_context(). Cleanup.
2003-02-05 16:59:04 +00:00
Sven Neumann
af7db2a186 quick fix to make Gimp survive its startup 2003-02-05 15:17:59 +00:00
Michael Natterer
aa9f82d127 Made GimpToolOptions a GimpContext subclass and objectified all tool
2003-02-05  Michael Natterer  <mitch@gimp.org>

	Made GimpToolOptions a GimpContext subclass and objectified
	all tool options types.

	* app/core/core-types.h: replaced GimpToolOptionsNewFunc by
	GimpToolOptionsGUIFunc.

	* libgimpproxy/gimpproxytypes.h: regenerated.

	* app/core/gimppaintinfo.[ch]: added "GType paint_options_type".

	* app/core/gimptoolinfo.[ch]: added "GType tool_options_type",
	removed tool_info->context since GimpToolOptions are a GimpContext
	now. Added "gboolean use_context" as a temp_hack.

	* libgimptool/gimptooltypes.h: added the tool_options_type to
	the tool registering callback.

	* app/tools/tool_options.[ch]: is a real GimpContext subclass now.

	* app/paint/paint-types.h
	* app/paint/paint.c: added the paint_options_type to the paint
	registering stuff.

	* app/paint/gimppaintoptions.[ch]: is a real GimpToolOptions
	subclass now.

	* app/paint/Makefile.am
	* app/paint/gimpairbrushoptions.[ch]
	* app/paint/gimpcloneoptions.[ch]
	* app/paint/gimpconvolveoptions.[ch]
	* app/paint/gimpdodgeburnoptions.[ch]
	* app/paint/gimperaseroptions.[ch]
	* app/paint/gimpsmudgeoptions.[ch]: new files holding
	GimpPaintOptions subclasses.

	* app/paint/gimpairbrush.[ch]
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.c
	* app/paint/gimppencil.[ch]
	* app/paint/gimpsmudge.[ch]: removed paint options stuff, lots
	of related changed & cleanups.

	* tools/pdbgen/pdb/paint_tools.pdb: changed accordingly.

	* app/pdb/paint_tools_cmds.c: regenerated.

	* app/tools/Makefile.am
	* app/tools/gimpblendoptions.[ch]
	* app/tools/gimpbucketfilloptions.[ch]
	* app/tools/gimpcolorpickeroptions.[ch]
	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpflipoptions.[ch]
	* app/tools/gimpinkoptions.[ch]
	* app/tools/gimpmagnifyoptions.[ch]
	* app/tools/gimpmeasureoptions.[ch]
	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimptextoptions.[ch]
	* app/tools/gimpvectoroptions.[ch]: new files holding the various
	tool options classes.

	* app/tools/selection_options.[ch]
	* app/tools/transform_options.[ch]: made them objects.

	* app/tools/paint_options.[ch]: contains only the paint_options
	GUI and reset stuff.

	* app/tools/tools-types.h: removed SelectionOptions typedef for
	now.

	* app/tools/[all tools]: removed the tool options stuff except
	some GUI constructors. Tons of related changes.

	* app/tools/tool_manager.[ch]: changed tool registration / restore /
	switching accordingly.

	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimpselectioneditor.c: changed accordingly.
2003-02-05 14:39:40 +00:00
Sven Neumann
70c3ea651b app/text/gimptextlayer.c fixed includes.
2003-02-05  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.c
	* app/tools/gimptexttool.c: fixed includes.
2003-02-05 08:45:26 +00:00
Sven Neumann
2c708acab4 app/display/gimpdisplayshell-selection.[ch] app/tools/gimpblendtool.c
2003-02-04  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-selection.[ch]
	* app/tools/gimpblendtool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c: misc trivial changes and cleanup.

	* app/widgets/gimppropwidgets.[ch]: added gimp_prop_unit_menu_new()
	and removed the scale widget again.

	* app/tools/gimptexttool.c: replaced the size scale entry with a
	spinbutton and made the unit menu working.

	* app/text/gimptext.c: increased the upper boundary for the font
	size again now that we don't use a scale any longer.
2003-02-03 23:54:19 +00:00
Sven Neumann
4fb5ca6a87 changed the text used in the preview.
2003-02-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfontselection-dialog.c: changed the text used in
	the preview.

	* app/widgets/gimpfontselection.[ch]: removed the yes/no image
	that used to signal a valid font but stopped working a long time
	ago.

	* app/widgets/gimppropwidgets.c: added a property widget for fonts.

	* app/tools/gimptexttool.c: use the new prop_widget.
2003-02-03 18:11:54 +00:00
Sven Neumann
47f2a7f8d9 app/config/gimpconfig.[ch] added a reset method to GimpConfigInterface.
2003-02-01  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig.[ch]
	* app/config/gimpconfig-utils.[ch]: added a reset method to
	GimpConfigInterface. Added the new function gimp_config_reset()

	* app/text/gimptext.c: added a GimpConfigInterface to GimpText.

	* app/widgets/Makefile.am
	* app/widgets/gimptexteditor.[ch]: new files that hold the simple
	text editor dialog used by the text tool.

	* app/widgets/gimppropwidgets.[ch]: added new widget constructor
	gimp_prop_scale_entry_new().

	* app/tools/gimptexttool.[ch]: replaced old-style ToolOptions with
	a GimpText object. Connect text layers to the text tool by means
	of their GimpText objects. Still work in progress ...
2003-02-01 21:50:21 +00:00
Sven Neumann
5e2c14ba8c don't use gimp_drawable_configure() to resize the text layer, it should
2003-01-31  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.c: don't use gimp_drawable_configure() to
	resize the text layer, it should only ever be called once. Take
	the logical rectangle into account when calculating the layer size
	and text position.

	* app/tools/gimptexttool.[ch]: added basic text editing
	functionality. Needs more work ...

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-gravity-east-24.png
	* themes/Default/images/stock-gravity-north-24.png
	* themes/Default/images/stock-gravity-north-east-24.png
	* themes/Default/images/stock-gravity-north-west-24.png
	* themes/Default/images/stock-gravity-south-24.png
	* themes/Default/images/stock-gravity-south-east-24.png
	* themes/Default/images/stock-gravity-south-west-24.png

	* themes/Default/images/stock-gravity-west-24.png: added new icons
	for yet-to-written GimpGravityChooser(?) widget. Artwork
	shamelessly taken from Jimmac's XFree cursors.

	* libgimpwidgets/gimpstock.[ch]: added stock items for the new icons.
2003-01-31 18:57:10 +00:00
Michael Natterer
794885e297 added gimp_item_configure() and gimp_item_copy().
2003-01-31  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: added gimp_item_configure() and
	gimp_item_copy().

	* app/core/gimpdrawable.c (gimp_drawable_configure,copy): use them.

	* app/vectors/gimpvectors.[ch]: added gimp_vectors_new(),
	gimp_vectors_copy() and gimp_vectors_copy_points(). Use the new
	GimpItem functions just as GimpDrawable does. Added a
	get_memsize() implementation.

	* app/vectors/gimpstroke.[ch]: made it a GimpObject and added
	a get_memsize() implementation.

	* app/undo.c: implemented vectors undo as if the new GimpVectors
	functions above worked.

	* app/gui/dialogs-constructors.c
	* app/gui/vectors-commands.c
	* app/tools/gimpvectortool.c: use gimp_vectors_new,copy().
2003-01-31 18:08:32 +00:00
Sven Neumann
57a23b7b54 allow NULL as context parameter in gimp_font_selection_new(). The widget
2003-01-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfontselection.c: allow NULL as context parameter
	in gimp_font_selection_new(). The widget then uses a default
	PangoFT2Context.

	* app/tools/gimptexttool.c (text_tool_options_new): call
	gimp_font_selection_new() with a NULL context. The text tool now
	doesn't know about Pango any longer.

	* app/paint/Makefile.am
	* app/tools/Makefile.am (INCLUDES): removed PANGOFT2_CFLAGS.
2003-01-31 13:58:49 +00:00
Sven Neumann
8ed5a7207c added new enum GimpGravityType.
2003-01-31  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.[ch]: added new enum GimpGravityType.

	* app/text/gimptext.[ch]
	* app/text/gimptextlayer.[ch]: added support for specifying a
	fixed layer size and how to position the text inside the layer.

	* app/text/gimptext-compat.c
	* app/tools/gimptexttool.c: changed accordingly.
2003-01-31 13:36:27 +00:00
Sven Neumann
27698a2b3f app/config/gimpconfig-params.h
2003-01-31  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-params.h

	* app/config/gimpcoreconfig.c: added a pixels parameter to the
	GIMP_CONFIG_INSTALL_PROP_UNIT() macro.

	* app/core/Makefile.am
	* app/core/gimpimage-text.[ch]: removed these two files.

	* app/text/Makefile.am
	* app/text/gimptext-compat.[ch]: new files with compatibility
	routines that provide the old text API (solely for PDB calls).

	* app/text/gimptext-render.[ch]: new files with text rendering
	routines (not much yet).

	* app/text/text-types.h
	* app/text/gimptextlayer.[ch]: new object derived from GimpLayer.

	* app/text/gimptext.[ch]: prepared for future improvements.

	* app/pdb/text_tool_cmds.c
	* app/tools/gimptexttool.c
	* tools/pdbgen/pdb/text_tool.pdb: changed accordingly.
2003-01-31 09:22:42 +00:00
Nate Summers
82109cf097 GimpToolGui 2003-01-30 08:01:32 +00:00
Sven Neumann
60273b5b9a configure.in app/Makefile.am added new directory text.
2003-01-29  Sven Neumann  <sven@gimp.org>

	* configure.in
	* app/Makefile.am
	* app/text/Makefile.am: added new directory text.

	* app/text/text-types.h
	* app/text/gimptext.[ch]: moved GimpText object here.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpimage-text.c
	* app/tools/gimptexttool.c: changed accordingly.
2003-01-29 22:20:09 +00:00
Sven Neumann
04d29efd74 added a new enum to specify how to display histograms.
2003-01-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-enums.h: added a new enum to specify how to
	display histograms.

	* app/widgets/widgets-enums.c: regenerated.

	* app/widgets/gimphistogramview.[ch]: added a scale property and
	made channel a property. Added support for linear histograms based
	on a patch from Akkana (see bug #72951).

	* app/widgets/gimphistogrambox.c: redraw the gradient when the
	histogram view notifies it that the displayed channel has changed.

	* app/tools/gimphistogramtool.c: added a menu to configure the
	histogram scale.
2003-01-25 18:58:45 +00:00
Sven Neumann
5653afe300 app/tools/gimplevelstool.c moved the creation of the histogram object to
2003-01-17  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c: moved the creation of the
	histogram object to the initialize method because we can't access
	tool_info->gimp in tool_init().
2003-01-17 13:34:26 +00:00
Sven Neumann
bb9a49ab08 Fixed bug #103561:
2003-01-15  Sven Neumann  <sven@gimp.org>

	Fixed bug #103561:

	* app/base/gimphistogram.[ch]: cleaned up multi-processor code,
	added a GimpBaseConfig parameter to gimp_histogram_new().

	* app/core/gimpdrawable-equalize.c
	* app/pdb/color_cmds.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* tools/pdbgen/pdb/color.pdb: changed accordingly.

	* app/base/pixel-processor.c: some cleanup to the multi-processor
	code; use the global base_config variable :(
2003-01-15 13:40:44 +00:00
Manish Singh
248dbd1e93 app/core/gimpchannel.h app/core/gimpitem.c
2003-01-14  Manish Singh  <yosh@gimp.org>

        * app/core/gimpchannel.h
        * app/core/gimpitem.c
        * app/display/gimpnavigationview.c
        * app/gui/paths-dialog.c
        * app/tools/gimphistogramtool.c
        * app/tools/gimpscaletool.c
        * app/widgets/gimplistitem.c
        * libgimp/gimppixelrgn.c
        * libgimpwidgets/gimpunitmenu.c
        * plug-ins/FractalExplorer/Dialogs.c
        * plug-ins/common/aa.c
        * plug-ins/common/despeckle.c
        * plug-ins/common/psd.c
        * plug-ins/common/sharpen.c
        * plug-ins/common/snoise.c
        * plug-ins/common/spread.c
        * plug-ins/ifscompose/ifscompose.c
        * plug-ins/xjt/xjt.c: some minor code cleanup

        * plug-ins/common/csource.c: 64-bit cleanliness
2003-01-15 03:55:20 +00:00
Michael Natterer
7e1396f9bf app/tools/gimpbezierselecttool.c app/tools/gimpbycolorselecttool.c
2003-01-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimprectselecttool.c: must use N_() instead of _()
	when registering tool menu entries.
2003-01-14 21:56:30 +00:00
Michael Natterer
8d86ec25e0 Move away from creating all item_factories statically in menus_init() but
2003-01-10  Michael Natterer  <mitch@gimp.org>

	Move away from creating all item_factories statically in
	menus_init() but create a new one for each place where one is
	needed:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmenufactory.[ch]: new factory which creates and
	configures the GimpItemFactories it knows about on-the-fly.

	* app/widgets/gimpitemfactory.[ch]: added
	gimp_item_factory_update() which calls the "update_func". Added
	"gboolean update_on_popup" so item_factories can be configured to
	require manual updates (used for the <Image> factory).

	* app/gui/menus.[ch]: create a "global_menu_factory" and register
	all menus we have with it. Added various setup functions which
	do stuff like adding the "Open Recent" menu or reorder plug-in
	menu entries. Removed the debugging stuff...

	* app/gui/Makefile.am
	* app/gui/debug-commands.[ch]: ...and added it here.

	* app/gui/gui.c: create the <Toolbox>, the popup-<Image> and the
	<Paths> factories here because they are still global.

	* app/gui/plug-in-menus.[ch]: changed the "image_factory"
	parameters to "item_factory" and create/update the entries for the
	passed item_factory only. Makes the whole stuff much more
	straightforward.

	* app/plug-in/plug-ins.c: don't call plug_in_make_menu().

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell.[ch]: added "menu_factory" and
	"popup_factory" parameters to gimp_display_new() and
	gimp_display_shell_new(). Create the menubar_factory and the
	qmask_factory dynamically. Pass the shell, not a Gimp to the QMask
	callbacks. Changed gimp_display_shell_set_menu_sensitivity() to
	gimp_display_shell_menu_update() and don't call it directly (it's
	a GimpItemFactory update_func now). Call gimp_item_factory_update()
	on the resp. factories instead.

	* app/gui/qmask-commands.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/tools/gimpimagemaptool.c: changed accordingly.

	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpbrushfactoryview.[ch]
	* app/widgets/gimpbufferview.[ch]
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpdataeditor.[ch]
	* app/widgets/gimpdatafactoryview.[ch]
	* app/widgets/gimpdialogfactory.[ch]
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.[ch]
	* app/widgets/gimpdocumentview.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpimageview.[ch]
	* app/widgets/gimpitemlistview.[ch]
	* app/widgets/gimppaletteeditor.[ch]: pass around lots of
	GimpMenuFactory pointers and menu_identifiers so all views can
	create their item_factories themselves. Unref the factories when
	they are no longer needed because they belong to the views now.

	* app/gui/dialogs-commands.c
	* app/gui/dialogs-constructors.c
	* app/gui/dialogs.c
	* app/gui/brush-select.c
	* app/gui/gradient-select.c
	* app/gui/palette-select.c
	* app/gui/pattern-select.c: changed accordingly.

	* app/gui/file-dialog-utils.[ch] (file_dialog_new): require
	menu_factory and menu_identifier parameters.

	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]: removed file_*_dialog_menu_init()
	(they went to menus.c as setup_funcs). Added file_*_dialog_set_type()
	and moved the <Load> and <Save> factory callbacks to file-commands.c

	* app/gui/file-commands.[ch]: changed accordingly.

	* app/gui/view-commands.c: changed the statusbar, menubar, rulers
	and guides callbacks to do their job only if the setting has
	actually changed. Don't update whole item factories afterwards.
	Instead, just change the state of the items that actually need
	update.

	Unrelated:

	* app/core/gimpchannel.c (gimp_channel_init): set "bounds_known"
	and friends to FALSE since we don't know that the new channel will
	be empty (fixes QMask and probably other stuff).

	* app/gui/image-commands.c
	* app/gui/vectors-commands.c: cleanup.
2003-01-10 17:55:53 +00:00
Michael Natterer
415f54d126 create a new GimpVectors object if the tool has none. Cleanup.
2003-01-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.c (gimp_vector_tool_button_press):
	create a new GimpVectors object if the tool has none. Cleanup.
2003-01-10 13:26:47 +00:00
Sven Neumann
44c1bbe1cf fixed typos.
2003-01-09  Sven Neumann  <sven@gimp.org>

        * app/app_procs.c: fixed typos.

        * app/tools/xinput_airbrush.[ch]: removed from CVS; can always be
        resurrected from the Attic. The files kept getting in the way when
        grepping the source.
2003-01-09 18:02:43 +00:00
Michael Natterer
224ecade54 added enum GimpRectSelectMode which can be one of "free", "fixed-size" and
2003-01-06  Michael Natterer  <mitch@gimp.org>

	* libgimptool/gimptoolenums.[ch]: added enum GimpRectSelectMode
	which can be one of "free", "fixed-size" and "fixed-ratio".

	* app/tools/selection_options.[ch]: replaced the "Fixed Size /
	Aspect Ratio" toggle by a menu offering the choices above.

	* app/tools/gimprectselecttool.[ch]: changed accordingly. Removed
	the possibility to <shift>-switch from "fixed-size" to
	"fixed-ratio" mode. Fixes bug #100320.
2003-01-06 16:25:04 +00:00
Manish Singh
1a44f2126c cleanup, removed unecessary G_OBJECT() casts. Should do the same for
2003-01-05  Manish Singh  <yosh@gimp.org>

        * many files in app, modules and libgimp*: cleanup, removed unecessary
        G_OBJECT() casts. Should do the same for plug-ins, when more of them
        get undeprecated.
2003-01-05 22:07:10 +00:00
Manish Singh
013e30db54 app/undo_history.c app/core/gimpbrush.c app/core/gimpimage-new.c
2003-01-05  Manish Singh  <yosh@gimp.org>

        * app/undo_history.c
        * app/core/gimpbrush.c
        * app/core/gimpimage-new.c
        * app/core/gimpobject.c
        * app/core/gimppalette-import.c
        * app/core/gimppattern.c
        * app/plug-in/plug-in.c
        * app/tools/gimpbezierselecttool.c
        * libgimpwidgets/gimpunitmenu.c
        * plug-ins/MapObject/mapobject_ui.c
        * plug-ins/common/convmatrix.c
        * plug-ins/common/curve_bend.c
        * plug-ins/common/sample_colorize.c
        * plug-ins/common/tiff.c
        * plug-ins/flame/flame.c
        * plug-ins/gflare/gflare.c
        * plug-ins/gimpressionist/general.c
        * plug-ins/gimpressionist/orientation.c
        * plug-ins/gimpressionist/preview.c
        * plug-ins/gimpressionist/size.c
        * plug-ins/imagemap/imap_grid.c
        * plug-ins/imagemap/imap_menu.c
        * plug-ins/maze/algorithms.c
        * plug-ins/script-fu/interp_regex.c
        * plug-ins/script-fu/interp_sliba.c
        * plug-ins/script-fu/script-fu-console.c
        * plug-ins/script-fu/script-fu-server.c
        * plug-ins/webbrowser/webbrowser.c: added GINT_TO_POINTER and friends,
        fixed format strings, for 64-bitness.

        * modules/colorsel_triangle.c
        * plug-ins/tools/tool-safe-mode-plug-in.c: #include missing header
        files
2003-01-05 20:38:21 +00:00
Sven Neumann
ec6c98656e bumped the version number to 1.3.12.
2003-01-03  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped the version number to 1.3.12.

	* app/display/Makefile.am
	* app/display/gimpdisplayshell-cursor.[ch]
	* app/display/gimpdisplayshell-title.[ch]
	* app/display/gimpdisplayshell-transform.[ch]: new files with code
	that used to live in gimpdisplayshell.c.

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-selection.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdrawtool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimptool.c: changed accordingly.
2003-01-03 18:01:30 +00:00
Michael Natterer
28bd9bf707 don't HALT the active tool if it is in "preserve" mode. Fixes crashes when
2003-01-03  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c (tool_manager_image_undo_start): don't
	HALT the active tool if it is in "preserve" mode. Fixes crashes
	when e.g. the transform tool was pushing an undo group and
	implicitly HALTing itself in the middle of the transform
	operation.
2003-01-03 17:01:55 +00:00
Michael Natterer
ef3f572af4 don't set paused_count to 0.
2003-01-03  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptoolcontrol.c (gimp_tool_control_halt): don't
	set paused_count to 0.

	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c
	* app/tools/tool_manager.c: removed comments about doing so.
2003-01-03 13:59:23 +00:00
Michael Natterer
ea95a3227d Replaced Garry's fix for bug #98843 by a more general solution which stops
2003-01-02  Michael Natterer  <mitch@gimp.org>

	Replaced Garry's fix for bug #98843 by a more general solution
	which stops the active tool when an undo group start is pushed:

	* app/core/gimpimage.[ch]: removed the "layer_merge" signal
	and added "undo_start" instead.

	* app/undo.c: emit "undo_start" in undo_push_group_start()
	_before_ checking if gimage->undo_on is TRUE.

	* app/tools/tool_manager.c: connect to "undo_start" and HALT the
	active tool if neccessary.

	* app/core/core-types.h: added EDIT_COPY_UNDO_GROUP.

	* app/core/gimpedit.c: push an undo group around the copy
	operation. Will probably have to add more undo group types to wrap
	other critical image modifications with.

	* app/core/gimpimage-merge.c
	* app/gui/convert-dialog.c
	* app/gui/edit-commands.c
	* app/gui/test-commands.c
	* app/tools/gimpimagemaptool.c: removed all special code to
	stop the active tool.
2003-01-02 13:38:09 +00:00
Garry R. Osgood
d8fd3b04c1 Updated my CVS. app/undo.c app/undo_history.c app/core/gimpimage.[ch]
2003-01-01 Garry R. Osgood <grosgood@rcn.com>
* MAINTAINERS: Updated my CVS.
* app/undo.c
* app/undo_history.c
* app/core/gimpimage.[ch]
* app/tools/gimpimagemaptool.c
* app/core/gimpimage-merge.c: implementation of LAYER_MERGE
signal emitters and listeners. (see bug #98843); listeners thaw
undo stack (image map tools, usually).
* app/widgets/gimpviewabledialog.c: gimp_viewable_dialog_close ()
Check if the widget has a non-null reference to a window before
using it to synthesize a cancel event. These seven deltas closes bug #98843.
* app/core/gimpimage-merge.c: (gimp_image_merge_layers())
Regardless of merge type, temporarily set composition mode
of bottom layer to NORMAL, then merge. Closes bug #101036.
2003-01-01 23:40:53 +00:00
Simon Budig
62b61811b3 New Type: GimpVectorExtendMode
2002-12-31  Simon Budig  <simon@gimp.org>

        * app/vectors/vectors-types.h: New Type: GimpVectorExtendMode

        * app/tools/gimpvectortool.c
        * app/vectors/gimpstroke.[ch]
        * app/vectors/gimpbezierstroke.[ch]: More stuff on the path
        (pun intended) to a better path tool...

        Thanks to Sven for being my host in Berlin!
2002-12-31 03:18:49 +00:00
Simon Budig
b7e1bb247b app/vectors/gimpanchor.h Anchors now have an enum as type and have the
2002-12-30  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpanchor.h
        * app/vectors/vectors-types.h: Anchors now have an enum as type and
        have the "selected" property.

        * app/vectors/gimpstroke.[ch]
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpvectors-preview.c: Additional functions to get
        information about the graphical representation of the stroke and be
        able to select anchors.

        * app/tools/gimpvectortool.c: semi-usable interface, better graphical
        representation of what is going on. Also make use of the "selected"
        property of the anhors to just display a subset of the control
        handles.
2002-12-30 16:36:01 +00:00
Sven Neumann
023c76978f configure.in etc/Makefile.am etc/gimprc.in removed templates for gimprc
2002-12-29  Sven Neumann  <sven@gimp.org>

	* configure.in
	* etc/Makefile.am
	* etc/gimprc.in
	* etc/gimprc_user.in: removed templates for gimprc files.

	* etc/gimprc: added this file as generated by gimp-config-dump.

	* app/gui/user-install-dialog.c
	* data/misc/user_install: don't install an empty user gimprc.

	* app/config/Makefile.am
	* app/config/gimpconfig-substitute.[ch]: removed these files.
	* app/config/gimpconfig-path.[ch]: and added them again with
	reduced functionality. Paths found in config files are now
	basically handled like standard strings by the config system.
	Users of the GimpConfig path variables need to expand the path
	themselves.

	* app/config/gimpbaseconfig.c
	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-utils.c
	* app/config/gimpconfig.c
	* app/config/gimpcoreconfig.c
	* app/config/gimprc.c:
	* app/base/base.c
	* app/base/temp-buf.c
	* app/core/gimp.c
	* app/core/gimpdatafactory.c
	* app/core/gimpmodules.c
	* app/gui/user-install-dialog.c
	* app/plug-in/plug-in.c
	* app/tools/tools.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2002-12-29 18:58:24 +00:00
Simon Budig
d3e9fc6405 app/core/gimpimage-mask-select.c app/paint/gimppaintcore-stroke.c
2002-12-29  Simon Budig  <simon@gimp.org>

        * app/core/gimpimage-mask-select.c
        * app/paint/gimppaintcore-stroke.c
        * app/tools/gimpvectortool.c
        * app/vectors/gimpbezierstroke.[ch]
        * app/vectors/gimpstroke.[ch]
        * app/vectors/gimpvectors-preview.c: some more stuff for the
        vectors tool: bezier interpolation is available, we have preview
        generation. Usage is still weird.
2002-12-28 23:52:29 +00:00
Michael Natterer
4328fa941b added utility functions gimp_get_mod_name_[shift|control|alt]() and
2002-12-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added utility functions
	gimp_get_mod_name_[shift|control|alt]() and gimp_get_mod_separator()
	which get the translated strings for "Shift", "Ctrl", "Alt" and "+"
	from GtkAccelLabelClass to force consistency between menu
	accelerators and other modifiers displayed in the GUI.
	Made the format string to display the modifier ("<%s>")
	translatable separately.

	* app/gui/file-open-dialog.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmovetool.c
	* app/tools/transform_options.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemlistview.c
	* app/widgets/gimpvectorslistview.c: use the new functions instead
	of hardcoding the modifier names over and over again.

	* app/tools/transform_options.c: made a scale_entry out of the
	grid density spinbutton.
2002-12-19 16:33:29 +00:00
Michael Natterer
94cf84b2c3 app/tools/gimpcurvestool.c replaced lots of "gpointer data" parameters of
2002-12-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: replaced lots of "gpointer data"
	parameters of local callbacks by GimpCurvesTool* and
	GimpLevelsTool* pointers. Makes the code shorter and more
	readable. Some random cleanup.

	* app/tools/gimphistogramtool.c: fixed type of "parent_class"
	pointer.
2002-12-18 15:57:25 +00:00
Michael Natterer
6af7df6291 app/tools/gimptransformtool.c replaced the totally unclear (to the user)
2002-12-17  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.c
	* app/tools/transform_options.[ch]: replaced the totally unclear
	(to the user) way we used to calculate the number of grid lines
	from the value entered in the "Density" spinbutton by a system
	where the user has the choice between the number of grid lines to
	display and the spacing between the displayed grid lines. Replaced
	the "Show Grid" toggle by an option menu to choose the grid type
	from. (idea from drc on #gimp).
2002-12-17 15:46:47 +00:00
Michael Natterer
1d1be9f079 use gdisp->gimage->gimp instead of the_gimp.
2002-12-14  Michael Natterer  <mitch@gimp.org>

	* app/gui/plug-in-commands.c (plug_in_repeat_cmd_callback):
	use gdisp->gimage->gimp instead of the_gimp.

	* app/tools/gimpimagemaptool.c: pass update_popup == FALSE to
	gimp_display_shell_set_menu_sensitivity().
2002-12-14 15:55:26 +00:00
Sven Neumann
78fb9db8cc made it compile after Mitch's changes.
2002-12-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c: made it compile after Mitch's
	changes.
2002-12-14 14:30:50 +00:00
Sven Neumann
1c60f4e045 check for gdisp != NULL to avoid to crash when being called from
2002-12-03  Sven Neumann  <sven@gimp.org>

	* app/tools/tool_manager.c (tool_manager_control_active): check
	for gdisp != NULL to avoid to crash when being called from
	indexed_ok_callback().
2002-12-03 11:31:15 +00:00
Michael Natterer
7fe6f39fb4 no need to include "appenv.h"
2002-11-30  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpnavigationview.c: no need to include "appenv.h"

	* app/tools/gimpinktool.c: pass InkOptions as user_data to the
	ink_type_update() callback so we don't need to get them from
	"the_gimp". Removed inclusion of "app_procs.h".
2002-11-30 22:55:01 +00:00
Michael Natterer
4d2cc6452b app/paint/gimpairbrush.[ch] app/paint/gimpclone.[ch]
2002-11-27  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpairbrush.[ch]
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintoptions.[ch]
	* app/paint/gimpsmudge.[ch]: it's hard to paint without a context
	to get color, brush etc. from. Added "context" parameters to
	all paint options constructors.

	* tools/pdbgen/pdb/paint_tools.pdb: pass gimp_get_current_context()
	to the constructors. Fixes bug #99557.

	* app/pdb/paint_tools_cmds.c: regenerated.

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpsmudgetool.c: changed accordingly.

	* app/tools/paint_options.c: ditto. Don't set
	paint_options->context here because we also need it in the
	no-interface case above.
2002-11-27 22:55:03 +00:00
Sven Neumann
073e533a8a Finally landed the new GimpConfig based gimprc parser. It's not finished
2002-11-18  Sven Neumann  <sven@gimp.org>

	Finally landed the new GimpConfig based gimprc parser. It's not
	finished yet but we need to start somewhere. This release removes
	the old gimprc.[ch] files. The gimprc format changes slightly, but
	the changes are minimal. The Preferences dialog is temporarily
	disabled since it still needs to be ported. If you are are afraid,
	stay away from CVS for a few days ;-)

	* app/Makefile.am
	* app/gimprc.[ch]: removed the old gimprc system.

	* app/base/Makefile.am
	* app/base/base-config.[ch]: removed these files in favor of
	config/gimpbaseconfig.[ch].

	* app/core/Makefile.am
	* app/core/gimpcoreconfig.[ch]: removed these files in favor of
	config/gimpcoreconfig.[ch].

	* app/config/Makefile.am
	* app/config/config-types.h: moved typedefs into this new file.

	* app/config/gimpbaseconfig.[ch]
	* app/config/gimpcoreconfig.[ch]
	* app/config/gimpdisplayconfig.[ch]
	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc.[ch]
	* app/config/test-config.c: brought into shape for real use.

	* app/base/base-types.h: include config/config-types.h here. Added
	a global GimpBaseConfig *base_config variable to ease migration.

	* app/gui/Makefile.am: temporarily disabled the preferences dialog.

	* app/app_procs.c
	* app/undo.c
	* app/undo_history.c
	* app/base/base.[ch]
	* app/base/gimphistogram.c
	* app/base/pixel-processor.c
	* app/base/temp-buf.c
	* app/base/tile-cache.c
	* app/core/core-types.h
	* app/core/gimp-documents.c
	* app/core/gimp.c
	* app/core/gimpbrush.c
	* app/core/gimpbrushgenerated.c
	* app/core/gimpcontext.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/core/gimpmodules.c
	* app/core/gimppattern.c
	* app/display/Makefile.am
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-scroll.c
	* app/display/gimpdisplayshell-selection.c
	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpnavigationview.c
	* app/file/file-save.c
	* app/gui/device-status-dialog.c
	* app/gui/dialogs-constructors.c
	* app/gui/file-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gui.c
	* app/gui/menus.c
	* app/gui/paths-dialog.c
	* app/gui/resize-dialog.c
	* app/gui/session.c
	* app/gui/test-commands.c
	* app/gui/tips-dialog.c
	* app/gui/tips-dialog.h
	* app/gui/user-install-dialog.c
	* app/gui/view-commands.c
	* app/paint/gimppaintcore.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimptexttool.[ch]
	* app/tools/selection_options.c
	* app/tools/tools.c
	* app/tools/transform_options.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpitemfactory.c
	* app/widgets/gimpselectioneditor.c
	* app/xcf/xcf-load.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/gimprc.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: use the new config system
	instead of the old gimprc stuff.

	* etc/gimprc.in
	* etc/gimprc_user.in: adapted to the new gimprc format. Will update
	the man-page later...

	* app/pdb/fileops_cmds.c
	* app/pdb/gimprc_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/transform_tools_cmds.c
	* libgimp/gimpgimprc_pdb.c: regenerated.
2002-11-18 20:50:31 +00:00
Michael Natterer
c8a980761b removed public function gimp_transform_tool_transform_tiles() and made it
2002-11-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.[ch]: removed public function
	gimp_transform_tool_transform_tiles() and made it the default
	implementation of the transform() virtual function. Added
	"const gchar *progress_text" to GimpTransformTool so it is
	available for the new default implementation. Cleanup.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: removed transform() implementations
	and set transform_tool->progress_text accordingly. Even more
	cleanup.
2002-11-18 13:10:04 +00:00
Michael Natterer
80a1156202 removed unneeded #includes.
2002-11-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c: removed unneeded #includes.
2002-11-18 00:13:24 +00:00
Michael Natterer
7476328f21 compare the old and new angle using an epsilon of 0.0001 degrees so we
2002-11-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimprotatetool.c (roatate_angle_changed): compare the
	old and new angle using an epsilon of 0.0001 degrees so we don't
	get double "angle changed" because of rounding foobar.

	* app/tools/gimptransformtool.c: made GimpTransformTool subclasses
	which don't use the grid (namely the flip tool) work correctly
	again by looking at transform_tool->use_grid more often.
2002-11-17 23:56:13 +00:00
Michael Natterer
7ee99ea3a3 Transform tool cleanup:
2002-11-14  Michael Natterer  <mitch@gimp.org>

	Transform tool cleanup:

	* libgimptool/gimptoolenums.[ch]: removed the TransformState enum.

	* app/tools/gimptransformtool.[ch]: don't dispatch everything
	through the transform() virtual function. Added new vitrual
	functions dialog(), prepare(), motion() and recalc(). Do only the
	actual transform in transform(). Moved lots of logic which was
	duplicated in each subclass' transform() here. Cleanup.

	* app/tools/gimpfliptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: changed accordingly: moved code from
	transform() to the other method imlementations. Removed duplicated
	logic which is now done by our parent class. Makes everything
	smaller and more readable.

	InfoDialog cleanup:

	* app/gui/info-dialog.c: removed the "delete_event" callback so
	InfoDialog users can decide themselves what to do.

	* app/gui/info-window.c
	* app/tools/gimpmeasuretool.c: changed accordingly.

	* app/tools/gimpcolorpickertool.c: ditto. Moved info_dialog
	creation to a utility function to improve code readbility.

	* app/tools/gimpcroptool.c: ditto. Added a "Cancel" button which
	really cancels the tool instead of just hiding the dialog.

	* app/tools/gimptransformtool.c: added a "Cancel" button here too.
2002-11-14 11:54:57 +00:00
Michael Natterer
1f3bd28832 removed the old hack which sets tool->gdisp. Fixes bug #98056.
2002-11-14  Michael Natterer  <mitch@gimp.org>

	* app/gui/tools-commands.c (tools_select_cmd_callback): removed
	the old hack which sets tool->gdisp. Fixes bug #98056.

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_initialize):
	set tool->gdisp here because the hack was there for tools which
	implement initialize() and show dialogs when selected from the
	menu. Also fixed wrong paramater to gimp_viewable_dialog_new().
2002-11-14 11:08:40 +00:00
Sven Neumann
00be63593c bumped version number to 1.3.10.
2002-11-01  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 1.3.10.

	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppathtool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c: use shorter strings for the dockable
	tabs.
2002-10-31 23:06:09 +00:00
Sven Neumann
f5780115a7 app/tools/Makefile.am removed this file which was moved to libgimptool in
2002-10-29  Sven Neumann  <sven@gimp.org>

        * app/tools/Makefile.am
        * app/tools/tools-enums.c: removed this file which was moved to
        libgimptool in March.
2002-10-29 10:51:34 +00:00
Michael Natterer
b5d27fc4ac app/display/gimpdisplayshell.c app/gui/about-dialog.c
2002-10-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c
	* app/gui/about-dialog.c
	* app/gui/convert-dialog.c
	* app/gui/dialogs-commands.c
	* app/gui/file-commands.c
	* app/gui/palette-import-dialog.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpwidgets-utils.c
	* libgimpwidgets/gimpfileselection.c
	* plug-ins/FractalExplorer/Dialogs.c
	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/common/AlienMap.c
	* plug-ins/common/AlienMap2.c
	* plug-ins/common/spheredesigner.c
	* plug-ins/flame/flame.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gimpressionist/general.c
	* plug-ins/gimpressionist/gimpressionist.c: replaced all sorts of
	gtk_widget_show()/gdk_window_rise() combinations by
	gtk_window_present().
2002-10-25 01:11:24 +00:00
Michael Natterer
c7ac6aff52 Moved generic datafile loading to LibGimpBase:
2002-10-23  Michael Natterer  <mitch@gimp.org>

	Moved generic datafile loading to LibGimpBase:

	* app/core/gimpdatafiles.[ch]: removed...

	* libgimpbase/gimpdatafiles.[ch]: ...and add here with a changed
	API which requires no more global variables.

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbasetypes.h
	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpdatafactory.c
	* app/gui/gui.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins.c
	* app/tools/tools.c: changed accordingly.

	Moved module loading to LibGimpModule:

	* app/core/gimpmodules.c: removed lots of code...

	* libgimpmodule/gimpmoduledb.[ch]: ...and added it here as
	GimpModuleDB object.

	* libgimpmodule/Makefile.am
	* libgimpmodule/gimpmoduletypes.h: changed accordingly.

	* app/core/gimp.[ch]: replaced gimp->modules by gimp->module_db.

	* libgimpmodule/gimpmodule.[ch]: added
	gimp_module_query(). Internal cleanup. Stuff...

	* app/gui/module-browser.c: changed accordingly. Unfinished...

	* app/core/gimpcontainer.c
	* app/core/gimplist.c: reverted the HACKS introduced recently.

	* app/core/gimpobject.[ch]: added gimp_g_object_get_memsize()
	utility function.

	* libgimpproxy/gimpobject.[ch]: regenerated.

	Changed display filter configuration stuff:

	* libgimpwidgets/gimpcolordisplay.[ch]: made the virtual
	configure() function return a GtkWidget instead of opening a
	dialog. Changed configure_cancel() to configure_reset(). Added
	"changed" signal.

	* app/display/gimpdisplayshell-filter-dialog.c: embed the filters'
	config GUI in the dialog. Connect to "changed" and added a "Reset"
	button which resets the filter.

	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c: changed accordingly.

	* modules/colorsel_triangle.c
	* modules/colorsel_water.c: minor fixes.

2002-10-23  Michael Natterer  <mitch@gimp.org>

	* libgimpbase/libgimpbase-docs.sgml
	* libgimpbase/libgimpbase-sections.txt
	* libgimpbase/tmpl/gimpbasetypes.sgml
	* libgimpbase/tmpl/gimpdatafiles.sgml: added GimpDatafiles

	* libgimpmodule/libgimpmodule-docs.sgml
	* libgimpmodule/libgimpmodule-sections.txt
	* libgimpmodule/tmpl/gimpmoduledb.sgml: added GimpModuleDB.

	* libgimpwidgets/libgimpwidgets.types: added gimp_dialog_get_type

	* libgimpmodule/tmpl/gimpmodule.sgml
	* libgimpwidgets/tmpl/gimpcolordisplay.sgml
	* libgimpwidgets/tmpl/gimpdialog.sgml: updated.
2002-10-23 14:55:07 +00:00
Sven Neumann
bb2b9f6825 added the API for level correction using black, gray and white point.
2002-10-15  Sven Neumann  <sven@gimp.org>

	* app/base/levels.[ch]: added the API for level correction using
	black, gray and white point.

	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.[ch]: misc smaller changes.

	* app/widgets/gimphistogrambox.[ch]: allocate the buffer for the
	gradient preview on size_allocate, not for every expose event.

	* app/widgets/gimphistogramview.c: fixed drawing for width > 256.

	* themes/Default/images/stock-color-picker-white-18.png: tweaked.
2002-10-15 13:36:28 +00:00
Sven Neumann
8a50627682 using gtk_image_new_from_pixmap() feels kinda lame. Draw the ink blob
2002-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpinktool.c: using gtk_image_new_from_pixmap() feels
	kinda lame. Draw the ink blob directly in an expose handler instead.
2002-10-15 01:56:45 +00:00
Sven Neumann
bd7e71dd60 no need to undef GTK_DISABLE_DEPRECATED any longer 2002-10-15 01:18:34 +00:00
Sven Neumann
9a9009bad9 app/tools/gimphistogramtool.c app/tools/gimplevelstool.[ch]
2002-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.[ch]
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimphistogrambox.[ch]
	* app/widgets/gimphistogramview.[ch]: started to clean up histogram
	code. Moved the gradient into the GimpHistogramBox. Draw only in the
	expose event handler.
2002-10-15 01:15:43 +00:00
Dave Neary
29cb0e89ab app/tools/gimpinktool.c Remooved warnings by including string.h, and
2002-10-15  Dave Neary  <bolsh@gimp.org>
        * app/tools/gimpinktool.c
        * app/tools/gimptexttool.c: Remooved warnings by
        including string.h, and changing from gtk_pixmap_new()
        to gtk_image_new_from_pixmap().
2002-10-14 22:07:39 +00:00
Sven Neumann
6303579945 added convenience function gimp_display_coords_in_active_drawable().
2002-10-14  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplay.[ch]: added convenience function
	gimp_display_coords_in_active_drawable().

	* app/tools/gimpcurvestool.c: indicate the possibility to pick color
	values from the image by showing a color picker cursor. Made the
	file selection dialog transient for the tool shell.

	* app/tools/gimplevelstool.c: made the file selection dialog
	transient for the tool shell.
2002-10-14 13:39:35 +00:00
Sven Neumann
7c241ea242 themes/Default/images/stock-color-picker-black-18.png
2002-10-13  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/stock-color-picker-black-18.png
	* themes/Default/images/stock-color-picker-gray-18.png
	* themes/Default/images/stock-color-picker-white-18.png: new icons.

	* libgimpwidgets/gimpstock.[ch]
	* themes/Default/images/Makefile.am: added the new color picker icons.

	* app/tools/gimplevelstool.c: added the GUI that will allow to pick
	the white, gray and black point from the image.
2002-10-13 17:24:29 +00:00
Manish Singh
669e37080a #include <stdio.h>
2002-10-13  Manish Singh  <yosh@gimp.org>

        * app/tools/gimptexttool.c: #include <stdio.h>
2002-10-13 08:45:00 +00:00
Sven Neumann
81a3115408 allow to load text from a file.
2002-10-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: allow to load text from a file.
2002-10-11 17:42:26 +00:00
Sven Neumann
d9f96f3f85 added a very simple text editor.
2002-10-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: added a very simple text editor.
2002-10-10 18:37:12 +00:00
Sven Neumann
ce5aa0c929 optionally allow GIMP_UNIT_PIXEL as value for GimpUnit params.
2002-10-10  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-params.[ch]: optionally allow GIMP_UNIT_PIXEL
	as value for GimpUnit params.

	* app/core/gimpimage-text.[ch]
	* app/core/gimptext.[ch]
	* app/tools/gimptexttool.c: moved some code around.
2002-10-10 17:07:46 +00:00
Sven Neumann
4c7b8a374b app/tools/gimptexttool.c app/widgets/gimpfontselection.[ch] started to
2002-10-09  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c
	* app/widgets/gimpfontselection.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: started to implement the
	text tool GUI as suggested in #84151.
2002-10-09 15:42:38 +00:00
Sven Neumann
29a75b7b07 new files that implement the text rendering that used to live in
2002-10-09  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-text.[ch]: new files that implement the text
	rendering that used to live in gimptexttool.[ch].

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/tools/gimptexttool.[ch]
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/pdb/text_tool.pdb: changed accordingly.

	* tools/pdbgen/enums.pl
	* app/pdb/text_tool_cmds.c: regenerated.
2002-10-09 14:00:26 +00:00
Michael Natterer
0ce8a599e2 set the toggle_cursor to GIMP_ZOOM_CURSOR, not the tool_cursor.
2002-09-27  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmagnifytool.c (gimp_magnify_tool_init): set the
	toggle_cursor to GIMP_ZOOM_CURSOR, not the tool_cursor.
2002-09-27 15:51:57 +00:00
Sven Neumann
8ccbf199a8 app/gui/file-new-dialog.c app/gui/preferences-dialog.c
2002-09-17  Sven Neumann  <sven@gimp.org>

	* app/gui/file-new-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpfontselection-dialog.c: place the Cancel button
	next to the confirmative button as suggested by the HIG.
2002-09-17 11:55:04 +00:00
Sven Neumann
b0b9df8a10 fixed typo (bug #93031).
2002-09-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: fixed typo (bug #93031).
2002-09-11 14:21:30 +00:00
Michael Natterer
5dc2b347d2 app/widgets/gimplayerlistview.c some more auto-sizing spinbuttons.
2002-09-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayerlistview.c
	* app/gui/channels-commands.c: some more auto-sizing spinbuttons.

	* app/gui/offset-dialog.c: added mnemonics for "X" and "Y".

	Dialog auto-hide cleanup:

	* app/widgets/gimpviewabledialog.c: close the dialog when the
	GimpViewable goes away (special cased GimpItems which become
	invisible on "removed"). Close the dialog by syntesizing a
	"delete_event" instead of simply hiding or destroying it so the
	closing method of the dialog's user gets invoked.

	* app/gui/resize-dialog.[ch]: don't do the same here. Simplifies
	the API even more as we don't have to pass the object to watch any
	more.

	* app/gui/image-commands.c
	* app/gui/layers-commands.c: changed accordingly.

	* app/undo_history.c
	* app/gui/convert-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/vectors-commands.c: removed all dialog auto-hiding which
	is now done by GimpViewableDialog. Also connect more close
	callbacks to gtk_widget_destroy() and handle shell destruction
	accordingly, so these pseudo widgets behave more like real ones.

	Tool-dialog auto-hide fix:

	* app/tools/tool_manager.c: never call a tool's initialize()
	method with a NULL gdisp (I can't follow why we did this before
	because it's conceptually broken and makes the semantics of
	initialize() more than unclear).
	To be sure, added g_return_if_fail(GIMP_IS_DISPLAY(gdisp)) to
	tool_manager_initialize_active().

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: removed the recently added code
	for handling NULL displays in initialize().
2002-09-08 12:18:23 +00:00
Michael Natterer
f54912e108 Histogram cleanup:
2002-09-07  Michael Natterer  <mitch@gimp.org>

	Histogram cleanup:

	* app/base/gimphistogram.c: Added g_return_if_fail() to all public
	functions, reordered stuff, cleanup (no logic changed).

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimphistogrambox.[ch]: new widget containing a
	GimpHistogramView and two range spinbuttons (as known from the
	threshold tool). Users only need to connect to the histogram
	view's "range_changed" signal. The spinbuttons are handled
	internally.

	* app/widgets/gimphistogramview.[ch]: define it's default size in
	the header. Make sure "start" is always smaller than "end". Emit
	"range_changed" in gimp_histogram_view_set_range().

	* app/tools/gimplevelstool.c: changed accordingly.

	* app/tools/gimpthresholdtool.[ch]: removed the code which
	did the same and use the new widget.

	* app/tools/gimphistogramtool.[ch]: ditto. Removed the "intensity"
	info label. Cleanup.
2002-09-07 17:27:32 +00:00
Hans Breuer
e17baf71d6 updated
2002-09-06  Hans Breuer  <hans@breuer.org>

	* */*/makefile.msc : updated

	* libgimptool/makefile.msc : new file, libgimptool
	is currently build as static lib due to references
	into app/core

	* themes/Default/makefile.msc : removed
	* themes/Default/images/makefile.msc : new file

	* libgimpwidgets/makefile.msc libgimpwidgets/gimpwidgets.c
	updated (externals)

	* app/paint-funcs.c : replaced gccism varibale size array on
	stack with portable alloca, removed sizeof(buf) check which
	must fail now.

	* app/config/gimpconfig.c : get write/close protos
	on win32 from io.h
	* app/config/gimprc.c : dito and <string.h>
	* app/config/gimpscanner.c : <string.h> only

	* app/core/gimpcontainer.c : workaround for clumsy
	compilers not supporting vararg macros

	* app/core/gimpdocumentlist.c app/core/gimpparasitelist.c
	include <io.h> on win32

	* app/widgets/gimpdocumentview.c
	  app/widgets/gimpimagedock.c
	  app/widgets/gimppreview.c : add #ifdef __GNUC__
	to avoid breaking on non standard pragma #warning.

	* app/gui/session.c : include <string.h>

	* regexrepl/makefile.msc : build as dll

	* plug-ins/makefile.msc : updated

	* plug-ins/common/pix.c : open file binary

	* plug-ins/common/spheredesigner.c : avoid error
	'incompatible types' while assigning, use memcpy()
2002-09-06 22:25:19 +00:00
Michael Natterer
424ed1f480 changed "Number of Colors" to "Max Number of Colors" to clarify what this
2002-09-06  Michael Natterer  <mitch@gimp.org>

	* app/gui/convert-dialog.c: changed "Number of Colors" to
	"Max Number of Colors" to clarify what this parameter does.
	(fixes #92194).

	* app/gui/menus.c: use GIMP_STOCK_INFO for "View/Info Window".

	Specify spibutton sizes in chars, not pixels (eek) all over
	the place. Also removed explicit sizes where the GtkSpinButton
	default size does not disturbe tabular widget layouts.

	* libgimpwidgets/gimpwidgets.c: removed the hardcoded width of 75
	pixels in gimp_spin_button_new(). Changed gimp_scale_entry_new()
	and gimp_coordinates_new() to interpret their "spinbutton_width"
	parameters as chars if < 16, and as pixels otherwise. This gives
	reasonable results and doesn't cause unchanged plug-ins to
	suddenly have spinbuttons of dozens of chars width :)

	* libgimpwidgets/gimpsizeentry.c: added the same heuristic here.

	* libgimpwidgets/gimpquerybox.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimppaletteeditor.c: changed accordingly.

	* plug-ins/FractalExplorer/Dialogs.c
	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/common/AlienMap.c
	* plug-ins/common/AlienMap2.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/bumpmap.c
	* plug-ins/common/checkerboard.c
	* plug-ins/common/cubism.c
	* plug-ins/common/curve_bend.c
	* plug-ins/common/depthmerge.c
	* plug-ins/common/despeckle.c
	* plug-ins/common/diffraction.c
	* plug-ins/common/emboss.c
	* plug-ins/common/film.c
	* plug-ins/common/flarefx.c
	* plug-ins/common/fractaltrace.c
	* plug-ins/common/gauss_iir.c
	* plug-ins/common/gauss_rle.c
	* plug-ins/common/glasstile.c
	* plug-ins/common/grid.c
	* plug-ins/common/illusion.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/jigsaw.c
	* plug-ins/common/lic.c
	* plug-ins/common/max_rgb.c
	* plug-ins/common/mblur.c
	* plug-ins/common/newsprint.c
	* plug-ins/common/nova.c
	* plug-ins/common/pixelize.c
	* plug-ins/common/sample_colorize.c
	* plug-ins/common/scatter_hsv.c
	* plug-ins/common/shift.c
	* plug-ins/common/sinus.c
	* plug-ins/common/sparkle.c
	* plug-ins/common/spread.c
	* plug-ins/common/tile.c
	* plug-ins/common/tileit.c
	* plug-ins/common/unsharp.c
	* plug-ins/common/vpropagate.c
	* plug-ins/common/waves.c
	* plug-ins/common/whirlpinch.c
	* plug-ins/gflare/gflare.c
	* plug-ins/mosaic/mosaic.c
	* plug-ins/rcm/rcm_dialog.c: changed accordingly, which involves
	removals of gtk_widget_set_size_request(spinbutton), removal of
	lots of explicit spinbutton sizes in gimp_scale_entry_new(), and
	adding of new ones because GtkSpinButton's auto-size trashed
	tabular layouts.

	Lots of cleanup & indentation while browsing the plug-ins'
	code. Changed spacings, moved toggle buttons into frame titles,
	use stock items, stuff...
2002-09-06 20:44:47 +00:00
Michael Natterer
3ca9dfc0ae call gimp_image_flush() after cropping. Fixes #90977 (Thanks to Toby
2002-09-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c (crop_tool_crop_image): call
	gimp_image_flush() after cropping. Fixes #90977 (Thanks to
	Toby Smith).
2002-09-05 14:50:28 +00:00
Michael Natterer
163a3f4155 More color correction stuff cleanup:
2002-09-04  Michael Natterer  <mitch@gimp.org>

	More color correction stuff cleanup:

	* app/base/Makefile.am
	* app/base/base-types.h
	* app/base/levels.[ch]: new files containing levels_lut_func(), a
	new "Levels" parameter struct and the "auto levels" stuff.

	* app/base/lut-funcs.[ch]: removed the levels stuff here, added
	lots of g_return_if_fail().

	* app/base/color-balance.[ch]
	* app/base/hue-saturation.[ch]: added init() and reset() functions
	so we don't need to duplicate this code in the tool and the pdb
	wrappers.

	* app/base/curves.[ch]: s/gint/GimpHistogramChannel/g, made
	curves_channel_reset() initialize the curves array.

	* app/tools/gimpcolorbalancetool.[ch]: use the new functions,
	moved the "Range" frame to the top, added a per-range "Reset"
	button, made the global "Reset" button reset all ranges and
	the "Preserve Luminosity" toggle.

	* app/tools/gimpcurvestool.[ch]: don't initialize the curves
	array manually, as curves_channel_reset() does that,
	s/gint/GimpHistogramChannel/g.

	* app/tools/gimphuesaturationtool.c: use the new functions, added
	a per-channel "Reset" button and made the global "Reset" button
	reset all channels, cleaned up the GUI update function.

	* app/tools/gimplevelstool.[ch]: changed to use the new Levels
	parameter struct and it's utility functions. Removed stuff
	which now lives in base/levels.c

	* app/tools/gimpimagemaptool.c: align the "Preview" button
	bottom-left, not bottom-right.

	* tools/pdbgen/pdb/color.pdb: use the new stuff and removed
	uglyness because using the "Levels" struct makes the code more
	straightforward.

	* app/pdb/color_cmds.c: regenerated.
2002-09-04 15:25:15 +00:00
Michael Natterer
c5d4b7020b DND cleanup part 1:
2002-09-02  Michael Natterer  <mitch@gimp.org>

	DND cleanup part 1:

	* app/widgets/gimpdnd.[ch]: changed all gimp_dnd_*_dest_set() and
	_unset() functions to _dest_add() and _dest_remove(). Switch from
	using static arrays of GtkTargetEntries to dynamic GtkTargetLists.
	The _add() and _remove() functions configure the drag dest
	automatically if not already done, so there is no need to call
	gtk_drag_dest_set() on the widget any more. Drag source cleanup
	will follow...

	Renamed silly function names gimp_gtk_* to gimp_dnd_*

	* app/display/gimpdisplayshell.c
	* app/tools/gimpblendtool.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimplistitem.c
	* app/widgets/gimpmenuitem.c
	* app/widgets/gimppreview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptoolbox-color-area.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptoolbox.c
	* app/gui/about-dialog.c
	* app/gui/color-select.c
	* app/gui/device-status-dialog.c
	* app/gui/tool-options-dialog.c: changed accordingly. Removed
	all calls to gtk_drag_dest_set() and their GtkTargetEntry tables.

	* app/widgets/gimpchannellistitem.c: enabled some commented out
	dnd code (which will not work since dnd needs more love...)

	* app/widgets/gimpitemlistview.[ch]: added a third
	"gboolean interactive" parameter to GimpItemNewFunc.

	* app/gui/channels-commands.[ch]
	* app/gui/layers-commands.[ch]
	* app/gui/vectors-commands.[ch]: if the new_item_func is called
	with "interactive == FALSE", don't pop up a dialog but silently
	create a new item of the image's size.

	* app/widgets/gimpdrawablelistview.c: use the new feature to allow
	color and pattern drops to the "New" button, which creates a new
	layer/channel filled with the color/pattern.
	(special feature for drc ;-)

	* app/widgets/gimppaletteeditor.c: fixed event handling so we see
	the context menu again. Also, don't redraw on "expose", since
	GtkPreview does that for us.
2002-09-02 14:39:08 +00:00
Michael Natterer
8ab7bfb39e manually add the src_drawable's offsets instead of implicitly using the
2002-09-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpclonetool.c (gimp_clone_tool_draw): manually add
	the src_drawable's offsets instead of implicitly using the
	offsets of the active_drawable (fixes #92311).
2002-09-02 13:22:25 +00:00
Michael Natterer
ce956702e5 GimpViewableDialogs everywhere, cleanup:
2002-09-01  Michael Natterer  <mitch@gimp.org>

	GimpViewableDialogs everywhere, cleanup:

	* libgimpwidgets/gimpstock.c: added texts for the RESIZE, SCALE
	and CROP stock items.

	* app/widgets/gimpviewabledialog.c: update the title when the
	viewable's name changes.

	* app/gui/color-notebook.[ch]: added color_notebook_viewable_new()
	which creates a GimpViewableDialog.

	* app/widgets/gimpgradienteditor.[ch]
	* app/gui/colormap-editor-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/gradient-editor-commands.c
	* app/gui/palette-editor-commands.c
	* app/undo_history.c: use GimpViewableDialogs and the new
	color_notebook constructor.

	* app/gui/convert-dialog.c: #include "widgets/gimpviewabledialog.h"

	* app/gui/image-commands.c
	* app/gui/info-dialog.c
	* app/gui/resize-dialog.c: minor cleanups.

	* app/gui/info-window.c: cleaned up the whole thing, esp. the
	"Extended" page. Added HSV color display to the color picker
	frame.  Set the icons as frame titles, stuff...

	* app/tools/gimpimagemaptool.[ch]: removed "shell_title",
	"shell_name" and "stock_id" from the GimpImageMapTool struct
	because they can be obtained from the tool's GimpToolInfo object.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: changed accordingly.

	* app/tools/gimphistogramtool.c: same here: take values from
	tool->tool_info instead of hardcoding them.

	* app/tools/gimpcroptool.[ch]: removed the static crop dialog
	variables and added them to the GimpCropTool struct. Feels safer
	and makes the callback code much simpler. Use stock items for the
	dialog's "Resize" and "Crop" buttons.

	* app/tools/gimpmeasuretool.c
	* app/tools/gimprotatetool.c: for consistency don't name the tools
	"Blah Tool", also the dialog titles need to match the menu
	entries.

	Unrelated:

	* libgimpwidgets/gimpwidgets.c: the recently changed, gtk-doc
	comment was correct, as gtk-doc takes the parameter names from
	the header, not the .c file.

	* app/tools/gimptransformtool.c: set the transform tool's state to
	TRANSFORM_CREATING after changing displays, so the initial matrix
	components are saved correctly for the "Reset" function.
2002-09-01 08:44:57 +00:00
Michael Natterer
cc3bdec2c9 app/widgets/Makefile.am app/widgets/widgets-types.h new dialog widget
2002-08-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewabledialog.[ch]: new dialog widget featuring
	a title bar containing a stock icon, a description, the viewable's
	name and a preview. Will be used for all viewable related dialogs
	and serves as a common place to control their look & feel.

	* app/tools/gimpimagemaptool.[ch]: removed the code which did
	almost the same and use GimpViewableDialog.

	* app/gui/info-dialog.[ch]: extended the API so it has enough
	information to create a GimpViewableDialog.

	* app/gui/channels-commands.c
	* app/gui/convert-dialog.c
	* app/gui/gradient-editor-commands.c
	* app/gui/image-commands.c
	* app/gui/info-window.c
	* app/gui/layers-commands.c
	* app/gui/offset-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/resize-dialog.c
	* app/gui/vectors-commands.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: use GimpViewableDialogs

	* themes/Default/gtkrc: apply the dialog style to "*Gimp*Dialog*",
	not only "*GimpDialog*" so it covers GimpViewableDialog.
2002-08-30 21:00:42 +00:00
Michael Natterer
14e0d0737b added a tool icon and descriptive string to the dialog's title box. Create
2002-08-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.[ch]: added a tool icon and
	descriptive string to the dialog's title box. Create the
	drawable preview with is_popup == TRUE so it doesn't show
	layers in the image context. Still not perfect...

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: Chain up early in initialize()
	and return if gdisp == NULL. Set stock_id and desc_text so
	GimpImageMapTool can display them. Added lots of mnemonics
	(#80804). Use gimp_size_entry_new() instead of manually creating
	the slider+spinbutton stuff.

	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.c: changed widgets packing to make them
	resizable without strange effects. Put the "Load", "Save" and
	"Auto" buttons into a frame.

	* app/tools/gimphuesaturationtool.c: use GimpColorAreas instead of
	deprecated GtkPreviews. Arranged the color previews and their
	radio buttons as a color wheel. Not the best solution maybe but
	IMHO better than the old GUI.
2002-08-28 19:47:07 +00:00
Kelly Martin
1c7da49a3d fixed typo.
2002-08-09  Kelly Martin  <kmartin@pyrzqxgl.org>

	* app/tools/gimpposterizetool.c (gimp_posterize_tool_register):
	fixed typo.
2002-08-27 14:57:41 +00:00
Michael Natterer
7b359896d5 changed the default text to "No, you can't change this text. Please DON'T
2002-08-27  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptexttool.c: changed the default text to
	"No, you can't change this text. Please DON'T report this bug."
2002-08-27 14:35:18 +00:00
Michael Natterer
1186e83a28 Color correction tool chopping:
2002-08-26  Michael Natterer  <mitch@gimp.org>

	Color correction tool chopping:

	* app/Makefile.am
	* app/image_map.[ch]: removed...

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpimagemap.[ch]: ...and added here as object.

	* app/base/Makefile.am
	* app/base/base-types.h
	* app/base/color-balance.[ch]
	* app/base/curves.[ch]
	* app/base/hue-saturation.[ch]
	* app/base/threshold.[ch]: the lowlevel color correction functions
	plus their parameter structs cut out of the resp. tools.

	* app/core/core-enums.[ch]: removed GimpTransferMode enum...

	* app/base/base-enums.[ch]: ...added it here. Also added
	GimpHueRange for the new hue-saturation files.

	* tools/pdbgen/enums.pl
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c: regenerated.

	* app/tools/Makefile.am
	* app/tools/gimpcolorbalancetool-transfer.c: removed (code went
	to base/color-balance.c).

	* app/tools/gimpimagemaptool.[ch]: added most code which was
	diplicated in subclasses. Create the dialog here with a nice title
	bar including image preview and name (fixes #66033). Added virtual
	functions map(), dialog() and reset() which need to be implemented
	by subclasses.

	* app/tools/gimpbrightnesscontrasttool.[ch]
	* app/tools/gimpcolorbalancetool.[ch]
	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimphuesaturationtool.[ch]
	* app/tools/gimplevelstool.[ch]
	* app/tools/gimpposterizetool.[ch]
	* app/tools/gimpthresholdtool.[ch]: removed tons of duplicated
	code and simply implement GimpImageMapTool's virtual functions.
	Removed all dialog structs and keep the variables in the tool
	structs. The dialogs are now created on-the-fly and destroyed when
	the tool goes away, which makes all callbacks much simpler and
	safer. Lots of GUI & code cleanup in all dialogs.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: added separate "Reset Channel"
	buttons and let the global "Reset" buttons reset all color
	channels.

	* app/tools/tools.c: the various antique foo_free() functions
	don't exist any more.

	* app/tools/gimphistogramtool.c: removed ImageMap field from
	dialog struct (it was unused). Cleaned up dialog a bit.

	* tools/pdbgen/Makefile.am: don't scan tools/gimphuesaturationtool.h
	for enums.

	* tools/pdbgen/pdb/color.pdb: use the new stuff from base/ and
	don't include stuff from tools/ any more.

	* app/pdb/color_cmds.c
	* app/pdb/paint_tools_cmds.c: regenerated.
2002-08-26 11:35:56 +00:00
Michael Natterer
e62c2c58c7 bumped version number to 1.3.9
2002-08-22  Michael Natterer  <mitch@gimp.org>

	* configure.in: bumped version number to 1.3.9

	* app/tools/gimpbycolorselecttool.[ch]: removed the ByColorDialog
	and cleaned up the code.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpselectioneditor.[ch]: added new widget
	GimpSelectionEditor with same same functionality as the old
	ByColorDialog which can be open all the time (independent of the
	active tool).

	* app/widgets/gimppreview.[ch]: added gimp_preview_new_by_type()
	so previews can be created without a viewable.

	* app/widgets/gimppreview-utils.[ch]: changed
	gimp_preview_type_from_viewable() to
	gimp_preview_type_from_viewable_type().

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c
	* app/gui/menus.c: register the new dialog type.
2002-08-22 12:49:01 +00:00
Michael Natterer
08c35cdfd9 namespace cleanup.
2002-08-20  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpfuzzyselecttool.c: namespace cleanup.
2002-08-20 10:40:38 +00:00
Michael Natterer
33bba65728 Make sure the selection (gimpimage-mask.c) functionality is really built
2002-08-20  Michael Natterer  <mitch@gimp.org>

	Make sure the selection (gimpimage-mask.c) functionality is really
	built *on top* of the GimpChannel functionality:

	* app/undo.[ch]: renamed undo_push_image_mask() to
	undo_push_mask() and generalized it's API to take a GimpChannel
	param so undos can be pushed for channels which are not the
	image's selection. Simplified the API and added code which copies
	the region of interest instead of leaving this to callers.

	* app/undo_types.h: s/IMAGE_MASK_UNDO/MASK_UNDO/

	* app/undo_history.c: changed accordingly.

	* app/core/gimpchannel.[ch]: don't #include "gimpimage-mask.h".
	Changed gimp_channel_push_undo() to really push a channel undo,
	not a selection undo. Added "gboolean push_undo" params to all
	functions which are called from gimpimage-mask.c. Various cleanups
	and optimizations. Added /*< proxy-foo >*/ stuff to the header so
	we export just the struct itself to libgimpproxy. Added accessors
	gimp_channel_[get|set]_show_masked().

	* app/core/gimpimage-mask.[ch]: renamed gimp_image_mask_undo() to
	gimp_image_mask_push_undo(). Call it before calling GimpChannel
	functions which modify the mask, also call all GimpChannel
	functions with push_undo = FALSE. Emit gimp_image_mask_changed()
	after each operation instead of calling it in
	gimp_image_mask_invalidate(). Removed gimp_image_mask_none()
	because it is the same as gimp_image_mask_clear().
	General cleanup.

	* app/core/gimpimage-mask-select.c
	* app/core/gimpimage-qmask.c: changed accordingly.

	* app/core/gimpedit.c: call gimp_image_mask_clear(), not
	gimp_channel_clear (gimp_image_get_mask()).

	* app/core/gimpimage-crop.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c: call gimp_image_mask_changed()

	* app/gui/channels-commands.c
	* app/gui/select-commands.c
	* app/tools/gimptexttool.c
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/selection.pdb: follow GimpChannel and
	gimp_image_mask* API changes.

	* app/pdb/channel_cmds.c
	* app/pdb/selection_cmds.c
	* libgimpproxy/gimpchannel.h: regenerated.

	Unrelated:

	* app/core/gimpimage.c: call gimp_drawable_push_undo() instead of
	undo_push_image() directly.
2002-08-20 10:22:23 +00:00
Sven Neumann
6d151f5fd0 reverted Dave's change since this feature has already been implemented
2002-08-06  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmagnifytool.[ch]: reverted Dave's change
	since this feature has already been implemented properly
	(and configurable) last December.
2002-08-06 10:55:40 +00:00
Dave Neary
07ecc12c2a Require a minimum movement in the X and Y direction before we zoom in
2002-08-05  Dave Neary  <bolsh@gimp.org>

        * app/tools/gimpmagnifytool.[ch]: Require a minimum
        movement in the X and Y direction before we zoom in
        on/out to the dragged square. Limit rather arbitrarily
        set to 5. This fixes bug #86939, reported by
        philipj@telia.com.
2002-08-05 09:30:33 +00:00
Michael Natterer
fa537489d7 removed gdisp->scale, gdisp->dot_for_dot, the scaling marcos and the
2002-06-27  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.[ch]: removed gdisp->scale,
	gdisp->dot_for_dot, the scaling marcos and the
	gdisplay_[un]transform[_f]() functions.

	* app/display/gimpdisplayshell.[ch]: added them here. Named the
	transform functions gimp_display_shell_[un]transform_xy[_f]().

	Made the gimp_display_shell_[un]transform_coords() functions copy
	all values of the GimpCoords struct, not just x and y.

	* app/display/gimpstatusbar.[ch]: keep a pointer to
	GimpDisplayShell, not GimpDisplay.

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-scroll.c
	* app/display/gimpdisplayshell-selection.c
	* app/display/gimpnavigationview.c
	* app/gui/image-commands.c
	* app/gui/info-window.c
	* app/gui/select-commands.c
	* app/gui/view-commands.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdrawtool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpvectortool.c: changed accordingly.

	* app/gui/layers-commands.c: if(gimage->selection_mask) is always
	TRUE, use if(!gimp_image_mask_is_empty(gimage)) instead.

	* app/tools/gimpfuzzyselecttool.[ch]: moved global variables
	to the object struct.
2002-06-26 22:16:59 +00:00
Michael Natterer
0aec31c3c6 Fixed color picking (reported by jimmac on #gimp):
2002-06-20  Michael Natterer  <mitch@gimp.org>

	Fixed color picking (reported by jimmac on #gimp):

	* app/core/gimpimage-pick-color.c: set the returned color's alpha
	value to opaque if the drawable we pick from has no aplha.

	* app/tools/gimpcolorpickertool.c: ignore all values returned by
	gimp_image_pick_color() if it returns FALSE (which happens if we
	want to pick outside the drawable).
2002-06-19 22:09:02 +00:00
Michael Natterer
a3f44d8b0f Separated tool_options creation from tool registration so we don't
2002-06-17  Michael Natterer  <mitch@gimp.org>

	Separated tool_options creation from tool registration so we
	don't implicitly create widgets before gui_init():

	* libgimptool/gimptooltypes.h: removed GimpToolOptionsNewFunc
	typedef here...

	* app/core/core-types.h: ...and added it here.

	* libgimpproxy/gimpproxytypes.h: regenerated.

	* app/core/gimptoolinfo.[ch]: added a GimpToolOptionsNewFunc
	pointer to remember the constructor. Fixed the finalize() method
	(bug was never noticed because we leaked all tool infos)

	* app/tools/tool_manager.[ch]: moved tool_options creation to the
	new function tool_manager_restore(). Unref the tool infos after
	adding them to their container. Added "brush" and "gradient" to
	the context properties which are defined for tool contexts.

	* app/app_procs.c: call tool_manager_restore() after gui_init().

	* app/gui/gui.c: removed the hack introduced recently and call
	render_setup() in gui_init() again, not in gui_themes_init().

	Use the correct contexts now that they are properly initialized
	at the time of tool_options creation:

	* app/tools/gimpblendtool.c: use tool_info->context, not
	gimp_get_user_context() to get/set the tool's gradient.

	* app/paint/gimppaintcore.[ch] (gimp_paint_core_start): added a
	GimpPaintOptions paramater and get the brush to use from
	paint_options->context (instead of gimp_get_current_context()).

	* app/paint/gimppaintcore-stroke.c
	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/paint_options.c: added a brush preview to the paint
	options.
2002-06-17 10:34:28 +00:00
Michael Natterer
aa7be287dc Fix for #85201:
2002-06-16  Michael Natterer  <mitch@gimp.org>

	Fix for #85201:

	* app/tools/gimpfliptool.c: set the toggle_cursor correctly.

	* app/tools/gimptransformtool.c: if "use_grid" is FALSE, skip the
	cursor update stuff and chain up directly.

	Misc tool->control options fixes:

	* app/tools/gimppainttool.c: set "motion_mode" to
	GIMP_MOTION_MODE_EXACT.

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimpsmudgetool.c: don't touch "motion_mode" here.

	* app/tools/gimpimagemaptool.c
	* app/tools/gimptransformtool.c: set "scroll_lock" to TRUE and
	"preserve" to FALSE.

	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: don't touch them here.

	* app/tools/gimphistogramtool.[ch]: derive it from GimpImageMapTool
	so it inherits it's control settings.

	* app/tools/gimpellipseselecttool.c: don't set "preserve" to TRUE.

	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmovetool.c: code formating paranoia.

	* app/tools/gimptoolcontrol.c: fixed indentation.
2002-06-16 17:13:39 +00:00
Michael Natterer
6fe42e3691 set the witdh of the gradient preview to 96 instead of 128 pixels so it is
2002-06-16  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpblendtool.c: set the witdh of the gradient preview
	to 96 instead of 128 pixels so it is not the widest tool options
	item with the "small" theme.
2002-06-16 16:35:05 +00:00
Sven Neumann
117a8032d1 center the preview's allocation.
2002-06-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppreview.c (gimp_preview_size_allocate): center
	the preview's allocation.

	* app/tools/gimpblendtool.c (blend_options_new): use a button for
	the gradient so it's more obvious that it can be pressed.
2002-06-12 15:39:03 +00:00
Michael Natterer
91cfa78384 added a boolean "internal" which indicates that the data object is an
2002-06-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdata.[ch]: added a boolean "internal" which
	indicates that the data object is an automatically created
	internal object. Changed the code to refuse saving to deleting
	internal objects.

	* app/core/Makefile.am
	* app/core/gimp-gradients.[ch]: new files implementing internal
	gradients (FG -> BG in RGB and HSV and FG -> transparent).

	* app/core/gimp.c: call gimp_gradients_init().

	* app/core/gimpdatafactory.c (gimp_data_factory_data_free): don't
	free internal objects so they stay there on "Refresh".

	* app/core/gimpdatalist.c: sort internal objects to the beginning
	of the list.

	* app/widgets/gimpdataeditor.c: refuse to change the name of
	internal objects.

	* app/widgets/gimpdatafactoryview.c: set the "Delete" button
	insensitive for internal objects.

	* app/widgets/gimpgradienteditor.c: refuse to edit internal
	gradients, just display them so color picking works.

	* app/gui/brushes-commands.c
	* app/gui/gradients-commands.c
	* app/gui/palettes-commands.c
	* app/gui/patterns-commands.c: set the "Delete" menu item
	insensitive for internal objects.

	* app/gui/gui.c: need to call render_setup() earlier because of
	you-dont-want-to-know-why. Will change it back once the previews
	have their own render buffers.

	* app/tools/gimpblendtool.c: Replaced the "Type" menu by a preview
	showing the active gradient. Clicking the preview pops up the
	gradient selection. Renamed the "Gradient" menu to "Shape". Removed
	"blend_mode" from the BlendOptions struct because we always use
	"custom" mode now.
2002-06-12 13:48:47 +00:00
Sven Neumann
fd21daebdf app/undo.c app/config/gimpconfig-deserialize.c app/core/gimpbrushpipe.c
2002-06-09  Sven Neumann  <sven@gimp.org>

	* app/undo.c
	* app/config/gimpconfig-deserialize.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpcontainer.c
	* app/core/gimpimagefile.c
	* app/gui/paths-dialog.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcomponentlistitem.c
	* app/widgets/gimpgradienteditor.c: unified translatable strings
	and unmarked a few for translation since they should never be seen.

2002-06-09  Sven Neumann  <sven@gimp.org>

	* POTFILES.in: updated.

	* de.po: updated german translation.
2002-06-09 12:53:42 +00:00
Sven Neumann
3aae39405e app/base/Makefile.am automake-1.6 seems to use yet another variable to
2002-06-08  Sven Neumann  <sven@gimp.org>

	* app/base/Makefile.am
	* app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another
	variable to pass flags to the assembler (bug #84514). Define
	AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake.

	* configure.in
	* all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a
	GNU make extension that we don't really need and newer versions of
	automake don't seem to like it.
2002-06-07 23:00:46 +00:00
Michael Natterer
413b9d3329 renamed gimp_drawable_apply_image() to gimp_drawable_push_undo() because
2002-06-06  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.[ch]: renamed gimp_drawable_apply_image()
	to gimp_drawable_push_undo() because that's what it actually does.

	* app/image_map.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage.c
	* app/core/gimplayer.c
	* app/paint/gimppaintcore.c
	* app/tools/gimpinktool.c: changed accordingly. Removed redundant
	comments because it's now obvious what the function does from
	looking at its name.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimage.h: renamed "gboolean undo" parameters to
	"gboolean push_undo".
2002-06-06 19:44:05 +00:00
Michael Natterer
1cbdc95fca fixed #84157: allow the tool to scroll the display. Also preserve it on
2002-06-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimprectselecttool.c: fixed #84157: allow the tool to
	scroll the display. Also preserve it on drawable changes.
2002-06-05 09:04:34 +00:00
Michael Natterer
8d37831a94 <shift>+click toggles the active layer's "linked" property now.
2002-05-15  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c: <shift>+click toggles the active
	layer's "linked" property now.

	* themes/Default/images/stock-tool-options-16.png: new icon.

	* themes/Default/images/Makefile.am
	* themes/Default/imagerc
	* libgimpwidgets/gimpstock.[ch]: added it to the stock system.

	* app/gui/menus.c: use it for the tool_options dialog's menu
	entries.
2002-05-15 19:15:23 +00:00
Sven Neumann
6c9134609b fixed documentation.
2002-05-15  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig.c: fixed documentation.

	* app/tools/gimppenciltool.c
	* app/tools/gimpsheartool.c: assign shortcuts that don't collide with
	other tools.
2002-05-15 18:23:17 +00:00
Sven Neumann
fdf3a59379 removed gimptool.h.
2002-05-11  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am (SOURCES): removed gimptool.h.

	* libgimptool/Makefile.am (SOURCES): added gimptoolcontrol.h.

Updated POTFILES.in and german translations.
2002-05-11 09:57:01 +00:00
Hans Breuer
8522a8470d add appconfig.lib. Statically link libgimptool/gimptool.lib.
2001-05-11  Hans Breuer  <hans@breuer.org>

	* app/makefile.msc : add appconfig.lib. Statically
	link libgimptool/gimptool.lib.

	* app/main.c : use gimp_locale_directory()

	* app/config/gimpconfig-utils.c : <string.h>

	* app/config/makefile.msc : add gimpscanner

	* app/core/gimpimagefile.c : some G_OS_WIN32 mess to get
	mkdir() and chmod()

	* app/display/gimpdisplayshell.c
	  app/plug-in/plug-in-progrss.c
	  app/tool/gimpcolorpickertool.c
	  app/tool/gimpcroptool.c
	  app/tool/gimpmeasuretool.c
	  app/tool/gimpperspectivetool.c
	  app/tool/gimprotatetool.c
	  app/tool/gimpscaletool.c
	  app/tool/gimpsheartool.c
	  app/tool/gimptransformtool.c
	  app/widgets/gimpcolormapeditor.c
	  app/widgets/gimpcolorpanel.c
	  app/widgets/gimptoolbox-color-area.c
	add #ifdef __GNUC__ to avoid breaking on non standard
	pragma #warning

	* app/tools/makefile.msc : add gimptoolcontrol remove
	tools-enum

	* app/tools/tool_manager.c : need to include
	libgimptool/gimptoolcontrol.h after core includes
	otherwise we would compile without prototypes or
	break miserably

	* app/gui/plug-in-menus.c : replace LOCALEDIR with
	gimp_locale_directory ()

	* app/gui/preferences-dialog.c (prefs_notebook_append_page) :
	only try to gdk_pixbuf_new_from_file() with a valid filename.
	It should simply return NULL otherwise, but fails if the
	filename is an empty string.

	* app/paint-funcs/makefile.msc : add -FImsvc_recommended_pragmas.h

	* app/widgets/gimpcolormapeditor.c : the 'row'
	allocated needs to be 'xn * cellsize * 2' (to avoid
	accessing unowned memory) not only width, which has
	become allocation.width by someone commenting out
	the correct size calculation

	* app/widgets/gimpdialogfactory.c : varargs to macros
	are GCCism or at least non standard. #define DEBUG
	to g_print or nothing - without arguments - does fix
	it somewhat dirty as the compiler needs to tolerate
	the '(blah, foo, bar);' statement than

	* app/widgets/makefile.msc : updated

	* app/xcf/makefile.msc : add -FImsvc_recommended_pragmas.h

	* etc/gimprc.win32 : use ';' to separate theme-path

	* libgimpbase/gimpenv.c : #include <stdio.h>
	for sprintf()

	* app/widgets/gimpdnd.c (gimp_dnd_set_file_data) :
	the passed in vals chunk is not always null-terminated
	(at least not on win32). Use the length parameter too
	to avoid reading junk filenames.

	* libgimp/gimp.def : export gimp_image_get_name()

	* libgimpbase/gimpbase.def : export gimp_locale_directory()
	* libgimpbase/gimpenv.[ch] : added gimp_locale_directory ()

	* libgimpbase/makefile.msc : define DATADIR and SYSCONFDIR
	to empty string to let gimp find its files in the common
	place (win32: relative to the top level gimp dir)

	* plug-ins/common/pixelize.c : <string.h>

	* plug-ins/flame/cmap.c : #include <glib.h> for g_random_int()

	* plug-ins/makefile.msc : -FImsvc_recommended_pragams.h
	and a little hack to give imagemap the prototypes it
	desires without changing the lexed source

	* themes/Default/images/makefile.msc : now added (see below)

	* themes/Default/images/stock-button-reset.png : made it binary
2002-05-10 23:30:09 +00:00
Michael Natterer
a3bb0b0dad Started to get rid of the gdisplays_foo() functions in
2002-05-08  Michael Natterer  <mitch@gimp.org>

	Started to get rid of the gdisplays_foo() functions in
	app/display/gimpdisplay-foreach.[ch]. Work in progress...

	* app/core/gimp.[ch]: added the display list to the Gimp object
	(as a GimpList of GimpObjects). This way we get more independent
	from whether there is GUI or not, as gimp->displays will simply
	be an empty list for the --no-interface case.

	* app/display/gimpdisplay.[ch]: Removed the global "display_list"
	and "display_num" variables. Use gimp->displays instead.

	* app/display/gimpdisplay-foreach.[ch]: renamed most functions
	from gdisplays_foo() to gimp_displays_foo() and pass them a Gimp
	pointer.

	* app/core/gimpimage.[ch]: added a "flush" signal.

	* app/display/gimpdisplay-handlers.c: connect to "flush" and call
	gimp_display_flush() in the callback.

	* tools/pdbgen/pdb/display.pdb: use gimp_displays_flush(gimp)
	here and only here.

	* app/pdb/display_cmds.c: regenerated.

	* app/app_procs.c
	* app/gui/gui.c
	* app/gui/preferences-dialog.c:
	s/gdislays_foo()/gimp_displays_foo(gimp)/

	* app/image_map.c
	* app/undo_history.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpdisplayshell-scale.c
	* app/gui/channels-commands.c
	* app/gui/colormap-editor-commands.c
	* app/gui/convert-dialog.c
	* app/gui/drawable-commands.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/offset-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/select-commands.c
	* app/gui/vectors-commands.c
	* app/paint/gimpairbrush.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpcomponentlistitem.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimpimageview.c
	* app/widgets/gimpitemlistitem.c
	* app/widgets/gimpitemlistview.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplayerlistview.c
	* app/widgets/gimpvectorslistview.c: replaced gdisplays_flush()
	with calls to gimp_image_flush(gimage). Removed inclusion of
	"display/gimpdisplay-foreach.h" from most files.
2002-05-08 17:48:24 +00:00
Sven Neumann
43c602dc95 app/arch/i386/mmx/detect_mmx.S applied a patch from iccii@hotmail.com that
2002-05-04  Sven Neumann  <sven@gimp.org>

	* app/arch/i386/mmx/detect_mmx.S
	* app/arch/i386/mmx/paint_funcs_mmx.S: applied a patch from
	iccii@hotmail.com that promises to fix build on mingw (bug #80681).

	* app/config/gimpconfig-serialize.c
	* app/config/gimpconfig-utils.[ch]: moved value compare function to
	gimpconfig-utils.

	* app/config/gimpconfig.[ch]: added duplicate and compare functions
	to GimpConfigInterface so derived interfaces can override them.

	* app/tools/gimptexttool.c: fixed tool cursor.
2002-05-03 23:48:03 +00:00
Michael Natterer
a74a8997b4 devel-docs/Makefile.am new file documenting the core's include policy.
2002-05-03  Michael Natterer  <mitch@gimp.org>

	* devel-docs/Makefile.am
	* devel-docs/includes.txt: new file documenting the core's
	include policy.

	* HACKING: mention it here.

	* libgimptool/gimptooltypes.h: removed GimpToolOptions here.

	* app/core/core-types.h: and added it here. This is a temp hack
	needed because GimpToolInfo needs to know the GimpToolOptions
	type.

	* libgimpproxy/gimpproxytypes.h: regenerated.

	* libgimptool/gimptoolmodule.h: don't include gimptooltypes.h here...
	* libgimptool/gimptoolmodule.c: ...but here.

	* app/config/gimpconfig-params.c: include "libgimpbase/gimpbase.h"
	entirely, not single files from it.

	* app/core/gimp.c
	* app/core/gimpcontext.c
	* app/core/gimpcoreconfig.c
	* app/core/gimpdatafactory.c
	* app/core/gimpdocuments.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-guides.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage-qmask.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage.c
	* app/core/gimpitem.c
	* app/core/gimpmodules.c
	* app/core/gimppaintinfo.c
	* app/core/gimpparasite.c
	* app/core/gimppreviewcache.c
	* app/core/gimptoolinfo.c
	* app/core/gimpunit.c: include "core-types.h" and no other types file.

	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.c: include "tools/tools-types.h"
	instead of "libgimptool/gimptooltypes.h", warn about inclusion
	on "gui/gui-types.h"

	* app/file/file-open.c
	* app/file/file-save.c: don't include "libgimptool/gimptooltypes.h".

	* app/gui/about-dialog.c
	* app/gui/brush-select.c
	* app/gui/brushes-commands.c
	* app/gui/color-select.c
	* app/gui/data-commands.c
	* app/gui/device-status-dialog.c
	* app/gui/dialogs.c
	* app/gui/gradients-commands.c
	* app/gui/help-commands.c
	* app/gui/info-window.c
	* app/gui/palettes-commands.c
	* app/gui/patterns-commands.c
	* app/gui/resize-dialog.c
	* app/gui/tips-dialog.c
	* app/gui/tool-options-dialog.c: include "gui-types.h" and no
	other types file.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore-stroke.c
	* app/paint/gimppaintcore.c
	* app/paint/gimppaintoptions.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c
	* app/paint/paint.c: include "paint-types.h" and no other types file.

	* app/pdb/pdb-types.h: don't include "libgimptool/gimptooltypes.h".

	* app/plug-in/plug-in-progress.c: warn about inclusion of
	"display/display-types.h"

	* app/tools/tools-types.h: include "libgimptool/gimptooltypes.h".

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpdrawtool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptoolcontrol.c
	* app/tools/gimptoolcontrol.h
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c
	* app/tools/tools.c: include "tools-types.h" and no other types file,
	warn about inclusion of "gui/gui-types.h".

	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimptoolbox-color-area.c: warn about inclusion of
	"gui/gui-types.h".

	* app/xcf/xcf-load.c
	* app/xcf/xcf.c: don't include "libgimptool/gimptooltypes.h".

	Split tool-safe-mode up in two files, one including libgimpproxy,
	one libgimp.

	* plug-ins/tools/Makefile.am
	* plug-ins/tools/tool-safe-mode-plug-in.[ch]: new files including
	libgimp/ stuff only.

	* plug-ins/tools/tool-safe-mode.[ch]: include libgimpproxy/ and
	libgimptool/ but don't include libgimp/ because of conflicting
	declarations.

	Unrelated:

	* app/tools/gimpclonetool.c: create the clone core so we don't crash.

	* app/gui/file-open-dialog.c: changed the way we create previews
	so that only out-of-date previews are created on a click in the
	preview area. Unconditional creation can still be forced by
	<Ctrl>+click. Changed the tooltip to document this.
2002-05-03 12:45:22 +00:00
Sven Neumann
84e1810adc app/tools/gimpairbrushtool.[ch] app/tools/gimpbezierselecttool.[ch]
2002-05-03  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpairbrushtool.[ch]
	* app/tools/gimpbezierselecttool.[ch]
	* app/tools/gimpblendtool.[ch]
	* app/tools/gimpbrightnesscontrasttool.[ch]
	* app/tools/gimpbucketfilltool[.ch]
	* app/tools/gimpbycolorselecttool[.ch]
	* app/tools/gimpclonetool[.ch]
	* app/tools/gimpcolorbalancetool[.ch]
	* app/tools/gimpcolorpickertool[.ch]
	* app/tools/gimpconvolvetool[.ch]
	* app/tools/gimpcroptool[.ch]
	* app/tools/gimpcurvestool[.ch]
	* app/tools/gimpdodgeburntool[.ch]
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpellipseselecttool[.ch]
	* app/tools/gimperasertool[.ch]
	* app/tools/gimpfliptool[.ch]
	* app/tools/gimpfreeselecttool[.ch]
	* app/tools/gimpfuzzyselecttool[.ch]
	* app/tools/gimphistogramtool[.ch]
	* app/tools/gimphuesaturationtool[.ch]
	* app/tools/gimpinktool[.ch]
	* app/tools/gimpiscissorstool[.ch]
	* app/tools/gimplevelstool[.ch]
	* app/tools/gimpmagnifytool[.ch]
	* app/tools/gimpmeasuretool[.ch]
	* app/tools/gimpmovetool[.ch]
	* app/tools/gimppaintbrushtool[.ch]
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool[.ch]
	* app/tools/gimppenciltool[.ch]
	* app/tools/gimpperspectivetool[.ch]
	* app/tools/gimpposterizetool[.ch]
	* app/tools/gimprectselecttool[.ch]
	* app/tools/gimprotatetool[.ch]
	* app/tools/gimpscaletool[.ch]
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsheartool[.ch]
	* app/tools/gimpsmudgetool[.ch]
	* app/tools/gimptexttool[.ch]
	* app/tools/gimpthresholdtool[.ch]
	* app/tools/gimptool.c
	* app/tools/gimptoolcontrol.h
	* app/tools/gimptoolmodule[.ch]
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool[.ch]
	* app/tools/path_tool.c
	* app/tools/tool_manager[.ch]
	* app/tools/tools.c
	* libgimptool/gimptool.c
	* libgimptool/gimptoolcontrol.h
	* libgimptool/gimptoolmodule.h: removed tons of warnings. Do we need
	to add -Werror to the CFLAGS to avoid such a mess in the future ?!
	Also had to enforce the GIMP coding style in lots of places :-(

	* libgimp/gimppixelrgn.c: got sick and tired of debugging plug-ins,
	so I've added checks for most parameters passed to the GimpPixelRgn
	functions. This will slow down plug-in execution a little bit but
	should help to find bugs early.
2002-05-03 11:31:08 +00:00
Nate Summers
00feb59a4c app/core/core-types.h moved GimpToolInfo back into the core.
* app/core/core-types.h
 	* libgimptool/gimptooltypes.h: moved GimpToolInfo back into the core.

 	* libgimptool/gimptoolcontrol.h
	* app/tools/gimptoolcontrol.c: got rid of gimp_tool_control_new

 	* libgimptool/gimptool.c (gimp_tool_init): create the GimpToolControl
 	here instead of in the descendant classes

	* app/tools/gimpairbrushtool.c
 	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
 	* app/tools/gimpbucketfilltool.c
 	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
 	* app/tools/gimpcolorbalancetool.c
 	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
 	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
 	* app/tools/gimpdodgeburntool.c
 	* app/tools/gimpeditselectiontool.c
 	* app/tools/gimpellipseselecttool.c
	* app/tools/gimperasertool.c
 	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.c
 	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphistogramtool.c
 	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
 	* app/tools/gimpiscissorstool.c
	* app/tools/gimplevelstool.c
 	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
 	* app/tools/gimpmovetool.c
	* app/tools/gimppaintbrushtool.c
 	* app/tools/gimppathtool.c
	* app/tools/gimppenciltool.c
 	* app/tools/gimpperspectivetool.c
	* app/tools/gimprectselecttool.c
 	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
 	* app/tools/gimpsheartool.c
	* app/tools/gimpsmudgetool.c
 	* app/tools/gimptexttool.c
 	* app/tools/gimpvectortool.c
 	* plug-ins/tools/tool-safe-mode.c: changed accordingly

	* libgimpproxy/gimpproxytypes.h: autogenerated
2002-05-02 21:03:27 +00:00
Sven Neumann
05581ddf78 app/tools/gimpairbrushtool.c app/tools/gimpblendtool.c
2002-04-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/tools/transform_options.c: in preparation of a more generic tool
	options framework: use the options value, not the default value when
	setting up the tool options UI. Doesn't make any difference since both
	are initialized to the same value, but reduces usage of the ugly foo_d
	variables.

	* app/tools/gimpmagnifytool.c: don't change the resize_windows_on_zoom
	gimprc value in response to changes in the tool options. Only use it
	as default value when resetting the tool options.
2002-04-28 14:35:01 +00:00
Nate Summers
810b983110 app/tools/gimptoolcontrol.[ch] resurrected the motion hints and cursor
* app/tools/gimptoolcontrol.[ch]
 	* libgimptool/gimptool.c: resurrected the motion hints and cursor
 	changing code.

 	app/tools/gimpairbrushtool.c
	app/tools/gimpbezierselecttool.c
 	app/tools/gimpblendtool.c
 	app/tools/gimpbucketfilltool.c
 	app/tools/gimpbycolorselecttool.c
 	app/tools/gimpclonetool.c
 	app/tools/gimpcolorbalancetool.c
 	app/tools/gimpcolorpickertool.c
 	app/tools/gimpconvolvetool.c
 	app/tools/gimpcroptool.c
 	app/tools/gimpcurvestool.c
 	app/tools/gimpdodgeburntool.c
 	app/tools/gimpeditselectiontool.c
 	app/tools/gimpellipseselecttool.c
 	app/tools/gimperasertool.c
 	app/tools/gimpfliptool.c
 	app/tools/gimpfuzzyselecttool.c
 	app/tools/gimphistogramtool.c
 	app/tools/gimphuesaturationtool.c
 	app/tools/gimpimagemaptool.c
 	app/tools/gimpinktool.c
 	app/tools/gimpiscissorstool.c
 	app/tools/gimplevelstool.c
 	app/tools/gimpmagnifytool.c
 	app/tools/gimpmeasuretool.c
 	app/tools/gimpmovetool.c
 	app/tools/gimppaintbrushtool.c
 	app/tools/gimppainttool.c
 	app/tools/gimppathtool.c
 	app/tools/gimppenciltool.c
 	app/tools/gimpperspectivetool.c
 	app/tools/gimprectselecttool.c
 	app/tools/gimprotatetool.c
 	app/tools/gimpscaletool.c
 	app/tools/gimpselectiontool.c
 	app/tools/gimpsheartool.c
 	app/tools/gimpsmudgetool.c
 	app/tools/gimptexttool.c
 	app/tools/gimptransformtool.c
 	app/tools/gimpvectortool.c: set the motion mode; fix a few parameters

 	* app/tools/gimpinktool.c (gimp_ink_tool_button_press): uncommented
 	some code I had temporarily commented out and didn't uncomment before
 	committing

 	* libgimptool/gimptoolcontrol.h
 	* app/tools/gimptoolcontrol-displayshell.[ch]: merged with
 	gimptoolcontrol.[ch].  The distinction was fairly arbitrary.

 	* plug-ins/tools/gimptoolcontrol.c: added some stubs

        * app/tools/Makefile.am
 	* app/tools/tool_manager.c
 	* app/display/gimpdisplayshell-callbacks.c: changed accordingly

 	* libgimp/gimpimage_pdb.c: applied a patch from Pippen to correct
 	documentation on the undo operations
2002-04-21 07:31:12 +00:00
Michael Natterer
65cfa8db19 added utility functions file_utils_uri_to_utf8_basename() and
2002-04-14  Michael Natterer  <mitch@gimp.org>

	* app/file/file-utils.[ch]: added utility functions
	file_utils_uri_to_utf8_basename() and
	file_utils_uri_to_utf8_filename().

	* app/nav_window.c
	* app/undo_history.c
	* app/display/gimpdisplayshell.c
	* app/gui/info-window.c
	* app/gui/menus.c
	* app/gui/palette-import-dialog.c
	* app/tools/gimpbycolorselecttool.c
	* app/widgets/gimpcontainerview-utils.c: use the new functions.
2002-04-14 17:28:58 +00:00
Michael Natterer
5e51cebc15 Use UTF-8 encoded escaped URIs for GimpImage and GimpImageFile.
2002-04-14  Michael Natterer  <mitch@gimp.org>

	Use UTF-8 encoded escaped URIs for GimpImage and GimpImageFile.

	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]: port everything to using URIs, removed
	file_open_absolute_filename() and added file_utils_filename_to_uri()
	instead.

	* app/core/gimpimage.[ch]: added gimp_image_[get|set]_uri() which
	works like the old gimp_image_[get|set]_filename().
	Changed gimp_image_[get|set]_filename() to call uri conversion
	functions.

	* app/app_procs.c: removed lots of code and use the new uri
	functions to open images passed on the command line.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: changed accordingly.

	* app/nav_window.c
	* app/undo_history.c
	* app/display/gimpdisplayshell.c
	* app/gui/info-window.c
	* app/gui/palette-import-dialog.c
	* app/tools/gimpbycolorselecttool.c
	* app/widgets/gimpcontainerview-utils.c:
	s/gimp_image_get_filename()/gimp_image_get_uri()/g. Need to add
	a utility function which returns the basename in unescaped UTF-8.

	* app/gui/file-commands.c
	* app/widgets/gimpdocumentview.c: use "uri", not "filename" as
	variable name where appropriate.

	* app/gui/menus.c: some broken code for the "Open Recent" items,
	will be fixed soon...

	* app/widgets/gimpdnd.c: evil (!!!) hackery to convert dropped
	filenames to uris.

	* tools/pdbgen/pdb/fileops.pdb: changed accordingly. Clarified
	the meaning of the "raw_filename" parameter.

	* tools/pdbgen/pdb/message.pdb: use g_message("%s", message),
	*not* g_message(message).

	* app/pdb/fileops_cmds.c
	* app/pdb/message_cmds.c
	* libgimp/gimpfileops_pdb.c: regenerated.
2002-04-14 14:38:55 +00:00
Nate Summers
9e76b55173 displayshell 2002-03-29 05:03:11 +00:00
Nate Summers
69ccb4d370 massive tool plugin changes 2002-03-29 03:50:29 +00:00
Hans Breuer
de5f8b5f43 #define GETTEXT_PACKAGE
2001-03-28  Hans Breuer  <hans@breuer.org>

	* config.h.win32 : #define GETTEXT_PACKAGE

	* makefile.msc : add theme rule

	* app/makefile.msc : gimp.exe depends on all the libs
	and general update

	* app/base/makefile.msc : updated

	* app/config/gimpconfig-serialize.c : #include <io.h> for win32
	* app/config/gimpconfig-types.c : #include <string.h>

	* app/core/gimpcontext.c app/core/gimpcontainer.c
	  app/core/gimptoolinfo.c : #include <string.h>

	* app/core/gimpdocuments.c (gimp_documents_save_func) :
	need to g_strescape() the filename to not make
	backslashes vanish during de-serialization

	* app/core/gimpimagefile.c : #define S_ISREG for G_OS_WIN32

	* app/core/makefile.msc : add -DGIMP_COMPILATION
	required for cpercep.c build

	* app/display/gimpdisplayshell.c : #include <string.h>

	* app/display/makefile.msc : -FImsvc_recommended_pragmas.h,
	G_LOG_DOMAIN definition and object file update

	* app/file/makefile.msc : -FImsvc_recommended_pragmas.h,
	G_LOG_DOMAIN definition

	* app/file/file-open.c (file_open_with_proc_and_display) :
	use absolute filename for gimp_documents_add()

	* app/gui/channel-commands.c app/gui/colormap-editor-commands.c
	  app/gui/edit-commands.c app/gui/vectors-commands.c :
	#include <string.h>

	* app/gui/makefile.msc : updated

	* app/gui/menus.c : use g_file_test() instead of access()
	to avoid inclusion <unistd.h>

	* app/paint/makefile.msc : updated

	* app/plug-in/plug-in-params.c : #include <string.h>

	* app/plug-in/makefile.msc : updated

	* app/plug-in/plug-in-def.h : #include <time.h> for time_t

	* app/plug-in/plug-in.c : remove definition of S_IFREG

	* app/plug-in/gap/gap_arr_dialog.c : include <config.h>
	before including libgimp/libgimp-intl.h

	* app/tools/makefile.msc : updated

	* app/vectors/makefile.msc : new file

	* app/widgets/makefile.msc : updated

	* libgimp/gimp.def : updated externals

	* libgimpwidgets/gimpwidgets.def : updated externals

	* modules/makefile.msc : updated and disabled colorsel_gtk.

	* plug-in/makefile.msc : don't define GETTEXT_PACKAGE

	* themes/Default/images/makefile.msc : moved makefile.msc from ..
	and adapted pathes to images
2002-03-28 00:10:56 +00:00
Sven Neumann
a226586d9f app/plug-in/plug-in-rc.c app/plug-in/plug-ins.c app/tools/tool_manager.c
2002-03-22  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-ins.c
	* app/tools/tool_manager.c
	* app/widgets/gimppreview.c
	* app/widgets/gimptoolinfopreview.c: plugged a couple of mem leaks
	found using valgrind.

	* libgimpwidgets/gimpcolorarea.c (gimp_color_area_expose): don't draw
	anything if an idle update is pending.
2002-03-22 15:21:18 +00:00
Michael Natterer
ffcb0bfa3f ./mitch --sanitize-identifier-namespace
2002-03-20  Michael Natterer  <mitch@gimp.org>

	./mitch --sanitize-identifier-namespace

	* app/core/gimpcontext.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/dialogs-commands.c
	* app/gui/dialogs-constructors.c
	* app/gui/dialogs.c
	* app/gui/edit-commands.c
	* app/gui/gui.c
	* app/gui/menus.c
	* app/gui/vectors-commands.c
	* app/gui/view-commands.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppathtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptoolbox.c: s/gimp:/gimp-/g and s/_/-/g for all
	identifier strings (e.g. gimp:eraser_tool -> gimp-eraser-tool,
	gimp:layer-list -> gimp-layer-list, ...)

	* plug-ins/tools/common/gimpbrushselecttool.c:
	s/gimp:brush_select_tool/gimp-brush-select-tool-module/

	Don't quite remember why I introduced the "gimp:" prefix in the
	first place, but we can always add it back if we need it (for
	whatever reason)

	You may want to edit your ~/.gimp-1.3/sessionrc and devicerc or
	all session settings will be lost due to parse errors.
2002-03-21 12:17:17 +00:00
Sven Neumann
982969e607 moved display after gui to make the build work with the latest "truly ugly
2002-03-20  Sven Neumann  <sven@gimp.org>

	* app/Makefile.am: moved display after gui to make the build work
	with the latest "truly ugly hack" in app/display/Makefile.am.

	* app/tools/gimpcolorbalancetool.[ch]: dialog overhaul.
2002-03-20 19:25:14 +00:00
Sven Neumann
77a0b74727 registered GimpConvertDitherType.
2002-03-20  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.[ch]: registered GimpConvertDitherType.

	* app/gui/convert-dialog.c: simplified a lot by using enums.

	* app/tools/paint_options.c: include gimpenummenu.h.
2002-03-20 14:10:45 +00:00
Sven Neumann
3db3dff47e app/base/Makefile.am app/base/base-enums.c app/core/Makefile.am
2002-03-19  Sven Neumann  <sven@gimp.org>

	* app/base/Makefile.am
	* app/base/base-enums.c
	* app/core/Makefile.am
	* app/core/core-enums.c
	* app/widgets/Makefile.am
	* app/widgets/widgets-enums.c: purely cosmetic change.

	* app/paint/Makefile.am
	* app/paint/paint-enums.[ch]: generate paint-enums.c with registered
	enums. Skip GIMP_BRUSH_PRESSURE and GIMP_CUSTOM_CONVOLVE so they
	don't get exported to libgimp and are not registered as enum values.

	* tools/pdbgen/pdb/paint_tools.pdb: removed special casing of
	GimpBrushApplicationMode and GimpConvolveType since the forbidden
	values are now skipped anyway.

	* libgimp/gimpcompat.h: removed compat defines for the forbidden
	enum values. They shouldn't have been used.

	* app/tools/Makefile.am
	* app/tools/tools-enums.[ch]: generate tools-enums.c with registered
	enums.

	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.h
	* app/paint/gimpdodgeburn.h
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.[ch]
	* app/tools/gimpdodgeburntool.c
	* app/tools/paint_options.c: changed accordingly. Added more enum
	radio frames and enum option menus.
2002-03-19 19:17:31 +00:00
Sven Neumann
9ea9114303 app/paint/Makefile.am app/paint/paint-enums.h split enums into their own
2002-03-19  Sven Neumann  <sven@gimp.org>

	* app/paint/Makefile.am
	* app/paint/paint-enums.h
	* app/paint/paint-types.h: split enums into their own file and
	namespacified them.

	* app/tools/Makefile.am
	* app/tools/tools-enums.h
	* app/tools/tools-types.h: split enums into their own file.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.[ch]
	* app/paint/gimppaintoptions.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/paint_options.c
	* plug-ins/gfig/gfig.c: changed accordingly.

	* libgimp/gimpcompat.h
	* plug-ins/script-fu/siod-wrapper.c: added compatibility defines for
	changed enums.

	* tools/pdbgen/Makefile.am: updated list of headers to parse for enums.

	* app/pdb/paint_tools_cmds.c
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl
	* tools/pdbgen/pdb/paint_tools.pdb: regenerated.
2002-03-19 15:05:38 +00:00
Michael Natterer
3ff5cee9fb added enum GimpMotionMode which can be one of { EXACT, HINT, COMPRESS }.
2002-03-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools-types.h: added enum GimpMotionMode which can be
	one of { EXACT, HINT, COMPRESS }.

	* app/tools/gimptool.[ch]: removed tool->perfectmouse and added
	tool->motion_mode. Default to GIMP_MOTION_MODE_HINT.

	* app/tools/gimpinktool.c
	* app/tools/gimppainttool.c: set GIMP_MOTION_MODE_EXACT.

	* app/tools/gimpfuzzyselecttool.c: set GIMP_MOTION_MODE_COMPRESS.

	* app/tools/gimpeditselectiontool.[ch]: ditto. Removed
	gtkutil_compress_motion().

	* app/display/gimpdisplayshell-callbacks.c: look at
	active_tool->motion_mode and perform pointer grabbing and motion
	compression accordingly. Also, don't request motion hints from
	XInput devices because the wacom driver sends crap (fixes #6901).
	This change also brings hints and ordinary motions back in sync
	albeit compression, so IMHO it also fixes #68542 and #22375, but
	this needs further investigation.
2002-03-19 13:14:25 +00:00
Sven Neumann
b4768836c7 app/widgets/Makefile.am use gimp_mkenums to create widgets-enums.c, added
2002-03-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-enums.[ch]: use gimp_mkenums to create
	widgets-enums.c, added it to CVS since it contains translatable
	messages now.

	* app/widgets/gimpenummenu.[ch]: added new functions
	gimp_enum_radio_box_new() and gimp_enum_radio_frame_new() that create
	groups of radio buttons out of enum types.

	* app/core/core-enums.[ch]: registered more enums.

	* app/paint/gimpdodgeburn.h
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/transform_options.[ch]: use gimp_enum_radio_frame_new()
	for some tool options.
2002-03-18 22:26:41 +00:00
Michael Natterer
09050a7299 app/paint/gimppaintoptions.h put the "Fade Out" and "Gradient" stuff into
2002-03-18  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintoptions.h
	* app/tools/paint_options.c: put the "Fade Out" and "Gradient" stuff
	into separate frames with togglebutton titles.

	* app/widgets/gimpchannellistview.c: use
	gimp_image_mask_select_channel() instead of reinventing the wheel.

	* app/widgets/gimpvectorslistview.c: removed unneeded inclusion
	of "core/gimpimage-mask.h".

	* app/widgets/gimpcolormapeditor.c: set the hex entry to 7 digits,
	some cleanup.

	* app/widgets/gimppaletteeditor.c: set the vertical scrollbar
	to GTK_POLICY_AUTOMATIC.

	Added support for configuring some more GUI dimensions using
	widget class style properties:

	* app/widgets/gimpdock.c: made "separator_height" work correctly.
	* app/widgets/gimpdockbook.c: added "tab_height".
	* app/widgets/gimpeditor.c: added "button_icon_size".
	* app/widgets/gimpimagedock.c: added "minimal_width".
	* app/widgets/gimptoolbox.c: added "tool_icon_size".

	* themes/Default/gtkrc: set the properties to their default values
	for documentation.

	* etc/gtkrc_user: added a (commented out) example style which makes
	lots of things a smaller.
2002-03-18 19:34:06 +00:00
Sven Neumann
d68b730a82 app/core/core-enums.h more enum cleanup (ChannelOps this time).
2002-03-18  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h
	* app/core/core-types.h: more enum cleanup (ChannelOps this time).

	* app/core/gimpchannel.[ch]
	* app/core/gimpimage-mask-select.[ch]
	* app/gui/channels-commands.c
	* app/gui/vectors-commands.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/tools-types.h
	* app/widgets/gimpchannellistview.[ch]
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/selection_tools.pdb: changed accordingly.

	* app/pdb/channel_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/selection_tools_cmds.c
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.
2002-03-18 16:22:14 +00:00
Sven Neumann
bba46560ba app/core/core-enums.h moved some more enums into the right place and
2002-03-18  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h
	* app/core/core-types.h: moved some more enums into the right place
	and namespacified them.

	* app/undo.c
	* app/core/gimpdrawable-bucket-fill.[ch]
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage-qmask.c
	* app/core/gimplayer.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/channels-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/layers-commands.c
	* app/gui/menus.c
	* app/paint-funcs/paint-funcs.c
	* app/tools/gimpbucketfilltool.c
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/misc_tools.pdb: changed accordingly.

	* libgimp/gimpcompat.h
	* plug-ins/script-fu/siod-wrapper.c: added compat defines for changed
	GimpMaskApplyMode enum.

	* tools/pdbgen/enums.pl
	* app/pdb/drawable_cmds.c
	* app/pdb/edit_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/misc_tools_cmds.c
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c: regenerated.
2002-03-18 11:07:34 +00:00
Manish Singh
96f78088b0 tools/pdbgen/app.pl tools/pdbgen/enumcode-py.pl tools/pdbgen/enumcode.pl
2002-03-17  Manish Singh  <yosh@gimp.org>

        * tools/pdbgen/app.pl
        * tools/pdbgen/enumcode-py.pl
        * tools/pdbgen/enumcode.pl
        * tools/pdbgen/enumgen.pl: removed enum nick support, best to keep
        internal and external names consistent

        * app/core/core-enums.h: remove chops from enums. Change TRANS to
        TRANSPARENT in GimpBlendMode

        * app/core/core-types.h: remove chops and nicks from enums. Change INV
        to INVERSE and SUB to SUBTRACT to make things more clear

        * app/core/gimpchannel.c
        * app/gui/channels-commands.c
        * app/gui/vectors-commands.c
        * app/tools/gimpbezierselecttool.c
        * app/tools/gimpbycolorselecttool.c
        * app/tools/gimprectselecttool.c
        * app/tools/gimpselectiontool.c
        * app/tools/selection_options.c
        * app/tools/tools-types.h
        * app/widgets/gimpchannellistview.c
        * app/widgets/gimpvectorslistview.c: reflect SUB -> SUBTRACT change

        * app/core/gimpdrawable-blend.c: reflect TRANS -> TRANSPARENT change

        * app/core/gimplayer.c
        * app/gui/layers-commands.c: reflect INV -> INVERSE change

        * app/paint/paint-types.h: remove nick from PaintApplicationMode

        * app/tools/gimperasertool.c: fix tooltip

        * app/widgets/gimpenummenu.c: #include "libgimp/gimpintl.h" for
        gettext

        * libgimp/gimpcompat.h: compatibility enums here, since we removed
        the nicks

        * tools/pdbgen/enums.pl
        * libgimp/gimpenums.h
        * plug-ins/script-fu/script-fu-constants.c
        * app/core/core-enums.c
        * app/pdb/channel_cmds.c
        * app/pdb/drawable_cmds.c
        * app/pdb/edit_cmds.c
        * app/pdb/layer_cmds.c
        * app/pdb/misc_tools_cmds.c
        * app/pdb/paint_tools_cmds.c
        * app/pdb/selection_cmds.c
        * app/pdb/selection_tools_cmds.c: regenerated, enum changes

        * plug-ins/common/hot.c: GIMP_TRANS_IMAGE_FILL -> GIMP_TRANSPARENT_FILL

        * plug-ins/common/warp.c: GIMP_BG_IMAGE_FILL -> GIMP_BACKGROUND_FILL

        * plug-ins/script-fu/siod-wrapper.c: compat constant definitions
2002-03-17 22:54:26 +00:00
Sven Neumann
9d8b1ec926 registered more enums.
2002-03-17  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.[ch]: registered more enums.

	* app/tools/gimpblendtool.c: use GimpEnumMenus.
2002-03-17 18:36:52 +00:00
Sven Neumann
7aaa80ef06 new function to set the sensitivity of an option_menu.
2002-03-17  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: new function to set the sensitivity
	of an option_menu.

	* app/base/base-enums.[ch]: register and describe GimpHistogramChannel.

	* app/core/Makefile.am
	* app/core/core-enums.[ch]: build with gimp-mkenums, added core-enums.c
	to CVS, added descriptions for GimpPreviewSize.

	* app/display/Makefile.am
	* app/display/display-enums.[ch]: build with gimp-mkenums, added
	display-enums.c to CVS, added descriptions for GimpCursorMode.

	* app/gui/preferences-dialog.c: more GimpEnumMenus.

	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimplevelstool.c: use a GimpEnumMenu for the Channel menu.
	Allow alpha channel in HistogramView. These tools needs more work...
2002-03-17 16:35:05 +00:00
Sven Neumann
26578e757c define GIMP_MKENUMS for use in Makefile.am.
2002-03-17  Sven Neumann  <sven@gimp.org>

	* configure.in: define GIMP_MKENUMS for use in Makefile.am.

	* tools/Makefile.am
	* tools/gimp-mkenums: a modified version of glib-mkenums that parses
	literal descriptions for enum values out of the header file.

	* app/base/Makefile.am
	* app/base/base-enums.h: added descriptions for the InterpolationType.

	* app/base/base-enums.c: added to CVS although it is generated since
	translatable messages are extracted from this file and translators
	shouldn't need to build stuff.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenummenu.[ch]: new widget to create a GtkMenu or a
	GtkOptionMenu directly from a registered enum.

	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/transform_options.c: use gimp_enum_option_menu_new() for
	the Interpolation menus.
2002-03-17 14:07:54 +00:00
Manish Singh
abc66990b3 add missing support for anchoring a selection (bugfix ported from stable
2002-03-14  Manish Singh  <yosh@gimp.org>

        * app/tools/gimpfuzzyselecttool.c: add missing support for
        anchoring a selection (bugfix ported from stable branch)
2002-03-15 08:01:07 +00:00
Michael Natterer
5e17408c84 Re-enabled the display filters. They work exactly the same way as before
2002-03-14  Michael Natterer  <mitch@gimp.org>

	Re-enabled the display filters. They work exactly the same way
	as before except for the color_area pseudo-display. More stuff
	to come...

	* app/display/Makefile.am: build them again.

	* app/display/gimpdisplayshell-filter-dialog.[ch]
	* app/display/gimpdisplayshell-filter.[ch]: changed to the new
	namespace, work on GimpDisplayShell instead of GimpDisplay.

	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell.[ch]: changed accordingly.

	* app/gui/dialogs-constructors.c: enabled the dialog constructor.

	* app/gui/gui.c: call the init() function.

	* app/gui/menus.c: enabled the menu entry, but moved it to
	<Image>/View. Moved "Undo History..." to <Image>/Image.

	* modules/Makefile.am: build and install the modules.

	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c: made them compile with minimal
	changes.

	Unrelated:

	* app/undo_history.c: connect to the image's "disconnect", not
	"destroy" signal.

	* app/tools/gimpselectiontool.c: mask out the irrelevant parts of
	the "state" passed to the modifier_key() func, so tool_options
	button toggling works with other modifiers (e.g. num_lock)
	pressed.
2002-03-14 22:42:50 +00:00
Michael Natterer
ce569349d3 oops, including removed files is a bad idea...
2002-03-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcolorpickertool.c: oops, including removed files
	is a bad idea...
2002-03-14 17:19:25 +00:00
Michael Natterer
17d655c1c3 app/gimprc.[ch] app/gui/preferences-dialog.c
2002-03-12  Michael Natterer  <mitch@gimp.org>

	* app/gimprc.[ch]
	* app/gui/preferences-dialog.c
	* app/paint/gimppaintoptions.[ch]
	* app/tools/paint_options.[ch]
	* app/tools/tool_manager.[ch]: removed the "global_paint_options"
	gimprc option because it doesn't quite fit the new dockable dialog
	architecture.

	* app/gui/brush-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: removed the "Global Brush/Pattern/...
	Selection" part of them. They are now only used for temp popup
	selections and the PDB. *Lots* of cleanup.

	* app/gui/convert-dialog.c
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c
	* app/gui/gui.c
	* app/gui/menus.c
	* app/gui/palette-import-dialog.c
	* app/plug-in/plug-in.c: changed accordingly.

	Cleaned up the palette and other data PDB stuff:

	* tools/pdbgen/Makefile.am
	* tools/pdbgen/groups.pl: added "palette_select" and "palettes".

	* tools/pdbgen/pdb/palette_select.pdb: new file. Makes the palette
	selection PDB controllable.

	* tools/pdbgen/pdb/palettes.pdb: new file cut out of palette.pdb
	because of API symmetry with brushes, patterns, ...

	* tools/pdbgen/pdb/palette.pdb: removed from here.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/palette.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/patterns.pdb: lots of cleanup.

	Autogenerated stuff:

	* app/pdb/Makefile.am
	* app/pdb/palette_select_cmds.c
	* app/pdb/palettes_cmds.c: new files.

	* app/pdb/brush_select_cmds.c
	* app/pdb/brushes_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/gradients_cmds.c
	* app/pdb/internal_procs.c
	* app/pdb/palette_cmds.c
	* app/pdb/pattern_select_cmds.c
	* app/pdb/patterns_cmds.c: regenerated.

	* libgimp/Makefile.am
	* libgimp/gimp_pdb.h
	* libgimp/gimppalettes_pdb.[ch]
	* libgimp/gimppaletteselect_pdb.[ch]: new files.

	* libgimp/gimpgradientselect_pdb.[ch]
	* libgimp/gimppalette_pdb.[ch]
	* libgimp/gimppatterns_pdb.c: regenerated.

	* devel-docs/libgimp/tmpl/gimpgradients.sgml
	* devel-docs/libgimp/tmpl/gimppalette.sgml: regenerated.
2002-03-12 21:02:10 +00:00
Michael Natterer
1f08f9d9d0 removed type checking casts from macros which return parts of
2002-03-10  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.h: removed type checking casts from
	macros which return parts of pseudo-widgets.

	* app/widgets/gimpbrushfactoryview.c: changed accordingly.

	* app/widgets/gimpdialogfactory.c: added a "dispose"
	implementation used to destroy all dialogs the factory has
	created.

	* app/gui/toolbox.[ch]: removed toolbox_free(), removed the static
	"toolbox_shell" variable, set the active tool correctly on
	creation, don't show the window here (fixes session menagement),
	take the vbox' spacing into account when calculating the window's
	resize hints.

	* app/gui/gui.c: don't include "toolbox.h", don't call
	toolbox_free().

	* app/widgets/gimpfontselection.c: set the width of the entry to
	16 chars on creation so it doesn't fall back to it's insanely
	large default width, minor stuff.

	* app/tools/gimptexttool.c
	* app/tools/selection_options.c: some more scale_entries.
2002-03-10 18:31:42 +00:00
Michael Natterer
8b8442e9f4 app/gui/dialogs-constructors.[ch] app/gui/dialogs.c made the tool options
2002-03-10  Michael Natterer  <mitch@gimp.org>

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c
	* app/gui/tool-options-dialog.[ch]: made the tool options dialog
	dockable. Create a fancy tab for it which looks like the old
	dialog header.

	* app/gui/gui.c
	* app/gui/menus.c
	* app/gui/toolbox.c: changed accordingly.

	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimperasertool.c: moved the tool toggling widgets to
	the top.

	* app/tools/paint_options.c: show the paint mode menu for all
	paint tools but set it insensitive where it makes no sense.
	Reduces flickering and makes the tools' similarity more obvious.

	* app/widgets/gimpdataeditor.c: fixed segfault in
	gimp_data_editor_set_data() (data may be NULL), don't pass NULL to
	gtk_entry_set_text(), make the name entry insensitive if data ==
	NULL.

	* app/widgets/gimpdialogfactory.c: fixed longstanding bug which
	made newly created docks steal the first session entry with a NULL
	widget instead of the first _dock_ session entry with a NULL
	widget. Added even more debugging output. Cleanup.

	* app/widgets/gimpdockbook.c: made the tab/menu widget code more
	general to cover the tool options tab.
2002-03-10 15:05:58 +00:00
Michael Natterer
c9c025c8d9 return the crated label from gimp_table_attach_aligned(), doc fixes.
2002-03-08  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: return the crated label from
	gimp_table_attach_aligned(), doc fixes.

	* app/gui/channels-commands.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimplayerlistview.c: use gimp_scale_entries instead
	of just hscales in lots of places, so the values are keyboard
	input-able.
2002-03-08 18:30:40 +00:00
Michael Natterer
b0e05cda4a added GimpPaletteEntry typedef.
2002-03-08  Michael Natterer  <mitch@gimp.org>

	* app/core/core-types.h: added GimpPaletteEntry typedef.

	* app/core/gimppalette.h: removed it here.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpeditor.[ch]: new widget which is the base class
	for everything which is a vbox and has a button area at the
	bottom.

	* app/widgets/gimpcontainerview.[ch]: derived from GimpEditor now.

	* app/widgets/gimpdataeditor.[ch]: a GimpEditor subclass which is
	the base class for the new data editors below.

	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpitemlistview.c
	* app/widgets/gimplayerlistview.c
	* app/widgets/gimpvectorslistview.c
	* themes/Default/gtkrc: chagec accordingly.

	* app/gui/Makefile.am
	* app/gui/brush-editor.[ch]
	* app/gui/gradient-editor.[ch]
	* app/gui/palette-editor.[ch]: removed...

	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]: ...and added back as
	GimpDataEditor subclasses. Lots of cleanup and stuff...

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c
	* app/gui/gradient-editor-commands.c
	* app/gui/gui-types.h
	* app/gui/palette-select.c
	* app/tools/gimpcolorpickertool.c: changed accordingly.
2002-03-08 00:27:45 +00:00
Michael Natterer
952353698f Forgot some gint opacity values:
2002-03-04  Michael Natterer  <mitch@gimp.org>

	Forgot some gint opacity values:

	* app/core/gimplayer.[ch]: layer->opacity, gimp_layer_new(),
	gimp_layer_new_from_tiles()

	* app/core/gimpimage-projection.[ch]: gimp_image_projection_opacity()

	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage.c
	* app/core/gimplayer-floating-sel.c
	* app/gui/layers-commands.c
	* app/tools/gimptexttool.c
	* app/widgets/gimplayerlistview.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb: changed accordingly.

	* app/pdb/layer_cmds.c
	* libgimp/gimplayer_pdb.c: regenerated.
2002-03-04 14:52:54 +00:00
Michael Natterer
ce643d2722 Use gdouble in a [0.0..1.0] range for opacity values in the whole core's
2002-03-03  Michael Natterer  <mitch@gimp.org>

	Use gdouble in a [0.0..1.0] range for opacity values in the whole
	core's API. Convert them using (opacity * 255.999) when passing
	them to base/ and paint-funcs/

	Affected functions:

	* app/core/gimpchannel.[ch]: gimp_channel_[set|get]_opacity()
	* app/core/gimpimage.[ch]: gimp_image_[apply|replace]_image()
	* app/paint/gimppaintcore.[ch]: gimp_paint_core_[paste|replace]_canvas()

	* app/core/core-types.h: added defines GIMP_OPACITY_TRANSPARENT
	and GIMP_OPACITY_OPAQUE, just like the ones from
	paint-funcs/paint-funcs-types.h

	* app/gimprc.c
	* app/image_map.c
	* app/core/gimpcontext.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimplayer.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimppalette.c
	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpinktool.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimppreview.c
	* app/xcf/xcf-load.c: changed accordingly, use the new constants.
2002-03-03 17:38:12 +00:00
Michael Natterer
affc31007e changed gimp_image_mask_select_channel() to not take "drawable" and
2002-03-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask-select.[ch]: changed
	gimp_image_mask_select_channel() to not take "drawable" and
	"sample_merged" parameters (which are silly in some contexts) but
	simply the offsets of the passed channel.

	* app/gui/channels-commands.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpiscissorstool.c: changed accordingly.

	* app/tools/gimpdrawtool.[ch]: chaged gimp_draw_tool_draw_lines()
	and _draw_strokes() to take an additional "use_offsets" parameter
	like the other drawing functions.

	* app/path_curves.c
	* app/tools/gimpvectortool.c: changed accordingly.

	* app/paint/gimppaintcore.c: removed #if 0'ed code which was
	identical to other functions.

	* app/tools/gimpselectiontool.c: use the GimpEditSelectionTool's
	"arrow_key_func" so it's now possible to keyboad-move the current
	layer and selection with all selection tool. Needs some more
	tweaking...

	* app/tools/gimpiscissorstool.[ch]
	* app/tools/gimpvectortool.[ch]: derive them from GimpSelectionTool
	to make the modifier key <-> tool options interaction work. Ported
	IScissors to the new way the draw_tool works.
2002-03-03 10:38:37 +00:00
Michael Natterer
6086f832c9 app/core/Makefile.am new object for registering GimpPaintCore subclasses,
2002-02-27  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/gimppaintinfo.[ch]: new object for registering
	GimpPaintCore subclasses, just like GimpToolInfo for tools.

	* app/core/gimp.h: added gimp->paint_info_list to hold them.

	* app/core/gimptoolinfo.[ch]: removed the "pdb_string" and
	"paint_core_name" pointers and added a GimpPaintInfo pointer
	instead.

	* app/core/gimpimage-mask.c
	* app/gui/vectors-commands.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/tool_manager.c: changed accordingly.

	* app/paint/paint-types.h
	* app/paint/paint.c: added paint class registration stuff like
	the tool_manager does.

	* app/paint/gimpairbrush.[ch]
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintbrush.[ch]
	* app/paint/gimppencil.[ch]
	* app/paint/gimpsmudge.[ch]: added register functions which are
	called from paint_init().

	The core object system lives not only in "core/", but in
	core, paint, vectors, file, plug-in and xcf, so I had to hack
	a bit to keep the deps working:

	* app/pdb/pdb-types.h: don't include "paint/paint-types.h"...

	* app/core/core-types.h: ...because it's included here. Moved
	the inclusions of the core's subsystems' "foo/foo-types.h"
	files to the end of the file.

	* app/paint/Makefile.am: Some slimy radioactive uglyness.

	* app/gui/drawable-commands.c
	* app/tools/gimpblendtool.c: removed calling core functions via
	the PDB because it makes no sense to do it manually in only a few
	places.  This needs to be done generically using generated
	wrappers living in "app/commands/" or something...
2002-02-27 13:57:49 +00:00
Michael Natterer
5aa1c92f6d added gimp_paint_core_stroke_vectors() which strokes the whole vector
2002-02-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore-stroke.[ch]: added
	gimp_paint_core_stroke_vectors() which strokes the whole vector
	using one undo step.

	* app/gui/vectors-commands.c: use the new function.

	* app/tools/gimpvectortool.c: changed to do evil voodoo in
	gimp_vectors_tool_set_vectors() and thus to always find a
	display to show the vectors.
2002-02-26 03:19:47 +00:00
Simon Budig
8b59fe87f8 app/gui/vectors-commands.c app/tools/gimpvectortool.c fixed a name of a
2002-02-26  Simon Budig  <simon@gimp.org>

        * app/gui/vectors-commands.c
        * app/tools/gimpvectortool.c
        * app/tools/gimpvectortool.h: fixed a name of a function
        and corrected gimp_vector_tool_set_vectors.
2002-02-26 02:14:11 +00:00
Michael Natterer
a2bd2ac28c Added some kind of paint core registry. It's ugly and will change...
2002-02-26  Michael Natterer  <mitch@gimp.org>

	Added some kind of paint core registry. It's ugly and will change...

	* app/core/gimp.c: call paint_init() and paint_exit().

	* app/core/gimptoolinfo.[ch]: added "gchar *paint_core_name" to
	the GimpToolInfo structure and the contstructor.

	* app/tools/tool_manager.c: pass the class names of the
	GimpPaintCore subclasses to gimp_tool_info_new().

	* app/paint/Makefile.am
	* app/paint/paint.[ch]: new files. Simlply ref/unref all paint
	core classes so we can find them using g_type_from_name().

	* app/paint/gimppaintcore-stroke.[ch]: changed to take an array
	of GimpCoords, not just gdouble.

	* tools/pdbgen/pdb/paint_tools.pdb: convert the stroke array here.

	* app/gui/vectors-commands.c: ad-hoc implementation of vectors
	stroking.  Double click now sets the active vectors in the vectors
	tool.

	* app/pdb/paint_tools_cmds.c: regenerated.
2002-02-26 02:00:02 +00:00
Sven Neumann
9c9b152cc6 some documentation can't hurt.
2002-02-26  Sven Neumann  <sven@gimp.org>

	* app/gui/tips-parser.c: some documentation can't hurt.

	* app/tools/Makefile.am
	* app/paint/Makfile.am
	* app/vectors/Makfile.am
	* plug-ins/tools/Makefile.am: fixed dist target.
2002-02-26 01:06:26 +00:00
Simon Budig
7f706974e8 app/tools/gimpdrawtool.c Added function gimp_draw_tool_draw_strokes to be
2002-02-26  Simon Budig  <simon@gimp.org>

        * app/tools/gimpdrawtool.c
        * app/tools/gimpdrawtool.h: Added function gimp_draw_tool_draw_strokes
        to be able to draw lines from a GimpCoords array.

        * app/vectors/gimpanchor.h: removed "active", since this should
        be a GUI thing.

        * app/vectors/gimpstroke.c
        * app/vectors/gimpstroke.h
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpbezierstroke.h: Implemented (and fixed API) for
        interpolation.

        * app/tools/gimpvectortool.c
        * app/tools/gimpvectortool.h: Changed accordingly, we can actually
        draw polylines now.
2002-02-26 00:58:04 +00:00
Michael Natterer
cdf2a90b03 app/core/Makefile.am app/core/core-types.h new base class for something
2002-02-25  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpitem.[ch]: new base class for something which is a
	child of an image, has a PDB ID, a tattoo, parasites and emits
	a "removed" signal.

	* app/core/gimpdrawable.[ch]
	* app/vectors/gimpvectors.[ch]: derive from GimpItem. Removed
	lots of stuff from GimpDrawable.

	* app/core/gimp.[ch]: changed gimp->drawable_table and
	gimp->next_drawable_ID to gimp->item_table and gimp->next_item_id.

	* app/undo.[ch]: s/undo_push_drawable_parasite/undo_push_item_parasite/,
	minor cleanups.

	* app/core/gimplayer.[ch]: changed gimp_layer_new_from_tiles() and
	gimp_layer_new_from_drawable() to take the "dest_gimage" as
	second, not first parameter.

	* app/image_map.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-histogram.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable-preview.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-pick-color.c
	* app/core/gimpimage.c
	* app/core/gimplayer-floating-sel.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-save.c
	* app/gui/channels-commands.c
	* app/gui/file-save-dialog.c
	* app/gui/layers-commands.c
	* app/gui/offset-dialog.c
	* app/gui/paths-dialog.c
	* app/gui/toolbox.c
	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c
	* app/plug-in/plug-in.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimppainttool.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* app/widgets/gimpdrawablepreview.c: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpitemlistview.[ch]: new widget implementing most
	of the stuff formerly done by GimpDrawableListView.

	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimpdrawablelistview.[ch]
	* app/widgets/gimplayerlistview.c: changed accordingly.

	* app/widgets/gimpdnd.[ch]: added a vectors DND type.

	* app/gui/menus.c
	* app/gui/dialogs.c
	* app/gui/dialogs-constructors.[ch]: added a vectors dialog and
	a vectors item_factory.

	* app/gui/Makefile.am
	* app/gui/vectors-commands.[ch]: new files implementing the
	callbacks for the new vectors dialog and item_factory.

	* app/pdb/pdb_glue.h: some more ugly hacks to keep intermediate
	perl code working...

	* tools/pdbgen/pdb.pl: added a vectors type, use GimpItem for all
	ID lookups.

	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/misc_tools.pdb
	* tools/pdbgen/pdb/parasite.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/selection_tools.pdb: misc changes according to
	stuff above.

	* app/pdb/channel_cmds.c
	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/edit_cmds.c
	* app/pdb/floating_sel_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/misc_tools_cmds.c
	* app/pdb/paint_tools_cmds.c
	* app/pdb/parasite_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/selection_tools_cmds.c
	* app/pdb/text_tool_cmds.c
	* app/pdb/transform_tools_cmds.c: regenerated.
2002-02-25 17:58:50 +00:00
Simon Budig
7112b2068f app/vectors/gimpbezierstroke.c app/tools/gimpvectortool.[ch]
2002-02-25  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpbezierstroke.c
        * app/tools/gimpvectortool.[ch]
        * app/vectors/gimpstroke.[ch]
        * app/vectors/gimpvectors.[ch]: Fixed various bugs, *including*
        the nasty one from this morning (thanks Mitch).
2002-02-25 16:57:19 +00:00
Simon Budig
29b8063356 app/vectors/gimpvectors.c Changed to a container of GimpStrokes. This will
2002-02-25  Simon Budig  <simon@gimp.org>

        * app/vectors/gimpvectors.c
        * app/vectors/gimpvectors.h: Changed to a container of
        GimpStrokes. This will enable it to contain different
        Stroke-types in one Vectors-Object (think Entry in path
        dialog)

        * app/vectors/gimpstroke.c
        * app/vectors/gimpstroke.h
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpbezierstroke.h: New Objects: A connected
        component in a vector.

        * app/vectors/gimpbezier.c
        * app/vectors/gimpbezier.h: Removed, obsoleted by gimpstroke
        and gimpbezierstroke.

        * app/tools/gimpvectortool.c
        * app/vectors/Makefile.am
        * app/vectors/vectors-types.h
        * app/vectors/gimpanchor.h: Changed accordingly.

        There is a nasty bug I am yet unable to find in the tool.
        Don't use it. For some reason a wrong function instead of
        gimp_stroke_real_anchor_get_next gets called. I have *no*
        idea, whats wrong here. I stared at the code for hours.

        If somebody has an idea I'd appreciate a hint.
2002-02-25 03:16:41 +00:00
Michael Natterer
a3c3e7d3a6 General undo cleanup:
2002-02-23  Michael Natterer  <mitch@gimp.org>

	General undo cleanup:

	* app/undo.[ch]: made all undo structs private. Changed all
	undo_push_foo() functions to take useful parameters instead of
	"gpointer foo_ptr" and create the undo structs internally.
	Renamed lots of functions so they are more self-explanatory
	(like undo_push_gimage_mod -> undo_push_image_size). Added some
	undo functions (channel reordering is undoable now).  Never pass
	in a UndoType, as they are reseved for groups now (see below).
	Lots of cleanup and stuff...

	* app/undo_types.h: is a private header now which defines "enum
	UndoImplType" which is reserved for actual undo operations.
	All enum values are named "FOO_UNDO".

	* app/core/core-types.h: added the "UndoType" enum here and don't
	include "undo_types.h" any more. The UndoType values are all
	named "FOO_UNDO_GROUP" and are reserved for undo groups.

	The ID space of actual undo operations and undo groups
	is now strictly disjunct.

	* app/core/gimpchannel.h
	* app/core/gimpimage.h
	* app/core/gimplayer.h
	* app/core/gimplayermask.h
	* app/paint/gimppaintcore.h
	* app/tools/gimptransformtool.h: removed undo stuct definitions.

	* app/undo_history.c
	* app/path_transform.h
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-qmask.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/channels-commands.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/paths-dialog.c
	* app/paint/gimppaintcore.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* tools/pdbgen/pdb/guides.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/undo.pdb: changed accordingly.

	* app/pdb/guides_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/undo_cmds.c: regenerated.

	* app/core/gimpimage.[ch]: added infrastructure for holding a
	GimpList of GimpVectors objects. The API is the same as for layers
	and channels. Not used yet.
2002-02-23 17:29:19 +00:00
Michael Natterer
ac0c4af07a app/Makefile.am removed...
2002-02-22  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimpprogress.[ch]: removed...

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: ...and added here. Prefixed
	everything with "gimp_".

	* app/gui/image-commands.c
	* app/plug-in/plug-in.c
	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c: changed accordingly.
2002-02-22 15:08:47 +00:00
Simon Budig
a7fcc25f10 app/vectors/Makefile app/vectors/Makefile.am app/vectors/Makefile.in
2002-02-22  Simon Budig  <simon@gimp.org>

        * app/vectors/Makefile
        * app/vectors/Makefile.am
        * app/vectors/Makefile.in
        * app/vectors/gimpanchor.h
        * app/vectors/gimpbezier.c
        * app/vectors/gimpbezier.h
        * app/vectors/gimpvectors.c
        * app/vectors/gimpvectors.h
        * app/vectors/vectors-types.h: new files, the beginning
        of a new vector infrastructure for gimp.

        * configure.in
        * app/Makefile.am
        * app/core/core-types.h: changed accordingly.

        * app/tools/Makefile.am
        * app/tools/gimpvectortool.c
        * app/tools/gimpvectortool.h
        * app/tools/tools.c: New tool without practical use (yet),
        using the new infrastructure.

        to be continued...
2002-02-22 00:11:37 +00:00
Michael Natterer
9f9fa587ec app/Makefile.am removed...
2002-02-21  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/floating_sel.[ch]: removed...

	* app/core/Makefile.am
	* app/core/gimplayer-floating-sel.[ch]: ...and added here.

	* app/undo.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage-qmask.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage.c
	* app/core/gimplayer.c
	* app/gui/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* plug-ins/tools/common/gimpbrushselecttool.c
	* tools/pdbgen/pdb/floating_sel.pdb
	* tools/pdbgen/pdb/layer.pdb: changed includes accordingly.

	* app/pdb/floating_sel_cmds.c
	* app/pdb/layer_cmds.c: regenerated.
2002-02-21 22:19:45 +00:00
Michael Natterer
9c510759c5 Made the paint tool PDB wrappers work again (a bit at least...)
2002-02-21  Michael Natterer  <mitch@gimp.org>

	Made the paint tool PDB wrappers work again (a bit at least...)

	* app/Makefile.am: changed linking order. libtool sucks.

	* app/undo.c: check if active_tool is a GimpPaintTool before
	casting it.

	* app/paint/Makefile.am
	* app/paint/paint-types.h: added new files/types.

	* app/paint/gimppaintoptions.[ch]: new files cut out of
	tools/paint_options.h. Prefixed everything with "Gimp". There is
	still GtkWidget* cruft hanging around in the structs...

	* app/paint/gimppaintcore-stroke.[ch]: utility function
	which paints a stroke array. Needed for the PDB wrappers.

	* app/paint/gimpairbrush.[ch]
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.[ch]
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.[ch]: added *_options_new() functions which
	create correctly initialized options structures without widgets.

	* app/tools/paint_options.[ch]: removed the options struct
	definitions and value initialisations.

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpinktool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c: changed all paint_options functions
	accordingly, s/PaintOptions/GimpPaintOptions/g etc., removed all
	#if 0'ed non_gui functions.

	* tools/pdbgen/pdb/paint_tools.pdb: use gimp_paint_core_stroke().
	We currently leak all paint_options structs created by the PDB
	wrappers, more stuff to come...

	* app/pdb/paint_tools_cmds.c: regenerated.
2002-02-21 16:02:30 +00:00
Michael Natterer
5153abafa6 return the corrent value in g_retuen_val_if_fail().
2002-02-21  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.c: return the corrent value in
	g_retuen_val_if_fail().

	* app/tools/gimppainttool.c: removed some more painting logic...

	* app/paint/gimppaintcore.[ch]: ...and added it here so the PDB
	wrappers can use it too. Added "gboolean use_pressure" which needs
	to be set by GimpPaintTool so we don't need access to GdkDevices.
2002-02-21 11:01:12 +00:00
Michael Natterer
a49635e235 Implemented #10125 ("quick" colour picker does not honour "sample merged")
2002-02-20  Michael Natterer  <mitch@gimp.org>

	Implemented #10125 ("quick" colour picker does not honour
	"sample merged")

	* app/tools/gimpcolorpickertool.[ch]: made definition of
	GimpColorPickerToolOptions public.

	* app/tools/gimppainttool.c: get the color picker's tool_options
	and pick colors accordingly. Also draw a rectangle for
	"sample_average".
2002-02-20 11:37:20 +00:00
Michael Natterer
ad067c73f5 Oops, yesterday's "fix" for #10466 made it even worse :)
2002-02-20  Michael Natterer  <mitch@gimp.org>

	Oops, yesterday's "fix" for #10466 made it even worse :)

	* app/core/gimpdrawable-transform.c: need the 0.5 offset to
	the pixel's center only for INTERPOLATION_NONE, as the LINEAR
	and CUBIC algorithms already know about their errors.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: some more s/gint/gdouble/ so the
	tools can detect pointer motions again...
2002-02-20 09:59:50 +00:00
Michael Natterer
8d0af04c3a Fixed #10466 (disappearing pixels when rotating by 90 deg):
2002-02-19  Michael Natterer  <mitch@gimp.org>

	Fixed #10466 (disappearing pixels when rotating by 90 deg):

	* app/core/gimpdrawable-transform.c: when transforming backwards
	to find the destination line's sub-pixel source coordinates, we
	need to transform the pixels _center_, not it's upper left corner.

	* app/core/gimpdrawable-transform-utils.[ch]: added
	gimp_drawable_transform_matrix_rotate_center() which takes double
	center coordinates instead of an integer pixel bounding box.

	* app/tools/gimptransformtool.[ch]: use double instead of int for
	all coordinates except the original bounding box.

	* app/tools/gimprotatetool.c: use double whenever touching the
	"center" value, so it can be sub-pixel positioned.
2002-02-19 16:35:13 +00:00
Michael Natterer
bec4c72534 app/tools/tools-types.h chain up unconditionally in control(),
2002-02-18  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools-types.h
	* app/tools/*.[ch]: chain up unconditionally in control(),
	s/ToolAction/GimpToolAction/g, s/ToolState/GimpToolState/g.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimppainttool.c: don't touch tool->paused_count
	(setting it to 0 was a hack which should no longer be needed).

	* app/tools/gimpdrawtool.c: check if the draw tool has actually
	been started (draw_tool->gdisp != NULL) before calling it's
	draw() function.

	* app/tools/tool_manager.c: simplified tool_manager_control_active():
	simply call gimp_tool_control() if gdisp == tool->gdisp.

	* app/tools/gimptool.[ch]: gimp_tool_control(): do all the PAUSE,
	RESUME and HALT voodoo here.

	* app/tools/gimppainttool.c: implemented #9902 (Drawing straight
	lines does not work between different views). It's an evil hack,
	but clearly marked in the source.
2002-02-18 17:00:09 +00:00
Hans Breuer
6cb914db84 from now on use make.msc from $(TOP)/glib/build/win32; all occurences of
2001-02-17  Hans Breuer  <hans@breuer.org>

	* */*/makefile.msc */makefile.msc : from now on use
	make.msc from $(TOP)/glib/build/win32; all occurences
	of DIRENT removed and general update

	* app/config/makefile.msc app/paint/makefile.msc
	  app/plug-in/makefile.msc themes/Default/makefile.msc :
	new files

	* app/base/base.c : ported to GDir usage

	* app/config/gimpconfig-serialize.c :
	  app/config/gimpconfig-deserialize.c : HAVE_UNISTD_H
	* app/config/gimpconfig.c :
	  app/config/gimprc.c : HAVE_UNISTD_H, use <io.h> for
	open() prototype and merged pmode parameter
	(_S_IREAD | _S_IWRITE)

	* app/core/cpercep.c : msvc doesn't have cbrt(), provide
	it via pow(). Also include <glib.h> for painless 'inline'
	definition.

	* app/core/gimpdatafiles.c : ported to GDir usage

	* app/core/gimpimage-convert.c : work around a msvc compiler
	limitation (can't convert from uint64 to double)

	* app/file/file-open.c app/file/file-save.c :
	access() -> _access() for G_OS_WIN32

	* app/plug-in/plug-in.c : HAVE_UNISTD_H and <io.h>

	* libgimpbase/gimpbase.def : updated externals

	* libgimpbase/gimpenv.c : define WIN32_LEAN_AND_MEAN to
	avoid clashes with incompatible DATADIR definitions

	* libgimpcolor/gimpcolor.def : updated externals

	* lingimpmath/gimpmath.def : updated externals

	* libgimpwidgets/gimpwidgets.def : updated externals

	* libgimpwidgets/libgimp-glue.c : adapt to const changes
	of some prototypes

	* plug-ins/makefile.msc : disabled gdyntext

	* plug-ins/gap/iter_ALT/*/*.inc : GimpRunModeType -> GimpRunMode

	* plug-ins/FractalExplorer/FractalExplorer.c :
	* plug-ins/gap/gap_lib.c :
	* plug-ins/gfig/gfig.c :
	* plug-ins/gflare/gflare.c :
	* plug-ins/gimpressionist/gimpressionist.c :
	replaced DIRENT usage with GDir

	* plug-ins/script-fu/script-fu-scripts.c : #include <windows.h>
	to get the Sleep() prototype
2002-02-17 15:55:54 +00:00
Michael Natterer
2ccbf2a43d Fixed #34633 (wheel mouse zooming leaves straigth-line helpline on image)
2002-02-17  Michael Natterer  <mitch@gimp.org>

	Fixed #34633 (wheel mouse zooming leaves straigth-line helpline on
	image) and maybe some other stuff caused by the misbehaviour
	described below:

	* app/tools/tools-types.h
	* app/tools/tool_manager.c (tool_manager_control_active):

	Removed the "PAUSED" ToolState.

	The possible state transitions were INACTIVE <-> ACTIVE <-> PAUSED,
	where the ACTIVE <-> PAUSED transition was done only in the
	tool_manager, causing the tools's control() never to be called
	when the tool was INACTIVE.

	The GimpPaintTool however wants to draw on the display when it's
	INACTIVE, and of course wants to be suspended/resumed correctly
	while fiddling with display repainting/scaling/...

	The PAUSED state was also redundant information, since
	(tool->paused_count > 0) is the same information (only more
	correct and independent of tool activity).

	* app/display/gimpdisplayshell-scale.[ch]: suspend/resume the
	active tool around _all_ changes to the display's "scale" and
	"offset" fields.  Added new function
	gimp_display_shell_scale_by_values() which does that and is called
	from all places which need to change these values.

	* app/tools/gimpmagnifytool.c: changed accordingly.

	Unrelated stuff:

	* app/paint/gimpairbrush.c: added a #warning FIXME.

	* app/tools/gimpdrawtool.c: made a warning more verbose.

	* app/tools/gimppainttool.c: put one more drawable offset
	calculation in { .. }, will make a utility function out of it...
2002-02-17 11:46:39 +00:00
Michael Natterer
72284d3835 added back the handler which invalidates the display_title on dirty/clean.
2002-02-15  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-handlers.c: added back the handler
	which invalidates the display_title on dirty/clean. Removing it
	was simply wrong.

	* app/display/gimpdisplayshell-scale.c: don't call
	gimp_display_shell_update_title() directly but set
	shell->title_dirty to TRUE before calling gdisplays_flush().

	* app/paint/gimppaintcore.[ch]: added gimp_paint_core_constrain()
	which does the "snap to 15 degrees" stuff formerly done in
	GimpPaintTool. Call gimp_brush_select_brush() in
	gimp_paint_core_paint() if paint_state == MOTION, not in several
	other places.  Reordered functions, added some comments and
	documentation.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.c:
	s/CORE_CAN_HANDLE_CHANGING_BRUSH/CORE_HANDLES_CHANGING_BRUSH/g,
	minor cleanup.

	* app/pdb/pdb-types.h: include "paint/paint-types.h"

	* app/tools/gimppainttool.[ch]: use gimp_paint_core_constrain(),
	removed paint_tool->state because it's not needed any more,
	lots of cleanup.

	* tools/pdbgen/app.pl: another eeky special case for "paint/".

	* tools/pdbgen/pdb/paint_tools.pdb: include stuff from "paint/",
	not "tools/".

	* app/pdb/paint_tools_cmds.c: regenerated.
2002-02-15 17:44:05 +00:00
Michael Natterer
dca988f74d Core/UI separation for the paint tools:
2002-02-14  Michael Natterer  <mitch@gimp.org>

	Core/UI separation for the paint tools:

	* configure.in
	* app/Makefile.am
	* app/paint/.cvsignore
	* app/paint/Makefile.am: added new directory for the paint methods
	without GUI and tools around them.

	* app/paint/paint-types.h: typedefs for this module.

	* app/paint/gimppaintcore-kernels.h
	* app/paint/gimppaintcore.[ch]: the general paint logic taken
	from GimpPaintTool.

	* app/paint/gimpairbrush.[ch]
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintbrush.[ch]
	* app/paint/gimppencil.[ch]
	* app/paint/gimpsmudge.[ch]: subclasses of GimpPaintCore,
	implementing their own paint() methods.  Needs more hacking
	to get the GtkWidget pointers out of the options structs.

	* app/tools/gimppainttool_kernels.h: removed.

	* app/tools/tools-types.h: removed the paint tool enums.

	* app/tools/gimpairbrushtool.[ch]
	* app/tools/gimpclonetool.[ch]
	* app/tools/gimpconvolvetool.[ch]
	* app/tools/gimpdodgeburntool.[ch]
	* app/tools/gimperasertool.[ch]
	* app/tools/gimppaintbrushtool.[ch]
	* app/tools/gimppainttool.[ch]
	* app/tools/gimppenciltool.[ch]
	* app/tools/gimpsmudgetool.[ch]: all paint tools are pure GUI
	things now.  PaintOptions and friends still need to be chopped up
	though...

	* app/undo.c: changed PaintUndo to GimpPaintCoreUndo, some minor
	cleanup.

	* tools/kernelgen.c: changed accordingly.

	* tools/pdbgen/Makefile.am: scan paint/paint-types.h for enums.

	* tools/pdbgen/pdb/paint_tools.pdb: hardcode "success = FALSE" for
	all paint PDB wrappers.  The non-gui stuff is completely broken.
	More commits to come...

	* app/pdb/paint_tools_cmds.c
	* tools/pdbgen/enums.pl: regenerated.
2002-02-14 19:31:16 +00:00
Michael Natterer
dac875d3f2 moved all global variables into the GimpPaintTool structure so they have a
2002-02-13  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.[ch]: moved all global variables into
	the GimpPaintTool structure so they have a proper lifecycle and
	it's easier to move them to the upcoming GimpPaintCore (??)
	object.

	* app/tools/gimppainttool_kernels.h
	* tools/kernelgen.c: s/SUBSAMPLE/KERNEL_SUBSAMPLE/
2002-02-13 14:50:37 +00:00
Sven Neumann
04c995fb70 renamed GimpInterpolationType values to something sane and unexported it
2002-02-12  Sven Neumann  <sven@gimp.org>

	* app/base/base-enums.h: renamed GimpInterpolationType values to
	something sane and unexported it from the PDB since it was never
	used in any PDB calls.

	* app/gimprc.c
	* app/config/gimpcoreconfig.c
	* app/core/gimpcoreconfig.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimplayer.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/paint-funcs/paint-funcs.c
	* app/pdb/transform_tools_cmds.c
	* app/tools/transform_options.c
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.
2002-02-12 03:30:52 +00:00
Michael Natterer
733d6335fe Made the interpolation type configurable in the scale and transform
2002-02-12  Michael Natterer  <mitch@gimp.org>

	Made the interpolation type configurable in the scale and
	transform options dialogs (#69251):

	* app/base/base-config.[ch]
	* app/config/gimpbaseconfig.[ch]: removed interpolation_type here...

	* app/core/gimpcoreconfig.[ch]
	* app/config/gimpcoreconfig.[ch]: ...and added it here.

	* app/gimprc.c
	* app/gui/preferences-dialog.c: changed accordingly.

	* app/paint-funcs/paint-funcs.[ch]: scale_region: take an
	interpolation_type parameter.

	* app/core/gimpchannel.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimplayer.[ch]: pass interpolation_type parameters to all
	scale and transform functions.

	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

	* app/gui/resize-dialog.[ch]
	* app/tools/transform_options.[ch]: added an interpolation_type menu.

	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/tools/gimptransformtool.c: changed accordingly.

	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/transform_tools_cmds.c: regenerated.
2002-02-12 02:31:45 +00:00
Michael Natterer
793f7b3bb3 app/tools/gimpbucketfilltool.c added missing tooltips, enabled "reset" for
2002-02-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpbucketfilltool.c
	* app/tools/selection_options.c: added missing tooltips, enabled
	"reset" for the new select/fill transparent toggles.
2002-02-11 16:22:26 +00:00
Michael Natterer
ceed8eae4e removed #if 0'ed old display update hackery. Don't flush the displays here
2002-02-10  Michael Natterer  <mitch@gimp.org>

	* app/undo.c: removed #if 0'ed old display update hackery. Don't
	flush the displays here at all and include nothing from
	"display/".

	* app/undo_history.c
	* app/gui/edit-commands.c: call gdisplays_flush() if undo_pop() or
	undo_redo() return TRUE.

	* app/core/gimpimage-contiguous-region.[ch]: allow a contiguous
	transparent region to be selected/filled (#71058).

	* app/core/gimpdrawable-bucket-fill.[ch]
	* app/core/gimpimage-mask-select.[ch]: take a boolean
	fill_transparent/select_transparent parameter and pass it to the
	contiguous region funcion.

	* app/display/gimpdisplayshell-dnd.c: pass
	fill_transparent == FALSE to bucket_fill_full because we fill the
	whole drawable anyway here.

	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/selection_options.[ch]: added toggle buttons to the
	tool options and pass the value to the fill and select core
	functions.

	* tools/pdbgen/pdb/misc_tools.pdb
	* tools/pdbgen/pdb/selection_tools.pdb: hardcode
	"select_transparent" to FALSE to get the old behaviour. Should
	export the new feature to plug-ins however.

	* app/pdb/misc_tools_cmds.c
	* app/pdb/selection_tools_cmds.c: regenerated.
2002-02-10 15:18:08 +00:00
Sven Neumann
00f90747ed app/tools/gimptoolmodule.[ch] app/tools/tools-types.h code cleanup, no
2002-02-09  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptoolmodule.[ch]
	* app/tools/tools-types.h
	* app/tools/tools.c: code cleanup, no real changes.
2002-02-09 18:51:17 +00:00
Nate Summers
751c2cb27f split registering classes and registering tools into separate functions.
* app/tools/gimptoolmodule.[ch]: split registering classes and
 	registering tools into separate functions. Makes tool plug-ins
 	actually work!

 	* app/tools/tools.c: replaced extremely ugly temporary hack for
 	loading tool modules with ugly temporary hack for loading tool
 	modules.
2002-02-09 00:11:11 +00:00
Nate Summers
e03ba1bd85 New class that uses GTypeModule to dynamically load tool plugins. Does not
* app/tools/gimptoolmodule.[ch]: New class that uses GTypeModule to
 	dynamically load tool plugins.  Does not quite work yet, but builds
 	correctly.

	* app/tools/tools.c: added some code to test the GimpToolModule code.

 	* app/tools/Makefile.am: added gimptoolmodule to the build.
2002-02-08 07:51:16 +00:00
Michael Natterer
72ca4d3e16 renamed the image size utility functions from foo_size_bar() to
2002-02-07  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-new.[ch]: renamed the image size utility
	functions from foo_size_bar() to foo_memsize_bar(), use "gsize"
	instead of "gdouble". Also take the selection mask into account
	for the initial image size.

	* app/display/gimpdisplayshell.c
	* app/gui/file-new-dialog.c: changed accordingly.

	* app/display/gimpdisplayshell-handlers.c: connect to "undo_event",
	not "dirty" and "clean" to dirty the image title.

	* app/tools/gimpmovetool.c: factored common code out to
	gimp_move_tool_start_guide(), also set a useful cursor there.
2002-02-07 17:37:34 +00:00
Sven Neumann
c51c98d911 app/gui/file-new-dialog.c app/gui/resize-dialog.c
2002-02-07  Sven Neumann  <sven@gimp.org>

	* app/gui/file-new-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c: moved Cancel button to the left.

	* data/images/Makefile.am
	* data/images/tips_wilber.png: removed ...
	* data/images/wilber-tips.png: ... and readded under a new name.

	* app/gui/tips-dialog.c: changed accordingly.

	* data/images/wilber-wizard.png: new wilber for the user installation
	dialog.

	* app/gui/user-install-dialog.c: use the new wilber icon. We still
	need a good new eeek wilber.

	* themes/Default/gtkrc: don't change the default font size.
2002-02-07 11:50:16 +00:00
Michael Natterer
758de05b72 made the gimp_object_get_memsize() debugging output configurable by a
2002-02-06  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpobject.c: made the gimp_object_get_memsize()
	debugging output configurable by a global "gimp_debug_memsize"
	boolean.

	* app/display/gimpdisplay.c: removed duplicated prototype.

	* app/display/gimpdisplayshell.[ch]: renamed the various cursor
	functions to be more consistent and shorter. Compress window title
	updates by adding a "gboolean title_dirty" and updating the title
	in gimp_display_shell_flush().  Added "%m" (memory size) to the
	possible title string substitutions.

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplayshell-handlers.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimptool.c: changed accordingly.

	* app/display/gimpdisplayshell-callbacks.c: forgot to grab the
	pointer when dragging guides from the rulers. Coincidentially,
	this also fixes the buggy offset between guide and mouse
	pointer...
	Cleaned up the main tool event callback a but more.

	* app/widgets/gimppreview.c
	* app/gui/commands.c: set the new global "gimp_debug_memsize"
	toggle to TRUE while calling gimp_object_get_memsize().

	* app/gui/preferences-dialog.c: added a image title example
	containing the new "%m" feature.

	* docs/gimprc-1.3.5.in: document "%m" in the manpage.

	* app/tools/gimpbezierselecttool.c: reordered some statements.

	* app/tools/gimpdrawtool.[ch]: store the GimpDisplay passed to
	gimp_draw_tool_start() in draw_tool->gdisp and use it for
	coordinate transfomration. This way we can paint on a display
	which is not tool->gdisp.

	* app/tools/gimppainttool.c: changed the gimp_draw_tool_foo()
	calls needed to make the straight_line preview work in a way
	that does not interfere with paint_tool subclasses which want
	to do their own drawing (like the clone tool).

	Also changed the paint_tools PRETRACE_PAINT and POSTTRACE_PAINT
	flags usage in a way that subclasses can use them without major
	hackery: don't simply wrap gimp_display_flush_now() with
	PRETRACE/POSTTRACE calls, but wrap the actual painting calls, so
	subclasses are able to do useful things with paint_tool->*_coords.

	* app/tools/gimpclonetool.c: removed poking around in draw_tool
	internals and simply suspend()/resume() it in
	PRETRACE_PAINT/POSTTRACE_PAINT to get the clone_src indicator
	drawn correctly.
2002-02-07 11:33:01 +00:00
Michael Natterer
967d3e4ef1 Removed pointer grabbing from all tools:
2002-02-05  Michael Natterer  <mitch@gimp.org>

	Removed pointer grabbing from all tools:

	* app/tools/gimptool.[ch]: added "gboolean perfectmouse" which
	defaults to FALSE but can be set to TRUE in a tool's instance_init
	function.

	* app/display/gimpdisplayshell-callbacks.c: look at
	active_tool->perfectmouse and gimprc.perfectmouse and do the
	pointer grab/ungrab here. The pointer is now grabbed right before
	dispatching the button_press to the tool and ungrabbed after
	the tool's button_release has returned. It is also grabbed
	*always*, not only if tool->state got ACTIVE by button_press,
	which makes it all much simpler...

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: removed
	gdk_pointer_grab()/ungrab() calls all over the place. Also removed
	inclusion of "display/gimpdisplayshell.h" from most of them.
2002-02-05 11:35:03 +00:00
Michael Natterer
989d80e79e added fields for both the tool's toggled and untoggled GdkCursorType,
2002-02-04  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]: added fields for both the tool's
	toggled and untoggled GdkCursorType, GimpToolCursorType and
	GimpCursorModifier. Added a default implementation of
	gimp_tool_cursor_update() which uses the new fields. Added
	gimp_tool_set_cursor() as simple wrapper around the resp.
	GimpDisplayShell functions so tools don't need to know them.

	Tool implementations can either set the new fields in their
	cursor_update() function and chain up or call the new wrapper.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.[ch]
	* app/tools/gimppathtool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: changed accordingly:

	- set default values in the tools' instance_init functions.
	- changed the cursor_update() stuff.
	- removed inclusion of subclasses in gimppainttool.c
	- the cursor_update() functions are better than before but still evil.
	- i probably broke some of them...
2002-02-04 17:43:01 +00:00
Michael Natterer
0440bbbf5a app/display/Makefile.am app/display/display-types.h new widget derived
2002-02-03  Michael Natterer  <mitch@gimp.org>

	* app/display/Makefile.am
	* app/display/display-types.h
	* app/display/gimpstatusbar.[ch]: new widget derived from
	GtkStatusbar.  Contains the coordinates display, a progress bar
	which is also used for status message display and a cancel button.
	Added a simplified API for pushing/popping messages which takes a
	string as context_id and does the conversion to guint internally
	on each call.

	* app/display/gimpdisplayshell.[ch]: removed the status bar code.

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-scale.c
	* app/gui/view-commands.c
	* app/gimpprogress.c: changed accordingly.

	Removed knowledge about GimpDisplayShell from tools:

	* app/tools/gimptool.[ch]: added gimp_tool_push_status() and
	gimp_tool_pop_status() so tools don't need to fiddle with
	display details.

	* app/tools/gimpdrawtool.[ch]: pass a GimpDisplay instead of
	a GdkWindow to gimp_draw_tool_start() (the window passed was
	always gdisp->shell->canvas->window).

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.[ch]
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.[ch]
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.[ch]
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.[ch]
	* app/tools/gimppathtool.c
	* app/tools/gimprectselecttool.[ch]
	* app/tools/gimptransformtool.c: changed accordingly:

	- pass GimpDisplay to gimp_draw_tool_start().
	- use GimpTool's new status push/pop functions.
	- removed the statusbar context_id from all tool structs.

	* app/gui/dialogs-constructors.[ch]: a bit cleanup in preparation
	of dockable editor dialogs.
2002-02-03 12:10:23 +00:00
Sven Neumann
b8fcfd9af1 derive from GtkDrawingArea instead of deprecated GtkPreview.
2002-01-30  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpcolorarea.[ch]: derive from GtkDrawingArea
	instead of deprecated GtkPreview.

	* app/nav_window.c
	* app/gui/brush-editor.c
	* app/gui/buffers-commands.c
	* app/gui/color-select.c
	* app/gui/colormap-dialog.c
	* app/gui/device-status-dialog.c
	* app/gui/dialogs-constructors.c
	* app/gui/file-open-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/indicator-area.c
	* app/gui/info-window.c
	* app/gui/palette-editor.c
	* app/gui/palette-import-dialog.c
	* app/gui/palettes-commands.c
	* app/gui/test-commands.c
	* app/gui/tool-options-dialog.c
	* app/gui/toolbox.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpcomponentlistitem.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimpimagedock.c
	* app/widgets/gimpitemfactory.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplistitem.c
	* app/widgets/gimpmenuitem.c
	* app/widgets/gimppreview.c
	* libgimp/gimpbrushmenu.c
	* libgimp/gimpgradientmenu.c
	* libgimp/gimpmenu.c
	* libgimp/gimppatternmenu.c
	* plug-ins/FractalExplorer/Dialogs.c
	* plug-ins/common/AlienMap.c
	* plug-ins/common/AlienMap2.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/blinds.c
	* plug-ins/common/curve_bend.c
	* plug-ins/common/depthmerge.c
	* plug-ins/common/despeckle.c
	* plug-ins/common/destripe.c
	* plug-ins/common/diffraction.c
	* plug-ins/common/emboss.c
	* plug-ins/common/exchange.c
	* plug-ins/common/flarefx.c
	* plug-ins/common/fractaltrace.c
	* plug-ins/common/glasstile.c
	* plug-ins/common/gqbist.c
	* plug-ins/common/grid.c
	* plug-ins/common/illusion.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/jigsaw.c
	* plug-ins/common/mapcolor.c
	* plug-ins/common/max_rgb.c
	* plug-ins/common/newsprint.c
	* plug-ins/common/nlfilt.c
	* plug-ins/common/noisify.c
	* plug-ins/common/nova.c
	* plug-ins/common/plasma.c
	* plug-ins/common/polar.c
	* plug-ins/common/sample_colorize.c
	* plug-ins/common/scatter_hsv.c
	* plug-ins/common/sharpen.c
	* plug-ins/common/sinus.c
	* plug-ins/common/tileit.c
	* plug-ins/common/video.c
	* plug-ins/common/waves.c
	* plug-ins/common/whirlpinch.c
	* plug-ins/common/wind.c
	* plug-ins/flame/flame.c
	* plug-ins/fp/fp_gtk.c
	* plug-ins/gimpressionist/brush.c
	* plug-ins/mosaic/mosaic.c
	* plug-ins/rcm/rcm_dialog.c: define GTK_DISABLE_DEPRECATED to make
	it compile.

	We really need a generic plug-in preview system that doesn't use
	GtkPreview.
2002-01-30 14:54:27 +00:00
Raja R Harinath
2189802fb8 Add a few [] to nested AC_CHECK_* invocations. Needed for autoconf 2.52,
* configure.in: Add a few [] to nested AC_CHECK_* invocations.
Needed for autoconf 2.52, but also the right fix for older
autoconfs.  (http://bugzilla.gnome.org/show_bug.cgi?id=68958)

* app/gui/Makefile.am
* app/tools/Makefile.am
* app/widgets/Makefile.am: Search for include files in build
directory too.  (http://bugzilla.gnome.org/show_bug.cgi?id=68961)
2002-01-18 19:07:39 +00:00
Michael Natterer
14d0a3ff07 app/gimpprogress.c app/nav_window.c app/ops_buttons.c app/undo_history.c
2001-12-29  Michael Natterer  <mitch@gimp.org>

	* app/gimpprogress.c
	* app/nav_window.c
	* app/ops_buttons.c
	* app/undo_history.c
	* app/display/gimpdisplayshell.c
	* app/gui/about-dialog.c
	* app/gui/brush-editor.c
	* app/gui/channels-commands.c
	* app/gui/color-area.c
	* app/gui/color-notebook.c
	* app/gui/color-select.c
	* app/gui/colormap-dialog.c
	* app/gui/convert-dialog.c
	* app/gui/device-status-dialog.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/info-dialog.c
	* app/gui/layers-commands.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-editor.c
	* app/gui/palettes-commands.c
	* app/gui/paths-dialog.c
	* app/gui/qmask-commands.c
	* app/gui/resize-dialog.c
	* app/gui/resolution-calibrate-dialog.c
	* app/gui/splash.c
	* app/gui/tips-dialog.c
	* app/gui/toolbox.c
	* app/gui/user-install-dialog.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpcomponentlistitem.c
	* app/widgets/gimpconstrainedhwrapbox.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainerlistview.c
	* app/widgets/gimpcontainermenuimpl.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimpfontselection-dialog.c
	* app/widgets/gimphistogramview.c
	* app/widgets/gimpitemfactory.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplistitem.[ch]
	* app/widgets/gimpmenuitem.c
	* app/widgets/gimppreview.[ch]
	* app/widgets/gtkhwrapbox.c
	* app/widgets/gtkvwrapbox.c
	* app/widgets/gtkwrapbox.c
	* libgimp/gimpbrushmenu.c
	* libgimp/gimpexport.c
	* libgimp/gimpgradientmenu.c
	* libgimp/gimpmenu.c
	* libgimp/gimppatternmenu.c
	* libgimpwidgets/gimpbutton.c
	* libgimpwidgets/gimpchainbutton.[ch]
	* libgimpwidgets/gimpcolorarea.h
	* libgimpwidgets/gimpcolorbutton.c
	* libgimpwidgets/gimpfileselection.c
	* libgimpwidgets/gimphelpui.c
	* libgimpwidgets/gimpoffsetarea.c
	* libgimpwidgets/gimppatheditor.c
	* libgimpwidgets/gimppixmap.h
	* libgimpwidgets/gimpquerybox.c
	* libgimpwidgets/gimpstock.[ch]
	* libgimpwidgets/gimpwidgets.h
	* plug-ins/FractalExplorer/Dialogs.c
	* plug-ins/FractalExplorer/Events.c
	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/MapObject/mapobject_ui.c
	* plug-ins/bmp/bmpwrite.c
	* plug-ins/dbbrowser/dbbrowser_utils.c
	* plug-ins/fits/fits.c
	* plug-ins/flame/flame.c
	* plug-ins/fp/fp_gtk.c
	* plug-ins/fp/fp_misc.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gflare/gflare.c
	* plug-ins/gfli/gfli.c
	* plug-ins/gimpressionist/*.c
	* plug-ins/imagemap/*.[ch]
	* plug-ins/maze/maze_face.c
	* plug-ins/mosaic/mosaic.c
	* plug-ins/pagecurl/pagecurl.c
	* plug-ins/print/print_gimp.h
	* plug-ins/rcm/rcm_callback.c
	* plug-ins/rcm/rcm_dialog.c
	* plug-ins/rcm/rcm_misc.c
	* plug-ins/script-fu/script-fu-console.c
	* plug-ins/script-fu/script-fu-scripts.c
	* plug-ins/script-fu/script-fu-server.c
	* plug-ins/sel2path/sel2path.c
	* plug-ins/sel2path/sel2path_adv_dialog.c
	* plug-ins/sgi/sgi.c
	* plug-ins/webbrowser/webbrowser.c
	* plug-ins/xjt/xjt.c
	* plug-ins/common/[A-n]*.c: compile with GTK_DISABLE_DEPRECATED
	defined. Not everything is fully ported yet, had to #undef
	GTK_DISABLE_DEPRECATED in many places and added #warnings when
	doing so.

	* pixmaps/Makefile.am
	* pixmaps/chain.xpm: removed.

	* themes/Default/Makefile.am
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-button-hchain-broken.png
	* themes/Default/images/stock-button-hchain.png
	* themes/Default/images/stock-button-vchain-broken.png
	* themes/Default/images/stock-button-vchain.png: new stock icons.
2001-12-29 13:26:29 +00:00
Sven Neumann
e43620f8cb calculate mouse movement in screen coordinates. Reset threshold to default
2001-12-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmagnifytool.c: calculate mouse movement in screen
	coordinates. Reset threshold to default value when the Reset button
	is pressed.
2001-12-28 17:36:58 +00:00
David Odin
f3b79372ce Added a threshold value determining by how many pixels the mouse should
move to use the window mode.
2001-12-27 18:33:25 +00:00
Sven Neumann
59ba328d2b fixed text positioning by removing a workaround for a bug that has finally
2001-12-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (text_render): fixed text positioning by
	removing a workaround for a bug that has finally been fixed in Pango.
2001-12-20 18:04:26 +00:00
Michael Natterer
be1215a221 added -DGDK_PIXBUF_DISABLE_DEPRECATED to CPPFLAGS.
2001-12-18  Michael Natterer  <mitch@gimp.org>

	* configure.in: added -DGDK_PIXBUF_DISABLE_DEPRECATED to CPPFLAGS.

	* app/core/gimpbuffer.[ch]: gimp_buffer_get_[width|height]:
	added "const" to the GimpBuffer parameter.

	* app/core/gimpchannel.c: indentation and comment changes.

	* app/core/gimpdrawable-desaturate.c: don't include
	"paint-funcs/paint-funcs.h".

	* app/display/gimpdisplayshell.c: don't include "base/temp-buf.h".

	* app/gui/gui.c: removed the image container's "name_changed"
	handler.

	* app/gui/palette-import-dialog.[ch]: use GimpPreview and
	GimpContainerMenu instead of doing the same manually. Removed lots
	of code. Not perfect yet.

	* app/tools/gimpfuzzyselecttool.c: no need to include tile stuff.

	* app/widgets/gimpcontainerview-utils.c: better g_warning() message.

	* tools/pdbgen/pdb/paint_tools.pdb: don't include
	"base/tile-manager.h".

	* app/pdb/paint_tools_cmds.c: regenerated.

	* data/images/Makefile.am
	* data/images/gimp_logo.ppm: removed...
	* data/images/gimp_logo.png: ...and added as PNG.

	* app/gui/about-dialog.c: use gdk_pixbuf_new_from_file() to load
	the PNG logo instead of manually parsing the PPM.
2001-12-17 23:41:01 +00:00
Michael Natterer
3726976963 added GIMP_IMAGE_TYPE_IS_[RGB|GRAY|INDEXED]() and
2001-12-14  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added
	GIMP_IMAGE_TYPE_IS_[RGB|GRAY|INDEXED]() and
	GIMP_IMAGE_TYPE_BASE_TYPE() macros.

	* app/plug-in/plug-in.[ch]: new enum PlugInImageType instead of
	multiple #defines.

	* app/gui/file-dialog-utils.[ch]: file_dialog_update_menus(): take
	a GimpImageType instead of the PlugInImageType.

	* app/core/gimpdrawable-preview.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpdrawable.c
	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimplayermask.c
	* app/core/gimppalette-import.c
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-render.c
	* app/gui/file-save-dialog.c
	* app/gui/toolbox.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/image.pdb: use the new macros, cleanups like
	storing GimpImageType in GimpImageType variables, not just gint.

	* app/pdb/convert_cmds.c
	* app/pdb/image_cmds.c: regenerated.

	* app/widgets/gimpdialogfactory.c: save the state of the "Auto"
	button in sessionrc.
2001-12-14 15:30:31 +00:00
Michael Natterer
1bc1419e8f app/core/Makefile.am new files.
2001-12-12  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/gimpimage-pick-color.[ch]: new files.

	gimp_image_pick_color() doesn't set the FG or BG color and doesn't
	touch the current palettte.

	* app/tools/gimpcolorpickertool.[ch]: removed the actual picking
	code, set the user_context's FG or BG color here.

	* app/gui/palette-editor.[ch]:
	s/palette_set_active_color/palette_editor_update_color/, don't set
	the FG and BG color here. The function is still #if 0'ed.

	* app/gui/toolbox.c: fixed WM resize hints in toolbox_style_set(),
	code cleanup.

	* app/tools/gimppainttool.[ch]: some cleanup before chopping.

	* app/tools/gimpsmudgetool.c: changed accordingly.

	* tools/pdbgen/pdb/misc_tools.pdb: removed the possibility to set
	the FG or BG color or add the picked color to the active palette
	bacause it doesn't belong here. Palette PDB wrappers are on the
	TODO anyway.

	* app/pdb/misc_tools_cmds.c
	* libgimp/gimpmisctools_pdb.[ch]: regenerated.

	* plug-ins/perl/examples/image_tile
	* plug-ins/perl/examples/logulator
	* plug-ins/script-fu/scripts/hsv-graph.scm
	* plug-ins/script-fu/scripts/title-header.scm: changed accordingly.
2001-12-12 01:16:39 +00:00
Sven Neumann
c44fe72500 app/core/core-enums.h moved gradient enums to core-enums.h and
2001-12-11  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h
	* app/core/core-types.h: moved gradient enums to core-enums.h and
	namespaceified them.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpgradient.c
	* app/gui/gradient-editor-commands.c
	* app/pdb/misc_tools_cmds.c
	* app/tools/gimpblendtool.c
	* tools/pdbgen/pdb/misc_tools.pdb: changed accordingly.

	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.
2001-12-11 18:53:03 +00:00
Sven Neumann
03a6c04419 app/base/base-enums.h moved all remaining enums to base-enums.h
2001-12-11  Sven Neumann  <sven@gimp.org>

	* app/base/base-enums.h
	* app/base/base-types.h: moved all remaining enums to base-enums.h

	* app/core/core-enums.h
	* app/core/core-types.h: moved GimpImageType to core-enums.h and
	changed the values from RGB_GIMAGE to GIMP_RGB_IMAGE and the like.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-preview.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpdrawable.c
	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage.[ch]
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimppalette-import.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-render.c
	* app/gui/file-save-dialog.c
	* app/gui/toolbox.c
	* app/plug-in/plug-in.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpdodgeburntool.c: changed accordingly.

	* tools/pdbgen/Makefile.am: no need to parse app/base/base-types.h
	any longer.

	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/paint_tools_cmds.c
	* tools/pdbgen/enums.pl: regenerated.
2001-12-11 18:11:56 +00:00
Sven Neumann
a611f06361 removed GimpImageBaseType enum ...
2001-12-11  Sven Neumann  <sven@gimp.org>

	* app/core/core-types.h: removed GimpImageBaseType enum ...

	* app/core/core-enums.h: and added it here with proper namespace
	(enum values prefixed with GIMP_).

	* app/gimprc.c
	* app/core/gimpcoreconfig.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-preview.c
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage.c
	* app/core/gimplayer.c
	* app/core/gimppalette-import.c
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell.c
	* app/file/file-utils.c
	* app/gui/colormap-dialog.c
	* app/gui/convert-dialog.c
	* app/gui/info-window.c
	* app/gui/layers-commands.c
	* app/gui/palette-import-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/toolbox.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpchannellistview.c
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/image.pdb: changed accordingly.

	* tools/pdbgen/enums.pl
	* app/pdb/convert_cmds.c
	* app/pdb/image_cmds.c
	* libgimp/gimpconvert_pdb.c
	* libgimp/gimpimage_pdb.c: regenerated.

	* app/config/Makefile.am
	* app/config/gimpconfig-params.h
	* app/config/gimpconfig-serialize.c
	* app/config/gimpcoreconfig.[ch]: added more stuff to GimpCoreConfig.
2001-12-11 15:58:07 +00:00
Sven Neumann
002ac38acd introduced new trigraph keyword /*< pdb-skip >*/ used to skip enums for
2001-12-08  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/enumgen.pl: introduced new trigraph keyword
	/*< pdb-skip >*/ used to skip enums for inclusion in libgimp when
	parsing headers. The keyword /*< skip >*/ is still used to skip
	enum values. This change is necessary since glib-mkenums also uses
	/*< skip >*/.

	* app/base/base-types.h * app/base/base-enums.h: moved
	GimpCheckType and GimpCheckSize to base-enums.h so they get
	registered with the type system, marked them as /*< pdb-skip >*/.

	* app/core/core-types.h * app/display/display-types.h *
	app/paint-funcs/paint-funcs-types.h * app/tools/gimppainttool.h *
	app/tools/tools-types.h: changed /*< skip >*/ to /*< pdb-skip >*/.
2001-12-09 00:15:46 +00:00
Sven Neumann
a65e1a39e4 app/core/Makefile.am new file that holds enums that are registered with
2001-12-08  Sven Neumann  <sven@gimp.org>

	* app/core/Makefile.am
	* app/core/core-enums.h: new file that holds enums that are registered
	with the type system and is used to generate core-enums.c.

	* app/core/core-types.h: include core-enums.h

	* app/base/base-types.h: namespace cleanup. Prefix all enumeration
	types with Gimp and their values with GIMP. Moved GimpLayerModeEffects
	enum ...

	* app/base/base-enums.h: ... here.

	* app/image_map.c
	* app/base/temp-buf.c
	* app/core/gimpcontext.[ch]
	* app/core/gimpdrawable-transform.c
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage.[ch]
	* app/core/gimplayer.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-render.c
	* app/gui/brush-select.c
	* app/gui/layers-commands.c
	* app/gui/preferences-dialog.c
	* app/gui/toolbox.c
	* app/paint-funcs/paint-funcs.[ch]
	* app/tools/gimpconvolvetool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimppainttool.[ch]
	* app/tools/gimptexttool.c
	* app/tools/paint_options.c
	* app/widgets/gimplayerlistview.c
	* app/widgets/gimpwidgets-constructors.[ch]
	* app/xcf/xcf-load.c
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/tools.pdb: changed accordingly.

	* libgimpbase/gimpbasetypes.h: no need to chop GIMP prefix off the
	enums any longer.

	* app/pdb/brush_select_cmds.c
	* app/pdb/brushes_cmds.c
	* app/pdb/color_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/message_cmds.c
	* app/pdb/procedural_db_cmds.c
	* app/pdb/tools_cmds.c
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* app/gimprc.c: removed code to parse for "plug_in" keyword which was
	left over from some very early gimp days.

	* app/plug-in/plug-in.[ch]: removed now unused function plug_in_add().
2001-12-08 23:12:59 +00:00
Michael Natterer
bcd208d9f4 app/Makefile.am removed, chopped...
2001-12-07  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/devices.[ch]: removed, chopped...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/gui/Makefile.am

	* app/widgets/gimpdeviceinfo.[ch]
	* app/widgets/gimpdevices.[ch]
	* app/gui/device-status-dialog.[ch]
	* app/gui/input-dialog.[ch]: ...and added here.

	Made GimpToolInfo a GimpContext subclass. Create a GimpDeviceManager
	struct in gimpdevices.c and attach it to the Gimp instance.

	* app/core/gimp.[ch]: removed gimp_create_context(). It was a bad
	idea in the first place beause it prevented GimpContext subclasses
	from being be properly registered with their Gimp instance.

	* app/core/gimpcontext.c: moved the stuff which used to be in
	gimp_create_context() back here. Added a "gimp" property which
	must be set on construction. Added a "dispose" implementation
	which removes the context from it's Gimp's context_list.

	* app/gimprc.c
	* app/core/gimptoolinfo.[ch]
	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/brush-select.c
	* app/gui/dialogs-constructors.c
	* app/gui/gradient-editor.c
	* app/gui/gradient-select.c
	* app/gui/gui.c
	* app/gui/menus.c
	* app/gui/palette-editor.c
	* app/gui/palette-select.c
	* app/gui/pattern-select.c
	* app/gui/toolbox.c
	* app/tools/gimppainttool.c
	* app/tools/tool_manager.c
	* app/widgets/gimpimagedock.c: changed accordingly.

	* app/gui/tools-commands.[ch]: made all callback signatures
	the same.

	* app/gui/preferences-dialog.c: cleaned up the
	display_format_string GtkCombo code.
2001-12-07 17:39:51 +00:00
Michael Natterer
403a38e20f use the passed Gimp pointer instead of using "the_gimp".
2001-12-03  Michael Natterer  <mitch@gimp.org>

	* app/devices.c: use the passed Gimp pointer instead of
	using "the_gimp".

	* app/base/temp-buf.c: indentation.

	* app/gui/preferences-dialog.c: prefs_toggle_callback(): fixed
	segfault when trying to find the prefs_dlg widget from a menu
	item callback (Fixes #65757).

	* app/gui/offset-dialog.[ch]: fixed public prototype, include
	the header in the .c file.

	* app/gui/menus.c: some menu cleanup: moved all functions which
	operate on the active layer/drawable to <Image>/Layer. Renamed
	"Layers" to "Layer".

	* app/display/gimpdisplayshell.c: changed menu update function
	accordingly.

	* app/gui/image-commands.[ch]
	* app/gui/layers-commands.[ch]: moved stuff from image-commands.*
	to layers-commads.*-

	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/paint_options.c
	* app/tools/transform_options.c
	* plug-ins/common/align_layers.c
	* plug-ins/common/autocrop.c
	* plug-ins/common/autostretch_hsv.c
	* plug-ins/common/c_astretch.c
	* plug-ins/common/color_enhance.c
	* plug-ins/common/guillotine.c
	* plug-ins/common/normalize.c
	* plug-ins/common/rotate.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/common/zealouscrop.c
	* plug-ins/rcm/rcm.c
	* plug-ins/fp/fp.c: register under <Image>/Layer, some cosmetic
	fixes.
2001-12-03 17:59:48 +00:00
Sven Neumann
4ba6db4e94 Michael Natterer <mitch@gimp.org>
2001-12-03  Sven Neumann  <sven@gimp.org>
	    Michael Natterer <mitch@gimp.org>

	* app/paint-funcs/paint-funcs-mmx.h: removed redefiniton of HAS_ALPHA
	macro.

	* app/core/gimp.c: reverted Daniel's change; it doesn't make the code
	simpler, only more error-prone.

	* app/gui/info-dialog.h
	* app/gui/resize-dialog.h
	* app/core/gimp.h
	* app/core/gimpbrushgenerated.h
	* app/core/gimpbrushpipe.h
	* app/core/gimpchannel.[ch]
	* app/core/gimpcontainer.h
	* app/core/gimpcoreconfig.h
	* app/core/gimpdata.h
	* app/core/gimpdatafactory.[ch]
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable.[ch]
	* app/core/gimpimage.h
	* app/core/gimpimagefile.h
	* app/core/gimplayer.h
	* app/core/gimplayermask.h
	* app/core/gimpmoduleinfo.h
	* app/core/gimppalette.h
	* app/core/gimpundo.h
	* app/widgets/gimpbrushfactoryview.h
	* app/widgets/gimpconstrainedhwrapbox.h
	* app/widgets/gimpcontainermenu.h
	* app/widgets/gimpcontainerview.h
	* app/widgets/gimpdialogfactory.h
	* app/widgets/gimpimagedock.h
	* app/widgets/gimplistitem.h
	* app/widgets/gimpmenuitem.h
	* app/widgets/gimpnavigationpreview.h
	* app/widgets/gimppreview.h
	* app/gimprc.h
	* app/pathP.h
	* app/tools/gimpbezierselecttool.h
	* app/tools/gimpcolorbalancetool.h
	* app/tools/gimpcurvestool.h
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpfreeselecttool.h
	* app/tools/gimphuesaturationtool.h
	* app/tools/gimpinktool-blob.h
	* app/tools/gimpinktool.h
	* app/tools/gimpiscissorstool.h
	* app/tools/gimpmagnifytool.h
	* app/tools/gimpmeasuretool.h
	* app/tools/gimppainttool.h
	* app/tools/gimppathtool.h
	* app/tools/gimprectselecttool.h
	* app/tools/gimpthresholdtool.h
	* app/tools/gimptool.h
	* app/tools/gimptransformtool.h
	* app/base/base-config.h
	* app/base/gimplut.[ch]
	* app/base/pixel-region.h
	* app/base/pixel-surround.[ch]
	* app/base/temp-buf.[ch]
	* app/base/tile-manager-private.h
	* app/base/tile-manager.[ch]
	* app/base/tile-private.h
	* app/base/tile.[ch]
	* app/display/gimpdisplay.h
	* app/display/gimpdisplayshell-selection.h
	* app/display/gimpdisplayshell.h
	* app/gui/brush-select.h
	* app/gui/gradient-editor.h
	* app/gui/gradient-select.h: reverted most of Daniel's changes.

	There's no reason to use unsigned integers here and in lots of places
	it is even wrong.

	Then it's way too early to convert gbooleans into bitfields. This
	change may make sense in a few places but can happen later when the
	API has settled and the code is more stable.

	* app/gimprc.c: reverted Daniel's change. This is a GCC-ism and this
	code is about to die soon anyway.
2001-12-03 13:44:59 +00:00
Sven Neumann
83468fca06 use g_tree_foreach() instead of deprecated g_tree_traverse().
2001-12-02  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in.c: use g_tree_foreach() instead of deprecated
	g_tree_traverse().

	* app/undo_history.c
	* app/display/gimpdisplayshell-selection.c
	* app/display/gimpdisplayshell.c
	* app/gui/about-dialog.c
	* app/gui/color-area.c
	* app/gui/color-select.c
	* app/gui/gradient-editor.c
	* app/gui/gui.c
	* app/gui/paths-dialog.c
	* app/gui/user-install-dialog.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpinktool.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpnavigationpreview.c
	* libgimpwidgets/gimpchainbutton.c
	* libgimpwidgets/gimppixmap.c
	* plug-ins/common/animationplay.c
	* plug-ins/common/uniteditor.c
	* plug-ins/ifscompose/ifscompose.c: s/gdk_gc_unref/g_object_unref/,
	s/gdk_drawable_unref/g_object_unref/
2001-12-02 15:43:00 +00:00
Daniel Egger
1ed9180112 Convert ugly comments into named structure fields. Much cleaner and less
2001-12-02  Daniel Egger  <degger@fhm.edu>

	* app/gimprc.c: Convert ugly comments into named structure fields.
	Much cleaner and less errorprone though may cause troubles on
	older compilers and then needs to be reverted. Please report!

	* app/base/base-types.h: Add FIXME reminder.

	* app/base/gimplut.c: Use CLAMP macro instead of if-cascade.

	* app/base/temp-buf.c: Remove duplicated calculations and simplify
	checks.

	* app/base/tile-manager.c:
	- (tile_manager_get_tile_num): Return success and take an additional
	  pointer for the tilenumber.
	- Simplify logic in the rest of the file as a result.
	- Remove rotten debugging cruft.

	* app/core/gimpbrushgenerated.c: Fix two stylistic nits.

	* app/app_procs.c: Include <stdlib.h> for exit () prototype.

	* app/core/gimpdrawable-blend.c: Include <stdlib.h> for abs ()
	prototype.

	* app/display/gimpdisplay.c: Include <string.h> for memcpy ()
	prototype.

	* app/core/gimpimage-convert.c: (HIST_RGB): First parameter is
	not const. Fixes a gcc warning for a wrong return value.

	* libgimpwidgets/gimpunitmenu.c
	* app/core/gimpunit.c: Add suggested (by gcc 3.1 cvs) parentheses
	to group correct logic tests together.

	* app/paint-funcs/paint-funcs-generic.h: Fix my HAS_ALPHA macro
	to avoid gcc 3.1 cvs warning.

	* app/gimprc.h
	* pathP.h
	* base-config.h
	* app/base/boundary.h
	* app/base/gimplut.[ch]
	* app/base/pixel-region.h
	* app/base/pixel-surround.[ch]
	* app/base/temp-buf.[ch]
	* app/base/tile-manager-private.h
	* app/base/tile-manager.c
	* app/base/tile-private.h
	* app/base/tile.[ch]
	* app/core/gimp.h
	* app/core/gimpbrushgenerated.h
	* app/core/gimpbrushpipe.h
	* app/core/gimpchannel.[ch]
	* app/core/gimpcontainer.h
	* app/core/gimpcoreconfig.h
	* app/core/gimpdata.h
	* app/core/gimpdatafactory.[ch]
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable.[ch]
	* app/core/gimpimage.h
	* app/core/gimpimagefile.h
	* app/core/gimplayer.h
	* app/core/gimplayermask.h
	* app/core/gimpmoduleinfo.h
	* app/core/gimppalette.h
	* app/core/gimpundo.h
	* app/display/gimpdisplay.h
	* app/display/gimpdisplayshell-selection.h
	* app/display/gimpdisplayshell.h
	* app/gui/brush-select.h
	* app/gui/gradient-editor.h
	* app/gui/gradient-select.h
	* app/gui/info-dialog.h
	* app/gui/resize-dialog.h
	* app/tools/gimpbezierselecttool.h
	* app/tools/gimpcolorbalancetool.h
	* app/tools/gimpcolorpickertool.h
	* app/tools/gimpcurvestool.h
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpfreeselecttool.h
	* app/tools/gimpfuzzyselecttool.h
	* app/tools/gimphuesaturationtool.h
	* app/tools/gimpinktool-blob.h
	* app/tools/gimpinktool.h
	* app/tools/gimpiscissorstool.h
	* app/tools/gimpmagnifytool.h
	* app/tools/gimpmeasuretool.h
	* app/tools/gimppainttool.h
	* app/tools/gimppathtool.h
	* app/tools/gimprectselecttool.h
	* app/tools/gimpthresholdtool.h
	* app/tools/gimptool.h
	* app/tools/gimptransformtool.h
	* app/tools/path_toolP.h
	* app/widgets/gimpbrushfactoryview.h
	* app/widgets/gimpconstrainedhwrapbox.h
	* app/widgets/gimpcontainermenu.h
	* app/widgets/gimpcontainerview.h
	* app/widgets/gimpdialogfactory.h
	* app/widgets/gimpimagedock.h
	* app/widgets/gimplistitem.h
	* app/widgets/gimpmenuitem.h
	* app/widgets/gimpnavigationpreview.h
	* app/widgets/gimppreview.h: Unsignify lots of variables and
	parameters and use bitfields in structs where possible. First
	part of a huge cleanup all over the code...
2001-12-02 14:59:30 +00:00
Michael Natterer
6d0e5c3450 forgot a "return".
2001-12-01  Michael Natterer  <mitch@gimp.org>

	* app/errors.c: forgot a "return".

	* app/gui/error-console-dialog.c: the menu item signals were
	connected "swapped", which is wrong.

	* app/tools/gimperasertool.c: added a cursor_update_func(), update
	the "toggled" state there and chain up. Fixes wrong cursor
	updating.

	Made brush_pipe slection work again, removed the #warnings:

	* app/core/gimpbrush.[ch]
	* app/core/gimpbrushpipe.c: changed brush_class->select_brush()
	and brush_class->want_null_motion() to be proper virtual
	functions. Pass last_coords and cur_coords to them.

	* app/tools/gimppainttool.c: call the functions again.
2001-12-01 22:59:48 +00:00
Michael Natterer
f77c7ade89 app/main.c moved "message_handler" from here...
2001-12-01  Michael Natterer  <mitch@gimp.org>

	* app/main.c
	* app/appenv.h: moved "message_handler" from here...

	* app/core/gimp.[ch]: ...to here. Added gimp_message() and a
	"gui_message_func" pointer...

	* app/gui/gui.c: ...which gets set here to gui_message().

	* app/errors.c: don't include any gui stuff but simply call
	gimp_message().

	* app/app_procs.c: don't set "message_handler" here, it's done in
	gui.c now.

	* app/gui/error-console-dialog.[ch]: use gimp->message_handler.

	* app/gui/dialogs-constructors.c: pass a Gimp pointer to
	error_console_create().

	* app/widgets/gimpwidgets-utils.[ch]: made the "message" parameter
	of gimp_message_box() a const gchar*, not just gchar*.

	* tools/pdbgen/pdb/message.pdb: use gimp->message_handler, don't
	include "appenv.h".

	* app/pdb/message_cmds.c: regenerated.

	* app/devices.[ch]: cleanup before chopping: removed global
	variable "current_device", added devices_get_current(), pass lots
	of Gimp pointers around.

	* app/gimprc.c: pass a Gimp pointer to devices_rc_update().

	* app/display/gimpdisplayshell-callbacks.c
	* app/gui/toolbox.c
	* app/tools/gimppainttool.c: use devices_get_current(), pass Gimp
	pointers to all devices_foo() functions.

	* app/core/gimpimage-mask.c: no need to include "pdb/pdb-types.h".
2001-12-01 21:02:34 +00:00
Michael Natterer
77863d8868 app/Makefile.am removed...
2001-11-30  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/plug_in.[ch]: removed...

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-types.h
	* app/plug-in/plug-in.[ch]: ...and added here.

	* app/appenv.h: removed StackTraceMode and MessageHandlerType...

	* libgimpbase/gimpbasetypes.h: ...and added them here.

	* tools/pdbgen/Makefile.am: don't scan "app/apptypes.h" for enums.

	* tools/pdbgen/enumcode.pl: added a general check to prevent
	enums which are defined in libgimp* from being written to
	"libgimp/gimpenums.c".

	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* app/core/core-types.h: include "pdb/pdb-types.h" so including
	"core/core-types.h" gets the whole core type space.

	* app/core/gimp.[ch]: added a "stack_trace_mode" parameter to the
	constructor and store it in the Gimp struct because the value is
	also passed to plug-ins and nobody should include "appenv.h".

	* app/gimprc.[ch]: pass the alternate_system_gimprc and
	alternate_gimprc filenames from the command line to gimprc_prase()
	so we don't need to include "appenv.h".

	* app/batch.[ch]: pass the "batch_cmds" as parameter, don't
	include "append.h".

	* app/app_procs.c: pass more parameters around.

	* app/devices.c
	* app/errors.c
	* app/gimphelp.c
	* app/main.c
	* app/core/gimpgradient.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/gui/commands.c
	* app/gui/error-console-dialog.c
	* app/gui/file-dialog-utils.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/paths-dialog.c
	* app/gui/user-install-dialog.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/xinput_airbrush.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/message.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly:

	- changed "plug-in.h" include where needed.
	- don't call gimp_fatal_error() directly, it's called via the log
	  handler when calling g_error().
	- don't incude "errors.h" except from main.c.
	- changed stack_trace and message_handler enum names.
	- get "stack_trace_mode" from Gimp.
	- removed many inclusions of "appenv.h".

	* app/pdb/fileops_cmds.c
	* app/pdb/help_cmds.c
	* app/pdb/message_cmds.c
	* app/pdb/plug_in_cmds.c
	* app/pdb/procedural_db.c: regenerated.
2001-12-01 00:14:14 +00:00
Michael Natterer
cacbd302e8 app/Makefile.am removed.
2001-11-30  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/colormaps.[ch]: removed.

	* app/app_procs.c: don't call it.

	* app/gui/gui.c: configure GdkRGB here.

	* app/display/gimpdisplayshell.c
	* app/display/gximage.c
	* app/gui/color-notebook.c
	* app/gui/color-select.c
	* app/gui/colormap-dialog.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/tools/gimpmovetool.c
	* app/display/gimpdisplayshell-selection.c: changed accordingly
	(simply removed the unneded include or use
	gdk_gc_set_rgb_[fg|bg]_color() instead).

	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-callbacks.[ch]: chopped
	gimp_display_shell_canvas_events() in smaller callbacks. Only the
	events that trigger tool actions are handled in a single callback.
2001-11-30 16:39:40 +00:00
Michael Natterer
bf6e5a4b9d replaced the QMask radio buttons ba a single check button. Still needs
2001-11-29  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.[ch]: replaced the QMask radio
	buttons ba a single check button. Still needs some tuning.

	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-qmask.[ch]: changed accordingly.

	* app/tools/gimptool.[ch]: added "gboolean handle_empty_image" to
	the GimpTool structure.

	* app/tools/gimpmovetool.c: set it to TRUE.

	* app/tools/gimpfuzzyselecttool.c: don't gimp_[set|unset]_busy()
	while calculating the selection but set the busy cursor on the
	display manually (we have the pointer grabbed anyway).

	* app/display/gimpdisplayshell-callbacks.c: don't check for
	GIMP_IS_MODE_TOOL(active_tool) but look at
	active_tool->handle_empty_image. Removed the checks for
	GIMP_IS_FUZZY_SELECT_TOOL(active_tool) because fuzzy_select
	doesn't set GIMP busy while it's active any more.

	* app/tools/transform_options.[ch]
	* app/tools/gimptransformtool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c: added widgets for the transform tools'
	constraints (one more #51108 issue fixed).

	* app/tools/gimperasertool.c: cosmetic.

	* app/widgets/gimpdockbook.c: don't hardcode GtkNotebook's
	tab_border to 0 but add a style property for it...

	* themes/Default/gtkrc: ...and set it to 0 here.
2001-11-29 16:44:51 +00:00
Michael Natterer
f7bbdc3e49 s/gimage_mask/gimp_image_mask/g
2001-11-28  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-mask.[ch]: s/gimage_mask/gimp_image_mask/g

	* app/floating_sel.c
	* app/undo.c
	* app/undo_history.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpdrawable.c
	* app/core/gimpedit.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-mask-select.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage.c
	* app/display/gimpdisplayshell-qmask.c
	* app/display/gimpdisplayshell-selection.c
	* app/display/gimpdisplayshell.c
	* app/gui/channels-commands.c
	* app/gui/edit-commands.c
	* app/gui/layers-commands.c
	* app/gui/select-commands.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpchannellistview.c
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/selection.pdb: changed accordingly.

	* app/pdb/edit_cmds.c
	* app/pdb/selection_cmds.c: regenerated.
2001-11-28 22:42:19 +00:00
Michael Natterer
6cf34005af include the new "paint-funcs/paint-funcs-types.h".
2001-11-28  Michael Natterer  <mitch@gimp.org>

	* app/base/base-types.h: include the new
	"paint-funcs/paint-funcs-types.h".

	* app/paint-funcs/Makefile.am
	* app/paint-funcs/paint-funcs-types.h: new file. Includes
	"base/base-types.h".

	* app/paint-funcs/paint-funcs.[ch]: removed the enums here,
	include "paint-funcs-types.h".

	* app/widgets/widgets-types.h: include "display/display-types.h"

	* app/display/display-types.h: include "widgets/widgets-types.h".

	* app/tools/tools-types.h: include "display/display-types.h"

	* app/gui/gui-types.h: include "tools/tools-types.h".

	The order of namespaces/dependencies should be (but is not):

	(base, paint-funcs) -> (core, file, xcf, pdb) ->
	(widgets, display) -> tools -> gui

	* app/path.c: include "tools/tools-types.h".

	* app/core/Makefile.am
	* app/core/gimpimage-guides.[ch]
	* app/core/gimpimage-merge.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-scale.[ch]: new files.

	* app/core/gimpimage.[ch]: removed the stuff which is in the new
	files. Reordered all functions in both the .h and .c files,
	commented the groups of functions.

	* app/core/gimpcontainer.c: create the handler_id using a counter,
	not the address of a pointer, because the address *may* be the
	same twice, added debugging output.

	* app/core/gimpviewable.[ch]: added primitive support for getting
	a preview GdkPixbuf.

	* app/nav_window.c
	* app/undo.c
	* app/undo_history.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.[ch]
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-scroll.c
	* app/gui/image-commands.c
	* app/gui/info-window.c
	* app/gui/layers-commands.c
	* app/gui/palette-import-dialog.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/widgets/gimpcontainerview-utils.c
	* app/xcf/xcf-load.c: changed accordingly, some cleanup.

	* tools/pdbgen/pdb/guides.pdb
	* tools/pdbgen/pdb/image.pdb: changed accordingly, reordered functions.

	* app/plug_in.c: set the labels of the "Repeat" and "Re-Show" menu
	items to the name of the last plug-in (Fixes #50986).

	* app/display/gimpdisplayshell.[ch]: set the labels of "Undo" and
	"Redo" to the resp. undo names. Much simplified the WM icon stuff
	by removing most code and using gimp_viewable_get_new_preview_pixbuf().

	* app/widgets/gimpbrushfactoryview.c: forgot to assign the GQuark
	returned by gimp_container_add_handler().

	* app/pdb/guides_cmds.c
	* app/pdb/image_cmds.c
	* libgimp/gimpimage_pdb.[ch]: regenerated.
2001-11-28 17:51:06 +00:00
Michael Natterer
9bac8fafec app/core/Makefile.am new files. Changed function names to be consistent.
2001-11-28  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/gimpimage-projection.[ch]: new files. Changed function
	names to be consistent.

	* app/core/gimpimage.[ch]: removed the projection stuff
	here. Removed the gimp_image_composite_blah() functions becauee
	they were just calling the resp. gimp_image_projection ones.

	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimppalette-import.c
	* app/undo.c
	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-render.c
	* app/gui/info-window.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpiscissorstool.c: changed accordingly.
2001-11-28 03:08:03 +00:00
Michael Natterer
54c1b2d1a3 added Rebecca Walter (bex).
2001-11-26  Michael Natterer  <mitch@gimp.org>

	* tools/authorsgen/contributors: added Rebecca Walter (bex).

	* AUTHORS
	* app/gui/authors.h: regenerated.

	* app/widgets/widgets-types.h: added GimpPreviewSize enum.

	* app/gimprc.c
	* app/gui/menus.c
	* app/gui/preferences-dialog.c
	* app/widgets/gimpdockbook.c: use the new enum.

	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpmagnifytool.c: added "(<Ctrl>)" and "(<Alt>)" to
	some tool options strings.

	* app/tools/gimpmovetool.c: some more widgets for hidden tool
	options (#51108).

	* app/tools/transform_options.c: renamed to "Tool Paradigm" stuff
	to something more understandable.

	* app/widgets/gimpdock.c: added a style property for the height
	of the separator.

	* themes/Default/gtkrc: show how to use the new property.

	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimplayerlistview.c: waste less lines when calling
	gtk_widget_style_get().
2001-11-26 13:17:18 +00:00
Simon Budig
477c5ca348 app/tools/gimperasertool.c app/tools/gimperasertool.h Removed the
2001-11-25  Simon Budig  <simon@gimp.org>

        * app/tools/gimperasertool.c
        * app/tools/gimperasertool.h
        * tools/pdbgen/pdb/tools.pdb: Removed the color_erase option of
        the eraser.

        * app/pdb/tools_cmds.c: regenerated.
2001-11-25 19:01:23 +00:00
Sven Neumann
d3047f570b don't draw resize_grip in status bar (patch from Guillermo S. Romero).
2001-11-23  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c: don't draw resize_grip in status bar
	(patch from Guillermo S. Romero).

	* app/devices.c
	* app/display/gimpdisplayshell-filter-dialog.c
	* app/display/gimpdisplayshell-qmask.c
	* app/display/gimpdisplayshell.c
	* app/gui/channels-commands.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/gui/error-console-dialog.c
	* app/gui/file-new-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/layers-commands.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-import-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/gui/resolution-calibrate-dialog.c
	* app/gui/user-install-dialog.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpfontselection-dialog.c
	* libgimpwidgets/gimpquerybox.c
	* libgimpwidgets/gimpunitmenu.c
	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c: changed button order to follow the
	new GTK+ style: confirmative is right-most (for LTR rendering).
2001-11-23 23:04:49 +00:00
Michael Natterer
d463a5efdf removed a useless g_return_if_fail().
2001-11-23  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontainer.c: removed a useless g_return_if_fail().

	* app/widgets/gimpcontainereditor.h: removed GimpViewType enum.

	* app/widgets/widgets-types.h: added it here.

	* app/widgets/gimpcontainerview-utils.[ch]: added a utility function
	which gets the GimpContainerView out of a GimpDockable.

	* app/widgets/gimpdialogfactory.[ch]: added support for saving and
	loading of each GimpDockable's preview size. Store the dialog's
	default preview size in the GimpDialogFactoryEntry.  Pass the
	preview_size to each created dialog.

	* app/gui/menus.c: added menu items for setting the preview_size
	and switching between list and grid view. Removed the item
	overkill in the "Add Tab" submenu.

	* app/gui/dialogs-commands.[ch]: added callbacks for the new items.

	* app/widgets/gimpdockbook.c: set the item's state before showing
	the menu.

	* app/errors.c
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c
	* app/gui/edit-commands.c
	* app/gui/gui.c
	* app/gui/indicator-area.c
	* app/gui/toolbox.c: changed accordingly.

	* app/tools/selection_options.[ch]: cleaned up the selection
	options and added some tooltips. Much more to do...
2001-11-23 16:25:01 +00:00
Sven Neumann
757017a8e2 bumped version number to 1.3.1. Require Glib/GTK+-1.3.11 and Pango-0.22.
2001-11-23  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 1.3.1.
	Require Glib/GTK+-1.3.11 and Pango-0.22. Removed GDK_DISABLE_COMPAT_H
	and GTK_DISABLE_COMPAT_H from our default CFLAGS since they don't
	exist any longer.

	* RELEASE-TO-CVS.patch: removed since the glib/gtk+ API is supposed to
	be frozen now.

	* HACKING: removed reference to RELEASE-TO-CVS.patch

	* app/gui/menus.c
	* app/tools/gimptexttool.c: applied RELEASE-TO-CVS.patch to conform
	to the new GTK+/Pango API.

	* app/core/Makefile.am: generate marshallers with gimp_marshal prefix.

	* app/core/gimpmarshal.list: added all marshallers we use.

	* app/core/gimpmarshal.[ch]: regenerated.

	* app/[lots of .c files]: use gimp_marshal_* for all marshallers.

	* data/images/
	* app/app_procs.c
	* app/gui/splash.c:

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimputils.[ch]: removed since they are no longer needed.

	* app/gimprc.c
	* plug-ins/common/ps.c
	* plug-ins/gdyntext/gdyntext.c
	* plug-ins/gdyntext/gdyntextcompat.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gflare/gflare.c
	* plug-ins/script-fu/script-fu-scripts.c: use glib functions instead
	of gimp_strescape() and gimpstrcompress().

	* cleaned up all header files: use G_BEGIN_DECLS/G_END_DECLS, declared
	all _get_type function as G_GNUC_CONST.

	* tools/pdbgen/enumcode.pl
	* tools/pdbgen/lib.pl: make them generate header files using
	G_BEGIN_DECLS/G_END_DECLS.

	* pixmaps/Makefile.am
	* pixmaps/wilber3.xpm: removed ...
	* data/images/tips_wilber.png: ... and added here as PNG

	* app/gui/tips-dialog.c: load the Wilber on demand using GdkPixbuf.

	* data/images/gimp_splash.ppm: removed ...
	* data/images/gimp_splash.png: ... and added as PNG

	* app/app_procs.c
	* app/gui/splash.[ch]: load the splash image using GdkPixbuf.

	* app/gui/about-dialog.c: sink the GtkPreview.
2001-11-22 23:46:13 +00:00
Michael Natterer
19af93aceb app/tools/gimpclonetool.c app/tools/gimpconvolvetool.c
2001-11-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/paint_options.c
	* app/tools/transform_options.c: removed the remaining cases of
	we-rely-on-the-radio-buttons-being-in-the-same-order-as-the-enum
	and use gimp_radio_group_set_active() instead.
	Use GINT_TO_POINTER(gint) instead of (gpointer)gint all over
	the place.
2001-11-22 17:11:52 +00:00
Michael Natterer
80492e66ed added stock *items* (not only icons) for all tools so they can be used as
2001-11-22  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpstock.c: added stock *items* (not only icons)
	for all tools so they can be used as action buttons.

	* app/tools/gimptransformtool.[ch]: added
	transform_tool->use_center so subclasses can switch on/off center
	detection/cursor_update . Added an oper_update() implementation
	and figure the current handle out there. Reordered button_press()
	so we don't need to call it recursively.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: use the new stock items instead of
	_("Rotate") etc.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimpscaletool.c: allow the whole thing being dragged
	around by handling the center separately.

	* app/tools/gimpdrawtool.c: gimp_draw_tool_on_handle(): need to
	use the radius, not the diameter to check if being over a
	GIMP_HANDLE_CIRCLE handle.
2001-11-22 14:28:39 +00:00
Michael Natterer
a08f3ac001 use "gimp-item-data" instead of "user_data" as data key when attaching
2001-11-22  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: use "gimp-item-data" instead of
	"user_data" as data key when attaching values to radio buttons or
	menu items. (For backward compat, attach "user_data" additionally,
	but don't use it to _get_data()).
	Added gimp_radio_group_set_active() which works like
	gimp_options_menu_set_history() and sets the active item by
	attached "gimp-item-data" value.

	* app/gui/brush-select.c
	* app/gui/file-new-dialog.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/gui/resolution-calibrate-dialog.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpselectiontool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/widgets/gimplayerlistview.c: removed all kinds of
	"user_data" stuff and evil hacks to find a radio button by the
	value it represents (simply call gimp_radio_group_set_active()).

	* app/tools/gimpdrawtool.c: added a g_return_if_fail().

	* app/tools/gimpfliptool.c: don't set draw_tool_class->draw to NULL,

	* app/tools/gimptransformtool.[ch]: fixed some stuff i broke when
	removing the old "interactive" boolean (there is no
	non-interactive transform tool any more).  Put the info_dialog
	pointer and the old_trans_info array into the GimpTransformTool
	instance. Added gimp_transform_tool_info_dialog_connect(). Don't
	include any subclasses any more.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: use
	gimp_transform_tool_info_dialog_connect() to create and connect
	the info dialogs' action_area.
2001-11-22 13:01:26 +00:00
Michael Natterer
d9d34b1055 seems I've comitted something which should only be in
2001-11-21  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptexttool.c: seems I've comitted something which
	should only be in RELEASE-TO-CVS.patch. Sorry...
2001-11-21 17:18:43 +00:00
Michael Natterer
958071b0c8 key press and release events were sent swapped to tools.
2001-11-21  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: key press and release
	events were sent swapped to tools.

	* app/tools/selection_options.[ch]: added radio buttons for the
	selection operation (REPLACE, ADD, ...). Partly fixes #51108.

	* app/tools/gimpselectiontool.[ch]: honor the new tool options
	stuff. Do evil things in gimp_selection_tool_modifier_key().

	* app/tools/gimpbycolorselecttool.[ch]: removed most of the
	widgets from the by_color_select window because they are all in
	the selection_options now.

	* libgimpwidgets/gimpstock.[ch]: added new stock items for the
	buttons.

	* themes/Default/Makefile.am
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-button-selection-add.png
	* themes/Default/images/stock-button-selection-intersect.png
	* themes/Default/images/stock-button-selection-replace.png
	* themes/Default/images/stock-button-selection-subtract.png: new
	stock images.
2001-11-21 03:54:09 +00:00
Michael Natterer
b3e5046e9b added "reset" code for the new auto_shrink tool options.
2001-11-21  Michael Natterer  <mitch@gimp.org>

	* app/tools/selection_options.c: added "reset" code for the new
	auto_shrink tool options.
2001-11-21 00:34:12 +00:00
Michael Natterer
a75c675d03 added GimpToolRegisterFunc, GimpToolRegisterCallback and
2001-11-20  Michael Natterer  <mitch@gimp.org>

	* app/tools/tools-types.h: added GimpToolRegisterFunc,
	GimpToolRegisterCallback and GimpToolOptionsNewFunc typedefs
	which are used to register tools.

	* app/tools/tools.c: put the register funcs in an array of
	GimpToolRegisterFuncs. Pass a Gimp pointer *plus* a
	GimpToolRegisterCallback (which is tool_manager_register_tool())
	to the tools' register functions.

	* app/tools/tool_manager.[ch]: added a GimpToolOptionsNewFunc to
	the parameters of tool_manager_register_tool(). Create the tool
	options here, not in each tool.

	* app/tools/paint_options.[ch]
	* app/tools/selection_options.[ch]
	* app/tools/tool_options.[ch]
	* app/tools/transform_options.[ch]: all _init() and _new()
	functions take a GimpToolInfo pointer now. The _reset() func needs
	to be set manually now.

	* app/tools/[all_tools].[ch]: changed accordingly:

	- pass GimpToolOptionsNewFuncs to the register callback.
	- don't create the tool options in the tools' _init() function.
	- removed all static tool options variables.
	- get the options from the tool system in the cases i missed
	  in my last commit.
	- added minor hacks to get rid of the static options pointer
	  in some pathological cases :) (i.e. the ink tool).
2001-11-20 23:00:47 +00:00
Michael Natterer
9ceb205cec app/tools/gimpdrawtool.[ch] app/tools/gimppainttool.[ch]
2001-11-20  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.[ch]
	* app/tools/gimppainttool.[ch]
	* app/tools/gimprectselecttool.[ch]
	* app/tools/gimptool.[ch]
	* app/tools/gimptransformtool.[ch]: use simple virtual functions
	instead of signals for all tools because they are much faster and
	don't need to be signals at all.
2001-11-20 14:20:17 +00:00
Michael Natterer
625b5c716c put a g_object_ref() on a different line.
2001-11-20  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp.c: put a g_object_ref() on a different line.

	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpmodules.c: ne need to #include "core/..." here.

	* app/display/gimpdisplay-handlers.c: added debugging output
	because we have an image refcounting problem :(

	* app/display/gimpdisplayshell-handlers.c: fixed a signal
	disconnection.

	* app/tools/gimpbezierselecttool.[ch]
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimpsmudgetool.c: get the tool's options via
	tool->tool_info->tool_options, not from the local statis pointer.
	Some minor cleanups & function reordering.

	* app/widgets/gimpdockbook.c: return TRUE from the notebook tabs'
	"button_press" handler, connect DND before cnnecting to
	"button_press" because we now stop it's emission.
2001-11-20 13:53:21 +00:00
Michael Natterer
57044c2f46 forgot to commit last time.
2001-11-19  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay-foreach.c: forgot to commit last time.

	Transform stuff cleanup:

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpdrawable-transform.[ch]: new files implementing
	the actual transform functions cut from tools/gimptransformtool.*.

	* app/core/gimpdrawable-transform-utils.[ch]: new files implementing
	transform matrix assembly utility functions.

	* app/tools/gimptransformtool.[ch]: removed the stuff here. cleanup.

	* app/tools/transform_options.[ch]: removed all stuff which does
	not belong here, e.g. the transform_tool_* functions and the
	global "transform_options" variable. Works like all other tool
	options now.

	* app/tools/gimpfliptool.[ch]
	* app/tools/gimpperspectivetool.[ch]
	* app/tools/gimprotatetool.[ch]
	* app/tools/gimpscaletool.[ch]
	* app/tools/gimpsheartool.[ch]: massive code removal because
	we can use core/gimpdrawable-fransform* functions now. cleanup.

	* tools/pdbgen/Makefile.am
	* tools/pdbgen/groups.pl: added new PDB group "transform_tools".

	* tools/pdbgen/pdb/tools.pdb: removed the transform stuff here...

	* tools/pdbgen/pdb/transform_tools.pdb: and added *much*
	simplified versions which use the new core/gimpdrawable-transform*
	utilities.

	* app/pdb/Makefile.am
	* app/pdb/transform_tools_cmds.c: new file.

	* app/pdb/internal_procs.c
	* app/pdb/tools_cmds.c: regenerated.

	* libgimp/Makefile.am
	* libgimp/gimp_pdb.h
	* libgimp/gimptransformtools_pdb.[ch]: new files.

	* libgimp/gimptools_pdb.[ch]: regenerated.
2001-11-19 18:23:43 +00:00
Michael Natterer
4403d58a62 Wishlist item #57669:
2001-11-16  Michael Natterer  <mitch@gimp.org>

	Wishlist item #57669:

	* app/gimprc.[ch]: replaced gimprc option "allow-resize-windows"
	by "resize-windows-on-zoom" and "resize-windows-on-resize".

	* app/gui/preferences-dialog.c: added a toggle for
	"resize-windows-on-resize".

	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-scale.c
	* app/tools/gimpmagnifytool.c
	* docs/gimprc.5.in
	* etc/gimprc.in
	* etc/gimprc.win32: changed accordingly.

	* app/display/gimpdisplay-area.[ch]: added gimp_area_new().

	* app/display/gimpdisplay.c: cleanup usage of GimpArea.

	* app/display/gimpdisplayshell.[ch]: added configurable canvas
	padding color and a small color_panel to change it in the upper
	right corner of the window.

	* app/display/gimpdisplayshell-callbacks.[ch]: added a callback
	for the color_panel, initialize the color in the "realize"
	callback.

	Wishlist item #51548.

	* app/display/gimpdisplayshell-selection.[ch]
	* app/gui/menus.c
	* app/gui/view-commands.[ch]: made the layer boundary toggleable
	separately from the selection.

	* app/gui/color-notebook.c: #if 0'ed a debugging g_print().
2001-11-16 15:08:59 +00:00
Michael Natterer
d7b3fbe5a5 Gimp's opacity values are a pain... the core actually *should* only accept
2001-11-15  Michael Natterer  <mitch@gimp.org>

	Gimp's opacity values are a pain... the core actually *should*
	only accept and expose values in a [0.0..1.0] range.

	* app/core/gimpdrawable-blend.c
	* app/core/gimpdrawable-bucket-fill.c: take 0.0 <= opacity <= 1.0,
	*not* 0.0 < opacity <= 100.0.

	* app/tools/gimpblendtool.c: don't (opacity * 100.0) before passing.

	* tools/pdbgen/pdb/tools.pdb: (opacity / 100.0) before passing.

	* app/display/gimpdisplayshell-dnd.c: paint_mode and opacity were
	swapped in the call to gimp_drawable_bucket_fill_full().

	* app/pdb/tools_cmds.c: regenerated.
2001-11-15 23:15:52 +00:00
Michael Natterer
f901b46da6 restructured the new draw utility functions and added
2001-11-15  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.[ch]: restructured the new draw utility
	functions and added gimp_draw_tool_draw_handle() and
	gimp_draw_tool_on_handle().

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpcroptool.[ch]
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimptransformtool.c: use the new functions all over
	the place so handle drawing and mouse_over detection work the same
	for all tools.
2001-11-15 21:17:36 +00:00
Michael Natterer
55aa4776f7 added tool_manager_button_press_active() and friends functions.
2001-11-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.[ch]: added
	tool_manager_button_press_active() and friends functions.

	* app/display/gimpdisplayshell-callbacks.c:
	gimp_display_shell_canvas_events(): use the functions instead of
	re-fetching the active_tool whenever it may have changed
	(which requires knowledge about the tools' implementation).
	Also moved lots of variables around.
2001-11-14 17:12:51 +00:00
Michael Natterer
3c8b37f18c added "update_guide" signal.
2001-11-14  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added "update_guide" signal.

	* app/display/gimpdisplay-foreach.[ch]: removed
	gdisplays_expose_guide().

	* app/display/gimpdisplayshell-handlers.c: added a handler for
	"update_guide" and expose the guide there.

	* app/undo.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c: call gimp_image_update_guide() instead
	of gdisplays_expose_guide().
2001-11-14 15:40:30 +00:00
Michael Natterer
6ed7523052 use GimpCoords structs for cur_coords, last_coords and start_coords and
2001-11-13  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.[ch]: use GimpCoords structs for
	cur_coords, last_coords and start_coords and the undo struct
	instead of storing separate gdouble values.

	* app/undo.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c: changed accordingly.
2001-11-13 16:21:34 +00:00
Michael Natterer
3413a9ef3c small fix.
2001-11-12  Michael Natterer  <mitch@gimp.org>

	* HACKING: small fix.

	* configure.in: changed --disable-perl to --enable-perl because
	it doesn't build properly at the moment.

	* pixmaps/Makefile.am: removed stuff which is no longer there
	from EXTRA_DIST.

	* plug-ins/Makefile.am: put back the $(GIMP_PERL) line in SUBDIRS.

	* app/widgets/gimpmenuitem.c. include "libgimpwidgets/gimpwidgets.h".

	* data/Makefile.am
	* data/brushes/Makefile.am
	* data/gradients/Makefile.am
	* data/palettes/Makefile.am
	* data/patterns/Makefile.am: removed the old "files" hack and put
	the stuff to EXTRA_DIST.

	* app/Makefile.am
	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/file/Makefile.am
	* app/gui/Makefile.am
	* app/paint-funcs/Makefile.am
	* app/pdb/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* app/widgets/gimpmenuitem.c
	* app/xcf/Makefile.am
	* cursors/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am
	* libgimpcolor/Makefile.am
	* libgimpmath/Makefile.am
	* libgimpwidgets/Makefile.am
	* m4macros/Makefile.am
	* themes/Makefile.am
	* themes/Default/Makefile.am
	* themes/Default/images/Makefile.am
	* themes/Default/images/tools/Makefile.am: removed "files" target.
2001-11-13 01:46:10 +00:00
Michael Natterer
242b9041a2 use gimp_display_shell_[install|remove]_override_cursor() to set the
2001-11-12  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: use
	gimp_display_shell_[install|remove]_override_cursor() to set the
	middle mouse button move cursor so we get the original cursor back
	after scrolling.

	* app/tools/gimpdrawtool.[ch]: added lots of drawing functions
	(gimp_draw_tool_draw_rectangle() etc.) which work in image (or
	active drawable) coordinates.

	* app/tools/gimpblendtool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/path_tool.[ch]: use the new functions. Removed tons of
	gdk_draw_foo() and gdisplay_transform_foo() calls. Most drawing
	functions look *much* nicer now. Ported some tools to detect
	handle clicks in display coordinates while I was on it, misc
	fixes.

	* app/tools/gimpmovetool.[ch]: derive from GimpDrawTool instead
	of drawing manually.
2001-11-12 14:45:58 +00:00
Michael Natterer
8dac894966 app/display/gimpdisplay-marching-ants.h removed...
2001-11-10  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay-marching-ants.h
	* app/display/gimpdisplay-selection.[ch]: removed...

	* app/display/gimpdisplayshell-marching-ants.h
	* app/display/gimpdisplayshell-selection.[ch]: ...new names.

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell.[ch]: moved the Selection stuff
	from GimpDisplay to GimpDisplayShell.

	Renamed all functions which will stay in GimpDisplay from
	gdisplay_foo() to gimp_display_foo(). Added gimp_display_get_ID(),
	cleaned up the idle renderer.

	* app/image_map.c
	* app/plug_in.c
	* app/display/Makefile.am
	* app/display/gimpdisplay-foreach.[ch]
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-scroll.c
	* app/gui/gui.c
	* app/gui/view-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* tools/pdbgen/pdb.pl: changed accordingly, cleanup.

	* app/pdb/display_cmds.c: regenerated.
2001-11-10 23:03:22 +00:00
Michael Natterer
7125fdbc43 fixed qmask callbacks to check if the toggle is active before performing
2001-11-10  Michael Natterer  <mitch@gimp.org>

	* app/qmask.c: fixed qmask callbacks to check if the toggle is
	active before performing any action.

	* app/core/core-types.h: added the GimpCoords type here because it
	will be used by core functions as soon as the painting stuff is
	separated from the painting tools.

	* app/core/gimpdrawable-bucket-fill.c: fixed g_return_if_fail()s
	to not disable any useful operation :-) Still didn't figure out
	how I broke display color and pattern dropping :-(

	* app/display/gimpdisplayshell.[ch]: added
	gimp_display_shell_[un]transform_coords() which work on two
	GimpCoords pointers.

	* app/display/gimpdisplayshell-callbacks.c: use the new functions
	instead of the gdisplay_* ones.

	* app/gui/image-commands.c: GimpImage emits "disconnect", not
	"destroy".

	* app/tools/tools-types.h
	* app/tools/gimptool.h: removed GimpCoords here.

	* app/tools/gimpconvolvetool.c: fixed modifier_key() implementation.

	* app/tools/gimpcroptool.c: cleanup.

	* app/tools/paint_options.c: don't need a separator in the ink
	tool options.

	* app/tools/gimprectselecttool.c
	* app/tools/selection_options.[ch]: implemented wish #50352:

	Added "Auto Shrink Selection" and "Sample Merged" toggles to
	the rect_select and ellipse_select tools. Put the "Fixed size"
	widgets in a frame. Removed the separators after the common
	selection tool options because I didn't like them any more
	(feel free to comment ;)
2001-11-10 14:17:01 +00:00
Michael Natterer
4fa2553253 should set the fs.backing_store TileManager pointer to NULL after deleting
2001-11-09  Michael Natterer  <mitch@gimp.org>

	* app/undo.c: should set the fs.backing_store TileManager pointer
	to NULL after deleting it. Why the heck didn't this crash
	before...?

	* app/core/Makefile.am
	* app/core/gimpdrawable-blend.[ch]: the blend stuff taken from
	the blend tool.

	* app/core/core-types.h: added the blend enums.

	* app/tools/gimpblendtool.[ch]: removed the stuff here.

	* tools/pdbgen/pdb/tools.pdb: changed blend wrapper accordingly.

	* app/pdb/tools_cmds.c: regenerated.

	* tools/pdbgen/Makefile.am: don't scan tools/gimpblendtool.c.

	* tools/pdbgen/enums.pl: regenerated.

	* app/tools/gimpbucketfilltool.c: fixed crash caused by my last
	change.

	* app/display/gimpdisplay.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.c: removed lots of uglyness by
	using GtkImages for the qmask and navigation buttons. Don't realize
	anything before the shell is shown. Connect the realize
	callback and do stuff there. Don't call the realize callback
	from gimp_display_shell_canvas_events() any more.

	* pixmaps/navbutton.xpm
	* pixmaps/qmasknosel.xpm
	* pixmaps/qmasksel.xpm: removed.

	* themes/Default/Makefile.am
	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-menu-navigation.png
	* themes/Default/images/stock-menu-qmask-off.png
	* themes/Default/images/stock-menu-qmask-on.png: new PNGs instead.

	* libgimpwidgets/gimpstock.[ch]: register them as stock icons.
2001-11-09 16:54:56 +00:00
Michael Natterer
02fde14c95 build display/ before tools/.
2001-11-08  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am: build display/ before tools/.

	* app/devices.c: devices_check_change(): added all events
	which have a GdkDevice pointer.

	* app/gimpprogress.c: include "display-types.h" instead of
	"core-types.h".

	* app/core/Makefile.am
	* app/core/gimpdrawable-bucket-fill.[ch]: new files: the bucket_fill
	stuff taken from tools/gimpbucketfilltool.[ch].

	* app/core/core-types.h: added "BucketFillMode".

	* app/core/gimpimage-mask-select.[ch]: cleanup.

	* app/core/gimpmarshal.list: added more marshallers for GimpTool's
	new signal signatures.

	* app/core/gimpmarshal.[ch]: regenerated.

	* app/display/Makefile.am
	* app/display/gimpdisplayshell-dnd.[ch]
	* app/display/gimpdisplayshell-layer-select.[ch]: new files: the
	canvas drop callbacks from gimpdisplayshell-callbacks.[ch] and
	the stuff formerly knows as gui/layer-select.[ch].

	* app/display/gimpdisplay.h: don't include "gui/gui-types.h".

	* app/display/gximage.c: include "display-types.h".

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplayshell.[ch]: call gdsplay_delete(), don't
	destroy the shell widget.

	* app/gui/Makefile.am
	* app/gui/layer-select.[ch]: removed.

	* app/gui/gradients-commands.c: fixed "Save as POV" fprintf()s.

	* app/gui/preferences-dialog.c: removed the layer_select stuff
	because it is useless with the new preview system.

	* app/gui/tool-options-dialog.c: send the correct data to the
	close_callback.

	* app/gui/tools-commands.c: changed to follow the new
	gimp_tool_initialize() semantics (see below).

	Tool & canvas event handling chainsawing:

	* app/tools/tools-types.h: new struct GimpCoords which contains
	x, y, pressure, tilt etc.

	* app/display/gimpdisplayshell-callbacks.[ch]: added utility
	functions which transparently retreive the current event's
	GimpCoords or take it from the device directly if the event has
	none. Pass GimpCoords _in_image_coordinates_ to all tool
	functions.

	Most important: don't pass GdkEvents and display coordinates to
	tools any more.

	* app/tools/gimptool.[ch]: changed virtual functions to take
	GimpCoords, time and state separately instead of GdkEvents.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.[ch]
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.[ch]
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpdrawtool.c
	* app/tools/gimpeditselectiontool.[ch]
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.[ch]
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.[ch]
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpselectiontool.[ch]
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/path_tool.[ch]
	* app/tools/selection_options.c: tons and tons of changes:

	- changed to use the new virtual function parameters.
	- removed zillions of gdisplay_untransform_coords().
	- get the active drawable's offsets manually in many cases.
	  (questionable, but IMHO ok because it's obvious and not simply a
	  "TRUE" passed to some function)
	- reordered some functions to be consistent across tools.
	- some tools had to be changed to work on image coords, not
	  display ones (esp. crop).
	- fixed strange rotate tool behaviour which should be backported
	  to stable.
	- some stuff i came across.
	- indentation and other paranoia.
	- rounding of coordinated may be broken in some tools.
	- new bugs guaranteed.

	* app/tools/tool_manager.[ch]: new semantic of
	tool_manager_initialize_active() (looked at the places where it
	was used from and put common code together). Should be a bit
	better now :)

	* app/tools/gimpblendtool.c
	* app/tools/transform_options.c: use the new GTK+ feature that a
	widget (toggle button) can be a frame's title for this tools' tool
	options.

	* app/widgets/widgets-types.h: stuff.

	* themes/Default/gtkrc: s/GtkDialog/GimpDialog/.

	* tools/pdbgen/Makefile.am: don't scan tools/gimpbucketfilltool.h
	any more.

	* tools/pdbgen/enums.pl: regenerated.

	* tools/pdbgen/pdb/tools.pdb: changed bucket_fill wrapper.

	* app/pdb/tools_cmds.c: regenerated.
2001-11-08 19:14:51 +00:00
Michael Natterer
7c2b559593 stop synthesizing expose events but use gdk_window_invalidate_rect() and
2001-11-02  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-scroll.c: stop synthesizing expose
	events but use gdk_window_invalidate_rect() and
	gdk_window_process_updates() (both with "update_children == FALSE"
	because the canvas has no children).

	* app/tools/gimpmagnifytool.c: nothing.
2001-11-02 10:55:10 +00:00
Michael Natterer
d162376d47 app/display/Makefile.am app/display/gimpdisplay-callbacks.[ch]
2001-11-01  Michael Natterer  <mitch@gimp.org>

	* app/display/Makefile.am
	* app/display/gimpdisplay-callbacks.[ch]
	* app/display/gimpdisplay-render.[ch]
	* app/display/gimpdisplay-scale.[ch]
	* app/display/gimpdisplay-scroll.[ch]: removed and added as
	gimpdisplayshell-foo.[ch] because they are all methods of the
	shell.

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell.[ch]: moved the "offset" and "size"
	variables from GimpDisplay to GimpDisplayShell. GimpDisplay
	should know nothing about screen coordinates.

	The gdisplay_[un]transform_foo() methods are still part of
	GimpDisplay but will be moved to GimpDisplayShell as soon as the
	tools' vitrual functions speak in image coordinates instead of
	GdkEvents.

	* app/display/gimpdisplayshell-callbacks.[ch]: prefixed all
	functions with gimp_display_shell_*. Moved some stuff to a
	"realize" callback File still has to be renamed.

	* app/display/gimpdisplay-foreach.[ch]: removed
	gdisplays_shrink_wrap().

	* app/gui/menus.c
	* app/gui/view-commands.[ch]
	* app/display/gimpdisplayshell-scale.[ch]: implemented "Zoom to
	Fit Window" function (#57670).

	* app/nav_window.c
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-render.[ch]
	* app/display/gimpdisplayshell-scale.[ch]
	* app/display/gimpdisplayshell-scroll.[ch]
	* app/gui/colormap-dialog.c
	* app/gui/gui.c
	* app/gui/preferences-dialog.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmovetool.c
	* app/widgets/gimppreview.c: changed according to variable
	and filename changes.

	* app/tools/tool_manager.c: tool_manager_select_tool(): send the
	active tool a "HALT" command before selecting the new one. Fixes
	stale tool dialogs which were there because some other hack was
	removed (This is IMHO the right place to shut down the active
	tool).

	* app/tools/gimpcroptool.c: don't shrink wrap after cropping but
	let gimprc.allow_resize_windows decide.

	* app/tools/gimpselectiontool.c: gimage_mask_value() takes image,
	not screen coordinates. A good example of how braindead it is to
	pass GdkEvents to tools :-) Fixes incorrect cursor and oper
	update of the selection tools.

	* app/tools/gimptransformtool.c
	* app/undo.c: removed (#if 0 for now) some strange code which did
	manual exposing of GimpDisplayShell areas. This was definitely a
	hack and should not be there given the image emits correct
	"update" signals.
2001-11-02 09:31:21 +00:00
Michael Natterer
cbce339039 fscking broken pipe... 2001-10-31 21:20:09 +00:00
Simon Budig
8c6aa9f2e7 Oops - forgot to remove a #warning.
2001-10-30  Simon Budig   <simon@gimp.org>

	* app/tools/gimperasertool.c: Oops - forgot to remove a #warning.
2001-10-30 23:28:02 +00:00
Simon Budig
3954526311 app/pdb/tools_cmds.c app/tools/gimperasertool.c app/tools/gimperasertool.h
2001-10-30  Simon Budig   <simon@gimp.org>

        * app/pdb/tools_cmds.c
        * app/tools/gimperasertool.c
        * app/tools/gimperasertool.h
        * tools/pdbgen/pdb/tools.pdb

        Added a "color erase" feature to the eraser. This is ported from
        the colortoalpha plugin and is utterly cool.

        The "Color Erase" Option should be disabled when the drawable
        has no alpha channel, however, I have no idea how to do this.
2001-10-30 22:59:06 +00:00
Sven Neumann
de5af18f87 rewrote so gcc-3.0 doesn't complain.
2001-10-29  Sven Neumann  <sven@gimp.org>

	* app/base/temp-buf.c (temp_buf_to_gray): rewrote so gcc-3.0 doesn't
	complain.

	* app/widgets/gimpfontselection-dialog.c: use g_ascii_strcasecmp().

	* libgimp/gimpintl.h
	* libgimp/stdplugins-intl.h
	* plug-ins/script-fu/script-fu-intl.h: don't call gtk_set_locale()
	since gtk_init() does it for us now. Don't set LC_NUMERIC to "C".
	INIT_I18N_UI() is the same as INIT_I18N_UI() now.

	* app/devices.c
	* app/gimprc.c
	* app/core/gimpbrushgenerated.c
	* app/core/gimpgradient.c
	* app/gui/color-notebook.c
	* app/gui/gradients-commands.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gflare/gflare.c
	* plug-ins/gimpressionist/presets.c
	* plug-ins/ifscompose/ifscompose_storage.c: use g_ascii_formatd() and
	g_ascii_strtod() to serialize and deserialize floats. These functions
	are locale-independent. There are probably more places that need to be
	fixed in this fashion.

	* plug-ins/script-fu/script-fu-console.c
	* plug-ins/script-fu/script-fu-scripts.c
	* plug-ins/script-fu/script-fu-server.c
	* plug-ins/script-fu/script-fu.c: s/INIT_I18N_UI/INIT_I18N/

	* tools/gimp-remote.c
	* app/widgets/gimpwidgets-utils.c
	* app/core/gimpimage-contiguous-region.c
	* app/paint-funcs/paint-funcs-indexeda.c
	* app/paint-funcs/paint-funcs.c
	* app/tools/gimppathtool.c
	* app/tools/path_tool.c
	* modules/colorsel_triangle.c
	* plug-ins/common/mpeg.c
	* plug-ins/imagemap/imap_csim_parse.c: cleanups
2001-10-29 12:51:21 +00:00
Michael Natterer
05e15eb1cc Cleanup weekend...
2001-10-29  Michael Natterer  <mitch@gimp.org>

	Cleanup weekend...

	* app/app_procs.c: pass "no_interface" to gimp_new().

	* app/core/gimp.[ch]: added "gboolean no_interface" and the
	load_procs and save_procs GSLists.

	* app/core/gimptoolinfo.[ch]: added a "Gimp" pointer to the
	GimpToolInfo object so more functions find their context without
	accessing the global "the_gimp" variable.

	* app/display/display-types.h: removed the GDisplay -> GimpDisplay
	typedef.

	* app/display/gimpdisplay.c: look at gimp->no_interface, don't
	include "appenv.h".

	* app/file/file-open.[ch]
	* app/file/file-save.[ch]: don't use "the_gimp" any more. Instead,
	pass around lots of "Gimp" pointers. Removed the global load_procs
	and save_procs variables here. Use access() to find out whether a
	file is readable/writable, removed the manual voodoo and it's
	Win32 wrappers. Added an optional (can be NULL) "PlunInProcDef"
	parameter to file_save(), removed file_save_with_proc().

	* app/gui/menus.c: Use the unused "gpointer data" parameter of the
	GtkItemFactory callbacks to pass a "Gimp" pointer to all of them.
	This reduces the usage of the global "the_gimp" hack to zero
	in app/gui/... yeah.

	* app/gui/channels-commands.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/palettes-commands.c
	* app/gui/select-commands.c
	* app/gui/test-commands.c
	* app/gui/tools-commands.c
	* app/gui/view-commands.c: use the passed "Gimp" pointer.

	* app/gui/color-area.[ch]
	* app/gui/convert-dialog.c
	* app/gui/dialogs-constructors.c
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/gui.c
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/palette-editor.c
	* app/gui/palette-import-dialog.[ch]
	* app/gui/paths-dialog.c
	* app/gui/preferences-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/tool-options-dialog.[ch]
	* app/gui/toolbox.c: pass around lots more "Gimp" and
	"GimpContext" pointers and don't use "the_gimp" any more.

	* app/tools/gimptool.h: added a pointer to the corresponding
	GimpToolInfo object (which in turn has a pointer to a Gimp).

	* app/tools/tool_manager.[ch]: set the pointer after creating the
	tool object. Removed tool_manager_get_info_by_tool() as there is a
	tool->tool_info pointer now.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpdrawtool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppathtool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/path_tool.c
	* app/tools/xinput_airbrush.c: s/GDisplay/GimpDisplay/g.
	Use tool->tool_info and tool_info->gimp in some places to get
	rid of using "the_gimp".

	Removing the remaining ones involves changing the tool options
	system and is scheduled next...

	* app/widgets/gimpdnd.c
	* app/widgets/gimpdocumentview.c: pass a "Gimp" pointer to all
	file_open_*() functions.

	* app/gdisplay_color.[ch]
	* app/gdisplay_color_ui.[ch]
	* app/image_map.[ch]
	* app/nav_window.[ch]
	* app/path.c
	* app/path_bezier.c
	* app/path_transform.h
	* app/qmask.[ch]: s/GDisplay/GimpDisplay/g

	* tools/pdbgen/pdb/fileops.pdb: load_procs and save_procs are
	members of the "Gimp" object now.

	* tools/pdbgen/pdb/plug_in.pdb: use gimp->no_interface, don't
	include "appenv.h".

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2001-10-29 11:47:11 +00:00
Michael Natterer
840a9700f4 app/file-open.c app/file-utils.c app/gimprc.c app/plug_in.c
2001-10-24  Michael Natterer  <mitch@gimp.org>

	* app/file-open.c
	* app/file-utils.c
	* app/gimprc.c
	* app/plug_in.c
	* app/user_install.c
	* app/base/base.c
	* app/base/temp-buf.c
	* app/core/gimpdata.c
	* app/core/gimpdatafiles.c
	* app/core/gimpimagefile.c
	* app/gui/about-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gui.c
	* app/gui/menus.c
	* app/gui/splash.c
	* app/gui/tips-dialog.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* libgimpbase/gimpenv.c
	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gflare/gflare.c
	* tools/pdbgen/pdb/fileops.pdb: use g_build_filename() all over
	the place instead of g_strconcat() and friends together with
	G_DIR_SEPARATOR_S. Also removed all attempts to manually detect
	double dir separators. LibGimpBase's searchpath utility functions
	don't append a G_DIR_SEPARATOR_S to all paths any more.

	* app/pdb/fileops_cmds.c: regenerated.
2001-10-24 15:56:33 +00:00
Michael Natterer
99e78c7074 General cleanup of the selection tools and their PDB wrappers:
2001-10-22  Michael Natterer  <mitch@gimp.org>

	General cleanup of the selection tools and their PDB wrappers:

	* app/core/Makefile.am
	* app/core/gimpimage-contiguous-region.[ch]
	* app/core/gimpimage-mask-select.[ch]: new files providing a clean,
	uniform API for the selection functionalities. Changed order of
	parameters to be consistent, removed code duplication.

	The region returned by the "by_color" function is not really
	contiguous but the API is so similar to "by_seed" and it's used
	in the same context so it's fair enough to put them together.

	Also, I'm not sure if the two is_pixel_sufficiently_different()
	I've optimized away were meant to do *exactly* the same. Added
	a comment there to remember the former difference.

	* app/core/gimpchannel.[ch] (gimp_channel_feather): removed the
	"output" channel parameter and made it optionally push an undo
	(like the other channel operations do).

	* app/core/gimpimage-mask.c: call gimp_channel_feather() with
	"push_undo == TRUE", removed some useless comments.

	* app/tools/gimpbycolorselecttool.[ch]
	* app/tools/gimpellipseselecttool.[ch]
	* app/tools/gimpfreeselecttool.[ch]
	* app/tools/gimpfuzzyselecttool.[ch]
	* app/tools/gimprectselecttool.[ch]: removed all the actual
	selection functionality and call the new gimp_image_mask_select_*()
	and gimp_image_contiguous_region_*() functions instead.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpiscissorstool.c: use new function
	gimp_image_mask_select_channel() instead of doing the same manually.

	* app/tools/gimpbucketfilltool.c: find_contiguous_region() ->
	gimp_image_contiguous_region_by_seed().

	* tools/pdbgen/Makefile.am
	* tools/pdbgen/groups.pl
	* tools/pdbgen/pdb/selection_tools.pdb: added new group "Selection
	Tools" which depends only on "core/" stuff (not on "tools/" any
	more, brrrr).

	* tools/pdbgen/pdb/text_tool.pdb: don't include "appenv.h"

	* tools/pdbgen/pdb/tools.pdb: removed the selection tools.

	* app/pdb/Makefile.am
	* app/pdb/selection_tools_cmds.c: new file.

	* app/pdb/internal_procs.c
	* app/pdb/text_tool_cmds.c
	* app/pdb/tools_cmds.c: regenerated.

	* libgimp/Makefile.am
	* libgimp/gimp_pdb.h
	* libgimp/gimpselectiontools_pdb.[ch]: new files.

	* libgimp/gimptools_pdb.[ch]: regenerated

	Misc cleanups:

	* app/app_procs.c: call splash_create() with "no_splash_image"
	as parameter.

	* app/display/gimpdisplay-render.c
	* app/display/gximage.c: don't include "appenv.h".

	* app/gui/gui.c: call session_restore() only if "restore_session"
	is TRUE.

	* app/gui/session.c: don't "if(restore_session)" here and don't
	include "appenv.h"

	* app/gui/splash.[ch]: added "gboolean show_image" parameter to
	splash_create(), don't include "appenv.h"

	* app/tools/gimppainttool.[ch]: added a "GimpGradient" parameter
	to gimp_paint_tool_get_color_from_gradient().

	* app/tools/gimppaintbrushtool.c: pass the gradient.

	* app/tools/gimpselectiontool.c
	* app/tools/gimptransformtool.c
	* app/tools/tool_manager.c: s/GDisplay/GimpDisplay/.

	* app/widgets/gimpcontainergridview.[ch]: removed the "white_style"
	class variable and don't fiddle around with colors and styles...

	* themes/Default/gtkrc: ...do the same here with a simple rc style.
2001-10-22 12:13:44 +00:00
Michael Natterer
18dd072836 app/gimpprogress.[ch] s/GDisplay/GimpDisplay/
2001-10-16  Michael Natterer  <mitch@gimp.org>

	* app/gimpprogress.[ch]
	* app/undo.c: s/GDisplay/GimpDisplay/

	* app/plug_in.[ch]: removed unused boolean "destroy" field of
	the PlugIn struct.

	* app/core/gimpedit.c: don't include "app_procs.h"

	* app/display/gimpdisplay-callbacks.c: moved the "grab_abd_scroll"
	stuff from gimpdisplay-scroll.* here (less complicated and easier
	to cleanup...)

	* app/display/gimpdisplay-scroll.[ch]: removed here.

	* app/display/gimpdisplay-render.[ch]
	* app/display/gimpdisplay-selection.[ch]
	* app/display/gimpdisplayshell.c: s/GDisplay/GimpDisplay/g

	* app/display/gimpdisplay.[ch]: ditto, removed gdisplay_active()
	which was just a wrapper around
	"gimp_context_get_display (gimp_get_user_context (the_gimp))"
	(which is more to type but makes the use of the global
	"the_gimp" variable more obvious).

	* app/gui/color-area.h
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/file-dialog-utils.c
	* app/gui/image-commands.c
	* app/gui/info-window.h
	* app/gui/paths-dialog.h
	* app/gui/select-commands.c
	* app/gui/tool-options-dialog.c
	* app/gui/tools-commands.c
	* app/gui/view-commands.c: s/GDisplay/GimpDisplay/, gdisplay_active()
	removal, include "app_procs.h" for "the_gimp".

	* app/tools/gimpbezierselecttool.h
	* app/tools/gimpbrightnesscontrasttool.[ch]
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorbalancetool.[ch]
	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimpeditselectiontool.h
	* app/tools/gimphistogramtool.[ch]
	* app/tools/gimphuesaturationtool.[ch]
	* app/tools/gimplevelstool.[ch]
	* app/tools/gimpmovetool.h
	* app/tools/gimpperspectivetool.h
	* app/tools/gimpposterizetool.[ch]
	* app/tools/gimprotatetool.h
	* app/tools/gimpscaletool.h
	* app/tools/gimpsheartool.h
	* app/tools/gimptexttool.h
	* app/tools/gimpthresholdtool.[ch]
	* app/tools/gimptool.[ch]
	* app/tools/gimptransformtool.h
	* app/tools/tool_manager.[ch]: lots of s/GDisplay/GimpDisplay/, made
	all *_dialog_hide() functions private, cleanup.

	* app/widgets/*: removed GtkType and gtk_type_* stuff entirely and
	use GObject functions, removed lots of empty "destroy" methods and
	use more type checking class cast macros instead of casting
	directly.

	* app/widgets/gimpcontainermenu.c: fixed item insert order.

	* app/widgets/gimphistogramview.[ch]: cleaned up and renamed all
	functions.

	* app/widgets/gimpwidgets-utils.[ch]: removed gimp_dialog_hide() as
	Gtk+ does the right thing (TM) now.

	* tools/pdbgen/pdb/color.pdb: implemented "histogram" without
	digging into tools/ and widgets/ (needs to be done for all
	color PDB functions).

	* tools/pdbgen/pdb/gimprc.pdb: no need to use "the_gimp" in a PDB
	function as a "Gimp" pointer is passed to them all.

	* tools/pdbgen/pdb/image.pdb: don't include "app_procs.h"

	* app/pdb/color_cmds.c
	* app/pdb/gimprc_cmds.c
	* app/pdb/image_cmds.c: regenerated.

	* app/pdb/procedural_db.c: don't include "app_procs.h"
2001-10-17 11:33:43 +00:00
Michael Natterer
859e9c4117 gdk_pixbuf_new_from_stream -> _from_inline
2001-10-13  Michael Natterer  <mitch@gimp.org>

	* RELEASE-TO-CVS.patch: gdk_pixbuf_new_from_stream -> _from_inline

	* app/display/Makefile.am
	* app/display/gimpdisplay-foreach.[ch]: new files for functions
	operating on all displays (will go away as soon as the display
	behaves like a proper view which doesn't need to be updated
	explicitly).

	* app/display/gimpdisplay-callbacks.c
	* app/display/gimpdisplay-scale.[ch]
	* app/display/gimpdisplay-scroll.[ch]
	* app/display/gimpdisplay.[ch]: "scale" and "scroll" namespace
	cleanup, moved bounds_checking() to gimpdisplay-scroll.[ch], lots
	of unfinished, intermediate stuff.

	* app/display/gimpdisplayshell.[ch]: added some GObject framework
	for the GimpDisplayShell object (not used yet).

	* app/app_procs.c
	* app/docindex.c
	* app/image_map.c
	* app/nav_window.c
	* app/path.c
	* app/qmask.c
	* app/undo.c
	* app/gui/channels-commands.c
	* app/gui/convert-dialog.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/gui.c
	* app/gui/image-commands.c
	* app/gui/layer-select.c
	* app/gui/layers-commands.c
	* app/gui/offset-dialog.c
	* app/gui/paths-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/select-commands.c
	* app/gui/view-commands.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpcomponentlistitem.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplayerlistview.c
	* app/widgets/gimplistitem.c
	* tools/pdbgen/pdb/display.pdb
	* app/pdb/display_cmds.c: changed accordingly (mostly including
	"gimpdisplay-foreach.h" instead of "gimpdisplay.h")
2001-10-13 12:52:30 +00:00
Michael Natterer
f235eabbf1 app/Makefile.am app/disp_callbacks.[ch] app/gdisplay.[ch]
2001-09-26  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/disp_callbacks.[ch]
	* app/gdisplay.[ch]
	* app/gdisplay_ops.[ch]
	* app/gximage.[ch]
	* app/image_render.[ch]
	* app/interface.[ch]
	* app/marching_ants.h
	* app/scale.[ch]
	* app/scroll.[ch]
	* app/selection.[ch]: removed.

	* app/display/Makefile.am
	* app/display/display-types.h
	* app/display/gimpdisplay-callbacks.[ch]
	* app/display/gimpdisplay-marching-ants.h
	* app/display/gimpdisplay-ops.[ch]
	* app/display/gimpdisplay-render.[ch]
	* app/display/gimpdisplay-scale.[ch]
	* app/display/gimpdisplay-scroll.[ch]
	* app/display/gimpdisplay-selection.[ch]
	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell.[ch]
	* app/display/gximage.[ch]: added here.

	* app/[many files]
	* app/gui/[many files]
	* app/tools/*
	* app/widgets/[many files]: changed accordingly. Still very
	incomplete separation of the display stuff but it at least
	compiles.

	* tools/pdbgen/pdb.pl:
	* tools/pdbgen/pdb/display.pdb: s/GDisplay/GimpDisplay/,
	s/"gdisplay.h"/"display/gimpdisplay.h"/.

	* app/pdb/display_cmds.c: regenerated.
2001-09-25 23:23:09 +00:00
Michael Natterer
b2215a1f8b renamed it to GimpDisplay and made it a GimpObject subclass.
2001-09-25  Michael Natterer  <mitch@gimp.org>

	* app/gdisplay.[ch]: renamed it to GimpDisplay and made it a
	GimpObject subclass.

	* app/disp_callbacks.[ch]
	* app/gdisplay_ops.[ch]
	* app/scale.[ch]
	* app/scroll.[ch]
	* app/display/display-types.h: changed accordingly.

	* app/core/gimpimage.[ch]: new signal "selection_control".

	* app/core/core-types.h: moved the SelectionControl enum and all
	other core enums here.

	* app/gui/gui.c: connect to the images' "selection_control" signal
	and call gdisplays_selection_visibility().

	* app/core/gimpcontext.c
	* app/core/gimpdrawable-offset.h
	* app/core/gimpimage-convert.h
	* app/core/gimpimage-mask.c
	* app/core/gimplayer.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c: changed accordingly.

	* app/gui/colormap-dialog.[ch]: GObject porting.

	* tools/pdbgen/Makefile.am: removed headers which no longer
	contain enums.

	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/drawable.pdb: include files which are no longer
	included automatically by the enum voodoo.

	* app/pdb/convert_cmds.c
	* tools/pdbgen/enums.pl: regenerated.
2001-09-25 17:44:03 +00:00
Hans Breuer
c2f9c198ea need to link with pangof2
2001-09-22  Hans Breuer  <hans@breuer.org>

	* app/makefile.msc : need to link with pangof2

	* app/display/display-funcs.h : new file to provide prototype
	gdisplays_selection_visibility ()
	* app/core/gimpimage-mask.c :
	* app/core/gimplayer.c : use it

	* app/core/makefile.msc : generate gimpmarshal.[hc]

	* app/gui/makefile.msc : add error-console-dialog.obj, also
	more trying for building as dll

	* app/tools/gimpinktool.c(965) : avoid "fatal error C1021: invalid
	preprocessor command 'warning'", by wrapping it in #ifdef __GNUC__

	* app/tools/makefile.msc : add FREETYPE2_CFLAGS

	* app/widgets/gimpfontselction-dialog.c : use g_strcasecmp ()

	* app/tools/makefile.msc : add FREETYPE2_CFLAGS and gimpfontselction*

	* libgimp/gimp.def :
	* libgimpwidgets/gimpwidgets.def : updated externals

	* libgimpwidgets/makefile.msc : add gimpstock

	* plug-ins/makefile.msc : gflare doesn't require EXTRA_gflare anymore

	* plug-ins/common/spheredesigner.c :
	* plug-ins/helpbrowser/helpbrowser.c :
	* plug-ins/imagemap/imap_main.c :
	remove _help_accel from gimp_help_connect ()

	* plug-ins/gap/gap_mov_dialog.c :
	* plug-ins/gap/gap_navigator_dialog.c : remove references to
	use_xshm and gimp_color_cube ()

	* plug-ins/gfig/gfig.c : don't access ->klass, but use
	G_OBJECT_GET_CLASS

	* plug-ins/gimpressionist/repaint.c : the GtkButton::child
	field is moved to the parent GtkBin.

	* plug-ins/ifscompose/ifscompose.c : the GtkStyle::font field
	isn't public anymore, use accessor gtk_style_get_font ()

	* plug-ins/imagemap/imap_preferences.c : reflect GTK2 API change
	gtk_notebook_set_current_page ()
2001-09-22 19:47:27 +00:00
Michael Natterer
cb474a0845 made a real object (GtkDialog subclass) out of it. The API will change
2001-09-20  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpdialog.[ch]: made a real object (GtkDialog
	subclass) out of it. The API will change soon too.

	* libgimpwidgets/gimpwidgetstypes.h: added GimpDialog typedef.

	* libgimpwidgets/gimpbutton.[ch]
	* libgimpwidgets/gimpchainbutton.[ch]
	* libgimpwidgets/gimpcolorarea.[ch]
	* libgimpwidgets/gimpcolorbutton.[ch]
	* libgimpwidgets/gimpfileselection.[ch]
	* libgimpwidgets/gimpoffsetarea.[ch]
	* libgimpwidgets/gimppatheditor.[ch]
	* libgimpwidgets/gimppixmap.c
	* libgimpwidgets/gimpsizeentry.c
	* libgimpwidgets/gimpunitmenu.c: removed GtkType stuff and use
	GType in all get_type() functions. Some random GObject porting.

	* app/gui/info-dialog.c
	* app/gui/info-window.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c: changed accordingly.
2001-09-21 10:47:19 +00:00
Sven Neumann
334911e271 require GTK+-1.3.8 and PangoFT2-0.19.
2001-09-19  Sven Neumann  <sven@gimp.org>

	* configure.in: require GTK+-1.3.8 and PangoFT2-0.19.

	* app/devices.c:
	* app/tools/gimppainttool.c: removed intermediate hacks that are no
	longer needed with the new GTK+ release.

	* app/plug_in.c
	* libgimp/gimp.[ch]
	* libgimp/gimpui.c
	* libgimpbase/gimpprotocol.[ch]: removed use_xshm and color_cube
	variables and accessor functions.

	* app/errors.c: use gtk_exit() instead of gdk_exit().

	* app/gdisplay.c: use Pango API to determine cursor label width. This
	does not work correctly, but at least it compiles...

	* app/gui/splash.c: follow Pango API changes.

	* app/tools/gimpcurvestool.[ch]: use PangoLayouts to draw text.

	* app/tools/gimptexttool.c: follow Pango API changes.

	* app/widgets/gimpfontselection-dialog.c
	* app/widgets/gimpfontselection.c: mostly rewritten following the
	changes in GtkFontSelection. This is unusable at the moment and
	crashes, but at least it compiles again...

	* plug-ins/Makefile.am: temporarily disabled build of ifscompose since
	it does not compile any longer after the latest GDK cleanups.

	* plug-ins/common/nlfilt.c: gimp_color_cube() is obsolete.
2001-09-19 14:42:35 +00:00
Sven Neumann
f586310605 app/devices.c readded the old code here in case the old GDK variable is
2001-09-09  Sven Neumann  <sven@gimp.org>

	* app/devices.c
	* app/tools/gimppainttool.c: readded the old code here in case the
	old GDK variable is defined. Since GTK+-1.3.7 is finally out, we want
	to try to keep GIMP compile against this release as long as possible.

	* plug-ins/common/gif.c: applied a patch from David Odin
	<dindinx@wanadoo.fr> that brings the GIF plug-in back to live.

	* plug-ins/common/.cvsignore
	* plug-ins/common/Makefile.am
	* plug-ins/common/plugin-defs.pl: build it again.
2001-09-09 19:54:37 +00:00
Daniel Egger
cae8f71e8a app/devices.c Use new gdk_device_get_core_pointer () instead of the former
2001-09-08  Daniel Egger  <egger@interearth.com>

        * app/devices.c
	* app/tools/gimppainttool.c: Use new gdk_device_get_core_pointer ()
	instead of the former gdk_core_pointer variable. You will need a
	recent CVS gtk to compile it!
2001-09-08 16:51:37 +00:00
Michael Natterer
1ccb029ead added -DGDK_DISABLE_DEPRECATED.
2001-09-02  Michael Natterer  <mitch@gimp.org>

	* configure.in: added -DGDK_DISABLE_DEPRECATED.

	* app/gui/about-dialog.c
	* plug-ins/common/wmf.c
	* plug-ins/ifscompose/ifscompose_utils.c: #undef it here (too lazy...)

	* app/colormaps.[ch]
	* app/gdisplay.c
	* app/module_db.c
	* app/plug_in.c
	* app/gui/brush-editor.c
	* app/gui/color-notebook.c
	* app/gui/gradient-select.c
	* app/gui/palette-select.c
	* app/gui/paths-dialog.c
	* app/gui/select-commands.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.c: replaced deprecated stuff,
	g_list_free() the return value of gtk_container_get_children().

	* plug-ins/Makefile.am: build gflare again.

	* plug-ins/gflare/asupsample.[ch]: removed because the same function
	is already in libgimpcolor.

	* plug-ins/gflare/gtkmultioptionmenu.[ch]: removed because Gtk+
	handles menu_height > screen_height by scrolling now.

	* plug-ins/gflare/Makefile.am
	* plug-ins/gflare/gflare.c: changed accordingly, cleanups.
2001-09-03 13:03:34 +00:00
Thomas Canty
4e9fcfa632 app/colormaps.c app/gdisplay.c app/nav_window.c app/scroll.c
2001-08-31  Thomas Canty  <tommydal@optushome.com.au>
	* app/colormaps.c
	* app/gdisplay.c
	* app/nav_window.c
	* app/scroll.c
	* app/selection.c
	* app/undo.c
	* app/gui/about-dialog.c
	* app/gui/color-area.c
	* app/gui/color-select.c
	* app/gui/gradient-editor.c
	* app/gui/gui.c
	* app/gui/splash.c
	* app/tools/gimpcurvestool.c
	* plug-ins/Lighting/lighting_preview.c
	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/MapObject/mapobject_preview.c
	* plug-ins/MapObject/mapobject_ui.c
	* plug-ins/common/animationplay.c
	* plug-ins/common/curve_bend.c
	* plug-ins/gap/gap_navigator_dialog.c
	* plug-ins/gfig/gfig.c
	* plug-ins/gimpressionist/gimpressionist.c
	* plug-ins/ifscompose/ifscompose.c
	* plug-ins/imagemap/imap_main.c
	* plug-ins/imagemap/imap_preferences.c
	* plug-ins/imagemap/imap_preview.c: replaced some deprecated GDK
	functions
2001-08-31 14:01:47 +00:00
Michael Natterer
51f99c3259 app/plug_in.c libgimpbase/gimpwire.c removed GIOChannel
2001-08-30  Michael Natterer  <mitch@gimp.org>

	* app/plug_in.c
	* libgimpbase/gimpwire.c
	* libgimp/gimp.c: removed GIOChannel "channel->funcs->io_foo()"
	hacks and use plain g_io_channel_[read|write]_chars(). An
	additional g_io_channel_set_buffered (channel, FALSE); is needed
	to make the channels work in binary mode. Fixed misc other stuff
	in the GIOChannel code.

	* app/tools/gimpdrawtool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpdialogfactory.c
	* libgimpwidgets/gimpcolorarea.c
	* libgimp/gimpui.c: replaced some deprecated GDK functions.

	* app/gui/palette-editor.c: block the color_name entry's "changed"
	signal while setting it. Fixes invalid UTF-8 warnings.
2001-08-30 01:09:58 +00:00
Michael Natterer
98410c35a9 added -DG_DISABLE_DEPRECATED and -DGDK_DISABLE_COMPAT_H.
2001-08-29  Michael Natterer  <mitch@gimp.org>

	* configure.in: added -DG_DISABLE_DEPRECATED and
	-DGDK_DISABLE_COMPAT_H.

	* app/batch.c
	* app/file-utils.c
	* app/gdisplay.c
	* app/gdisplay_ops.c
	* app/gimprc.[ch]
	* app/module_db.c
	* app/nav_window.c
	* app/undo_history.c
	* app/core/gimpgradient.c
	* app/core/gimpimagefile.c
	* app/core/gimppalette.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/gui/error-console-dialog.c
	* app/gui/file-commands.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/info-window.c
	* app/gui/menus.c
	* app/gui/palette-import-dialog.c
	* app/tools/gimpbycolorselecttool.c
	* app/widgets/gimpcontainerview-utils.c
	* app/widgets/gimpdatafactoryview.c
	* libgimp/gimpmenu.c
	* plug-ins/common/bz2.c
	* plug-ins/common/compose.c
	* plug-ins/common/csource.c
	* plug-ins/common/decompose.c
	* plug-ins/common/gz.c
	* plug-ins/common/uniteditor.c
	* plug-ins/common/wmf.c
	* plug-ins/common/xbm.c
	* plug-ins/rcm/rcm_dialog.c
	* plug-ins/script-fu/interp_slib.c
	* plug-ins/script-fu/script-fu-console.c
	* plug-ins/script-fu/script-fu-scripts.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/gimprc.pdb
	* app/pdb/fileops_cmds.c
	* app/pdb/gimprc_cmds.c: removed deprecated stuff like
	g_basename(), g_dirname(), g_strup() and friends. Added some
	"const gchar *" declarations while I was on it. Added some
	G_N_ELEMENTS() macros instead of declaring a useless variable
	for the number of items.

	* app/widgets/gtkhwrapbox.[ch]
	* app/widgets/gtkvwrapbox.[ch]
	* app/widgets/gtkwrapbox.[ch]: replaced with the latest versions
	from GLE, ported by the master himself.

	* app/gui/toolbox.c: changed accordingly.

	* app/plug_in.c
	* libgimp/gimp.c
	* libgimpbase/gimpwire.[ch]: use evil hacks to get binary mode
	from the new GIOChannel implementation (upstream bugreport already
	posted).
2001-08-29 17:48:28 +00:00
Sven Neumann
d896cf5916 app/devices.h app/disp_callbacks.c applied a patch from
2001-08-19  Sven Neumann  <sven@gimp.org>

	* app/devices.h
	* app/disp_callbacks.c
	* app/interface.c: applied a patch from <David.Odin@bigfoot.com> that
	changes some function prototype to return gboolean instead of gint.

	* app/tools/gimpblendtool.c: pixel_regions_register() and
	pixel_regions_process() return a gpointer, not (gpointer *).
2001-08-19 11:21:48 +00:00
Michael Natterer
01b780d682 added app/display/ and app/plug-in/. Empty for now except for the types
2001-08-17  Michael Natterer  <mitch@gimp.org>

	* configure.in: added app/display/ and app/plug-in/. Empty for
	now except for the types files.

	* app/Makefile.am
	* app/appenums.h
	* app/apptypes.h: removed.

	* app/display/Makefile.am
	* app/display/display-types.h
	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-types.h
	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/pdb/Makefile.am
	* app/pdb/pdb-types.h: new files for typedefs.

	* app/appenv.h: added MessageHandlerType and StackTraceMode here.

	* app/undo_types.h: moved undo struct typedefs here.

	* app/tools/tools-types.h
	* app/core/core-types.h: added some enums and Tattoo here
	(renamed to GimpTattoo).

	* app/gdisplay.h: temp_hack: #include "display/display-types.h"

	* app/gimphelp.c: s/gtk_idle_add/g_idle_add/

	* app/gimprc.c: don't use "gimprc" in token handlers but the
	passed "val1p" and "val2p".

	* app/image_map.[ch]: cleanup in preparation of making a GObject
	out of it.

	* app/base/pixel-region.[ch]: no need to pass the
	PixelRegionIterator around as void pointer.

	* app/core/gimp.[ch]
	* app/core/gimpcontext.[ch]
	* app/core/gimptoolinfo.[ch]
	* app/tools/tool_manager.c
	* app/widgets/gimpdnd.c: added the standard_tool_info to the Gimp
	object.

	* app/batch.c
	* app/file-open.c
	* app/file-save.c
	* app/file-utils.c
	* app/interface.c
	* app/main.c
	* app/path.[ch]
	* app/pathP.h
	* app/plug_in.h
	* app/core/gimpdrawable.[ch]
	* app/core/gimpimage-mask.c
	* app/core/gimpimage.[ch]
	* app/core/gimplayer.c
	* app/gui/color-area.c
	* app/gui/color-notebook.c
	* app/gui/colormap-dialog.c
	* app/gui/dialogs-commands.c
	* app/gui/dialogs-constructors.c
	* app/gui/error-console-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/gradient-select.c
	* app/gui/indicator-area.c
	* app/gui/info-dialog.c
	* app/gui/palette-editor.c
	* app/gui/palette-select.c
	* app/gui/pattern-select.c
	* app/gui/session.c
	* app/gui/splash.c
	* app/gui/view-commands.c
	* app/tools/gimpinktool-blob.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimppreview.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* app/xcf/xcf.c: changed accordingly: s/Tattoo/GimpTattoo/, include
	the new types files, include <glib-object.h> instead of >gtk/gtk.h>.
	Bad hacks to get rid of SELECTION_OFF and friends in core/ (will
	be replaced ba a signal soon).

	* tools/pdbgen/Makefile.am: changed list of headers scanned for
	enums accordingly.

	* app/pdb/procedural_db.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/display.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/pattern_select.pdb: same fixes as above, added
	hacks to ensure that all foo-types.h files are included before all
	other gimp internal includes, include "pdb-types.h" unconditionally.

	* tools/pdbgen/enums.pl
	* app/pdb/*_cmds.c: regenerated.
2001-08-17 14:27:31 +00:00
Michael Natterer
667d8626eb app/tools/gimptool.[ch] removed all *_get_PDB_string() functions and
2001-08-15  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: removed all *_get_PDB_string()
	functions and GimpToolClass' "pdb_string" field as this info is
	stored independent from a specific tool instance in GimpToolInfo

	* app/tools/gimpbezierselecttool.c: use GimpToolInfo's "pdb_string".
2001-08-14 22:28:25 +00:00
Michael Natterer
cf6221600c app/interface.c app/gui/about-dialog.c app/gui/brush-editor.c
2001-08-14  Michael Natterer  <mitch@gimp.org>

	* app/interface.c
	* app/gui/about-dialog.c
	* app/gui/brush-editor.c
	* app/gui/brush-select.c
	* app/gui/color-notebook.c
	* app/gui/color-select.c
	* app/gui/convert-dialog.c
	* app/gui/file-commands.c
	* app/gui/file-dialog-utils.c
	* app/gui/file-dialog-utils.h
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/gradients-commands.c
	* app/gui/gui.c
	* app/gui/image-commands.c
	* app/gui/info-window.c
	* app/gui/layer-select.c
	* app/gui/menus.c
	* app/gui/paths-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/resolution-calibrate-dialog.c
	* app/gui/select-commands.c
	* app/gui/splash.c
	* app/gui/test-commands.c
	* app/gui/tips-dialog.c
	* app/tools/gimpthresholdtool.c
	* app/tools/paint_options.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.c: got rid of all
	gtk_object_[get|set]_data() and almost all gtk_signal_foo()
	function calls.
2001-08-14 16:33:28 +00:00
Michael Natterer
e2daae315b an evil temp_hack which lets GimpContext managing the active display
2001-08-14  Michael Natterer  <mitch@gimp.org>

	* app/gdisplay.h: an evil temp_hack which lets GimpContext managing
	the active display withoug including "gdisplay.h". Will go away as
	soon ad context properties are registered dynamically.

	* app/module_db.c: cleaned up the object code in preparation of
	moving it to core/.

	* app/path.c: connect to GimpImage's

	* app/core/gimpobject.[ch]: derive it from GObject, not from
	GtkObject any more (yeah :-)

	* app/core/*.c: #include <glib-object.h> instead of <gtk/gtk.h>,
	removed some remaining GtkObject-isms.

	(left in a few #include <gtk/gtk.h> where bigger changes are needed
	to get rid of the UI dependency).

	* app/core/core-types.h: #include <gdk-pixbuf/gdk-pixbuf.h> here
	temporarily.

	* app/core/gimp.c (gimp_create_display): unref the image after
	creating it's first display.

	* app/core/gimpbrush.[ch]: disabled the parts of the code which
	depend on GimpPaintTool.

	* app/core/gimpbrushgenerated.c
	* app/core/gimpbrushpipe.c: changed accordingly.

	* app/core/gimpcontext.[ch]: evil hack (see above) to manage the
	active display without including "gdisplay.h"

	* app/core/gimpimage-mask.[ch]: pass a context to
	gimage_mask_stroke() and get the current tool's PDB string from
	there.

	* app/core/gimpedit.c: changed accordingly.

	* app/core/gimpimage.c: use gimp_image_update() instead of
	gdisplays_update_full().

	* app/gui/color-area.c
	* app/gui/colormap-dialog.c
	* app/gui/dialogs-constructors.c
	* app/gui/edit-commands.c
	* app/gui/image-commands.c
	* app/gui/toolbox.c: changed accordingly (don't use Gtk methods on
	GObjects).

	* app/gui/menus.c: fix some const warnings by explicit casting.

	* app/tools/*.[ch]: ported all tools to GObject, some minor
	cleanup while i was on it.

	* app/widgets/gimpdialogfactory.[ch]: ported to GObject.

	* app/widgets/gimplayerlistview.h: added FOO_GET_CLASS() macro.

	* tools/pdbgen/app.pl: added a "widgets_eek" hack like "tools_eek"
	which inserts #include "widgets/widgets-types.h" before ordinary
	includes.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/edit.pdb
	* app/pdb/brush_select_cmds.c
	* app/pdb/edit_cmds.c: changed according to the stuff above.
2001-08-14 14:53:55 +00:00
Sven Neumann
840437199c take image resolution and choosen unit into account for font and border
2001-08-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: take image resolution and choosen unit
	into account for font and border size.

	* app/widgets/gimpfontselection-dialog.[ch]
	* app/widgets/gimpfontselection.[ch]
	* app/widgets/widgets-types.h: added an indicator for font validity.
	Added a font preview to the font selection dialog.

	* libgimpwidgets/gimpfileselection.c: return FALSE from
	gimp_file_selection_entry_focus_out_callback() since we do not want
	to stop signal emission.
2001-08-14 13:49:21 +00:00
Michael Natterer
79faae01b4 Switched to GObject reference counting:
2001-08-12  Michael Natterer  <mitch@gimp.org>

	Switched to GObject reference counting:

	* app/core/gimpcontainer.c: only ref(), not ref()/sink() children
	of strong containers. Reordered gimp_container_remove() so we
	don't need to ref the object while removing it.

	* app/core/gimpcontext.c: misc fixes. Needs to be badly tortured...

	* app/app_procs.c
	* app/gdisplay.c
	* app/gimprc.c
	* app/core/gimp.c
	* app/core/gimpbrush.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpdatafactory.c
	* app/core/gimpdocuments.c
	* app/core/gimpgradient.c
	* app/core/gimpimage.c
	* app/core/gimplayer.c
	* app/core/gimplist.c
	* app/core/gimpobject.c
	* app/core/gimpparasite.c
	* app/core/gimppattern.c
	* app/core/gimpundostack.c
	* app/gui/dialogs.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpfuzzyselecttool.c: changed accordingly: don't
	ref()/sink() any more, unref all (??) objects after adding them to
	strong containers, misc. minor fixes.

	* app/gui/dialogs-constructors.c
	* app/widgets/gimpwidgets.c: use g_object_add_weak_pointer()
	instead of simply crashing because g_object_weak_ref() was used
	with gtk_widget_destroyed, brrr.

	* app/widgets/gimpdnd.c: removed unneeded g_return_if_fail()'s.
2001-08-12 15:39:23 +00:00
Sven Neumann
a01e644563 return the created layer.
2001-08-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: return the created layer.

	* app/pdb/text_tool_cmds.c
	* libgimp/gimptexttool_pdb.c
	* tools/pdbgen/pdb/text_tool.pdb: hacked a bit so scripts using the
	text_*_fontname procedures work again with the new text tool.
	The fontname is however no longer a X Logical Font Description, but
	the much simpler scheme that Pango understands:
	"[FAMILY-LIST] [STYLE-OPTIONS]". Interactive font selection is still
	broken. The variants of the text PDB calls that pass the XLFD fields
	directly should also work since the PDB now translates this to a
	Pango-conform fontname. Later this API will die, but for the moment,
	some backward compatibility can't hurt...
2001-08-11 21:35:23 +00:00
Michael Natterer
da68142ee9 split "destroy" up in "dispose" and "finalize".
2001-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp.c: split "destroy" up in "dispose" and "finalize".

	* app/core/gimpcontext.c: objects need to be passed around with
	g_param_spec_object() or bad things will happen.

	* app/gui/channels-commands.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/gui.c
	* app/gui/layers-commands.c
	* app/gui/resize-dialog.c
	* app/gui/select-commands.c
	* app/tools/gimpclonetool.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimppreview.c: removed many connections to
	"destroy": Connect to "dispose" or use g_object_weak_ref()
	instead.
2001-08-11 21:10:44 +00:00
Michael Natterer
5e74fa373a fsck^^^ -- lovely autofoo wants "changequote([,])dnl"
2001-08-11  Michael Natterer  <mitch@gimp.org>

	* configure.in: fsck^^^ -- lovely autofoo wants "changequote([,])dnl"

	* app/core/gimpcontext.[ch]: lots of GObject porting.

	* app/core/gimpobject.[ch]: added a "disconnect" signal, which
	like gtk's "destroy" is emitted in dispose(). This is ugly but
	I don't see another "clean" way to implement weak containers.

	* app/core/gimpcontainer.c: connect to the "disconnect" signal of
	the children of weak containes.

	* app/core/gimpimage.[ch]: replaced the "destroy" implementation
	with "dispose" + "finalize". Removed gimage->undo_history.

	* app/devices.c
	* app/gui/dialogs-constructors.c
	* app/gui/tools-commands.c
	* app/tools/tool_manager.c
	* app/widgets/gimpimagedock.c: changed accordingly.
2001-08-11 19:53:35 +00:00
Sven Neumann
eb50191ba9 made border work and fixed render offsets.
2001-08-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: made border work and fixed render offsets.
2001-08-11 18:41:47 +00:00
Sven Neumann
4c9033cd65 allow to specify size and border.
2001-08-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: allow to specify size and border.

	* app/widgets/gimpfontselection.c: use GTK_STOCK_SELECT_FONT icon.
2001-08-11 17:24:47 +00:00
Sven Neumann
df8a3120cf added dependency on PangoFT2 (Pango compiled with FreeType2 support).
2001-08-11  Sven Neumann  <sven@gimp.org>

	* configure.in: added dependency on PangoFT2 (Pango compiled with
	FreeType2 support).

	* app/Makefile.am: link against PangoFT2.

	* app/tools/Makefile.am
	* app/tools/gimptexttool.[ch]: rudimentary new text tool. Still needs
	lots of work.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h:
	* app/widgets/gimpfontselection-dialog.[ch]
	* app/widgets/gimpfontselection.[ch]: added font selection widgets.

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpfontselection.[ch]: removed font selection code
	from here since the fonts need to be selected from the core's
	PangoContext. Will add PDB-controlled font selection later.
2001-08-11 15:35:16 +00:00
Michael Natterer
2353c5d3e7 fix compiler warning.
2001-08-10  Michael Natterer  <mitch@convergence.de>

	* app/nav_window.c: fix compiler warning.

	* app/core/gimp.[ch]: added gimp->documents which will be an MRU
	list of GimpImagefile objects.

	* app/core/gimpcontainer.c: added some g_return_if_fail().

	* app/gui/palette-editor.c: use GtkImage instead of GtkPixmap,
	s/gtk_signal_*/g_signal_*/.

	* app/widgets/gimppreview.c: render the checkerboard only for
	channel == -1. In particular, don't render it for channel
	previews.

	* app/module_db.c
	* app/core/*.c
	* app/gui/colormap-dialog.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimperasertool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/tool_manager.c
	* app/widgets/*.c
	* libgimpwidgets/*.c: s/gtk_type_new/g_object_new/
2001-08-10 14:41:39 +00:00
Michael Natterer
30d2fdef07 configure.in themes/Default/images/Makefile.am some new Makefiles to make
2001-08-06  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* themes/Default/images/Makefile.am
	* themes/Default/images/tools/Makefile.am: some new Makefiles to
	make it installable.

	* Makefile.am
	* gtkrc: removed...

	* themes/Default/Makefile.am
	* themes/Default/gtkrc: ...added here.

	* themes/Default/imagerc: new file (not used, just for
	documentation) which loads the default theme's images in the same
	way the inlined pixbufs are registered with the stock system.

	* gimprc.in
	* gimprc.win32
	* user_install
	* user_install.bat
	* app/gimprc.[ch]: added "theme-path" and "theme" gimprc variables.

	* app/app_procs.c: prase gimprc before initializing the GUI.

	* app/core/gimpdatafiles.[ch]: added support for getting only
	subdirectories in the callback.

	* libgimpbase/gimpenv.c: as a temp_hack gimp_gtkrc(); returns the
	default theme's gtkrc.

	* app/gui/gui.c: build a hash of theme directories and select
	the one configured in gimprc.theme. Use gimp_gtkrc()'s default
	value if there is no theme installed or configured.

	* app/gui/preferences-dialog.c: Added theme_path to the GUI. No
	stuff for selection the theme yet.

	* app/gui/menus.c: beautify <Image>/Tools/

	* app/tools/gimpcroptool.c: register in <Image>/Tools/Transform Tools/
2001-08-05 20:34:10 +00:00
Michael Natterer
fdabe08cf0 DIE broken pipe, DIE 2001-08-05 16:08:19 +00:00
Michael Natterer
d128e9895b register the button icons with GTK_ICON_SIZE_BUTTON, but set them as
2001-08-05  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpstock.[ch]: register the button icons with
	GTK_ICON_SIZE_BUTTON, but set them as scalable fallbacks for
	themselves so they get scaled for menus.

	* app/gui/menus.c: set stock icons for much more menu entries.

	* app/widgets/gimpwidgets-utils.[ch]: new utility function
	gimp_item_factory_popup_with_data().

	* app/disp_callbacks.[ch]
	* app/gui/brushes-commands.c
	* app/gui/channels-commands.c
	* app/gui/gradients-commands.c
	* app/gui/layers-commands.c
	* app/gui/palettes-commands.c
	* app/gui/paths-dialog.c
	* app/gui/patterns-commands.c: use the new function.

	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c: s/_("Reset")/GIMP_STOCK_RESET/

	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainerview.[ch]: moved the button_box utility
	functions from the container editor to GimpContainerView itself.

	* app/widgets/gimpbufferview.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpcomponentlistitem.c
	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimpdrawablelistview.[ch]
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplayerlistview.c: changed accordingly. Removed
	lots of duplicated code and use stock images instead of pixmaps.

	* libgimpwidgets/gimpfileselection.[ch]
	* libgimpwidgets/gimppatheditor.c: use stock images instead of
	pixmaps.

	* pixmaps/Makefile.am: removed "yes" and "no", added "stroke".

	* pixmaps/anchor.xpm
	* pixmaps/delete.xpm
	* pixmaps/lower.xpm
	* pixmaps/new.xpm
	* pixmaps/paste-as-new.xpm
	* pixmaps/paste-into.xpm
	* pixmaps/paste.xpm
	* pixmaps/raise.xpm
	* pixmaps/refresh.xpm
	* pixmaps/toselection.xpm: made them all 16x16 so they are scaled
	nicely in menus. Should probably be 18x18.
2001-08-04 20:38:54 +00:00
Michael Natterer
a824143b20 set style properties for dockables.
2001-08-03  Michael Natterer  <mitch@gimp.org>

	* gtkrc: set style properties for dockables.

	* app/main.c: some #if 0'ed code for mem profiling.

	* app/gui/commands.[ch]
	* app/gui/menus.c: added a mem profiling menu entry + callback.

	* app/gui/palette-editor.c: added a #warning as reminder, use
	gtk_dialog_set_has_separator().

	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainerview.[ch]
	* app/widgets/gimpdockable.[ch]
	* app/widgets/gimpdrawablelistview.[ch]: added some style
	properties to set GimpDockable and friends' borders and spacings.

	* libgimpwidgets/gimppixmap.[ch]
	* libgimpwidgets/gimpsizeentry.[ch]
	* libgimpwidgets/gimpunitmenu.[ch]: GObject stuff, cleanup.

	* app/docindex.c
	* app/errorconsole.c
	* app/gdisplay_color_ui.c
	* app/gimpprogress.c
	* app/module_db.c
	* app/undo_history.c
	* app/user_install.c
	* app/gui/channels-commands.c
	* app/gui/gradient-editor.c
	* app/gui/info-window.c
	* app/gui/tips-dialog.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpdatafactoryview.c
	* libgimp/gimpexport.c
	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c
	* plug-ins/[lots of files]:

	Some perl mass processing applying s/_("Foo")/GTK_STOCK_FOO/g,
	minor manual cleanup in some files.
2001-08-03 19:43:19 +00:00
Michael Natterer
2f5558236c s/#ifndef GDK_WINDOWING_WIN32/#ifdef GDK_WINDOWING_X11/
2001-08-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptexttool.c:
	s/#ifndef GDK_WINDOWING_WIN32/#ifdef GDK_WINDOWING_X11/
2001-08-03 10:13:41 +00:00
Sven Neumann
8590e01fb9 app/tools/gimpairbrushtool.c app/tools/gimpblendtool.c
2001-08-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimperasertool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/tools/transform_options.c: got rid of all remaining gtk_signal
	wrappers.
2001-08-01 02:57:58 +00:00
Sven Neumann
fc12bd9a52 defined GimpTransferMode enum.
2001-08-01  Sven Neumann  <sven@gimp.org>

	* app/core/core-types.h: defined GimpTransferMode enum.

	* app/tools/gimpcolorbalancetool.[ch]
	* app/tools/gimpdodgeburntool.[ch]: use it here instead of defining
	the same enum again. Some GObject porting.

	* app/tools/gimpsmudgetool.h: removed unused enum SmudgeMode.

	* app/pdb/color_cmds.c
	* app/pdb/tools_cmds.c
	* libgimp/gimpenums.h
	* libgimp/gimptools_pdb.[ch]
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/enums.pl
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/tools.pdb: changed accordingly (mostly generated)
2001-08-01 02:01:49 +00:00
Sven Neumann
b2c676bd74 added GTK_DISABLE_COMPAT_H back to CPPFLAGS.
2001-08-01  Sven Neumann  <sven@gimp.org>

	* configure.in: added GTK_DISABLE_COMPAT_H back to CPPFLAGS.

	* app/user_install.c
	* app/base/base.c
	* app/gui/info-window.c
	* app/gui/menus.c
	* app/gui/preferences-dialog.c
	* app/pdb/procedural_db_cmds.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdrawablelistview.c
	* app/widgets/gimpnavigationpreview.c
	* libgimpbase/gimpparasiteio.c
	* libgimpwidgets/gimpwidgets.c
	* plug-ins/FractalExplorer/Dialogs.c
	* plug-ins/common/animationplay.c
	* plug-ins/common/newsprint.c
	* plug-ins/common/uniteditor.c
	* plug-ins/dbbrowser/dbbrowser_utils.c
	* plug-ins/gap/gap_navigator_dialog.c
	* plug-ins/gdyntext/gdyntext_ui.c
	* plug-ins/helpbrowser/helpbrowser.c
	* plug-ins/ifscompose/ifscompose_storage.c
	* plug-ins/print/gimp_main_window.c
	* tools/gimp-remote.c
	* tools/pdbgen/pdb/procedural_db.pdb: replaced lots of deprecated
	glib, gdk and gtk+ functions using the new API.

	* app/paint-funcs/paint-funcs-rgb.c: removed trailing commas.
2001-08-01 00:35:59 +00:00
Michael Natterer
fda881c51d g_strdup (g_get_temp_dir ()), may fix an unseen crash.
2001-08-01  Michael Natterer  <mitch@gimp.org>

	* app/base/base.c: g_strdup (g_get_temp_dir ()), may fix an unseen
	crash.

	* libgimpwidgets/gimphelpui.[ch]: fixed the help stuff by using
	GtkWidget's new "show_help" signal, which is exactly what we did
	before, only without badly hacking around.
	Renamed gimp_help_connect_help_accel() to gimp_help_connect()
	because that's what it does.

	* app/devices.c
	* app/errorconsole.c
	* app/interface.c
	* app/gui/about-dialog.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradients-commands.c
	* app/gui/gui.c
	* app/gui/info-dialog.c
	* app/gui/palettes-commands.c
	* app/gui/paths-dialog.c
	* app/gui/select-commands.c
	* app/gui/tips-dialog.c
	* app/gui/toolbox.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpdatafactoryview.c
	* libgimpwidgets/gimpdialog.c
	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/common/CEL.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/gee.c
	* plug-ins/common/gee_zoom.c
	* plug-ins/common/gqbist.c
	* plug-ins/flame/flame.c
	* plug-ins/fp/fp_gtk.c
	* plug-ins/script-fu/script-fu-scripts.c: changed accordingly,
	GObject stuff, sprinkled some GTK_STOCK_FOOs, minor cleanups.
2001-07-31 23:28:56 +00:00
Michael Natterer
8d9931f719 code formating paranoia.
2001-07-29  Michael Natterer  <mitch@gimp.org>

	* app/gimphelp.c: code formating paranoia.

	* app/core/gimp.c: one more g_signal_connect().

	* app/tools/gimpmeasuretool.c: a gtk_widget_show() was optimized
	away :)

	* plug-ins/Makefile.am: re-enabled script-fu and dbbrowser.

	* plug-ins/dbbrowser/dbbrowser_utils.[ch]
	* plug-ins/script-fu/script-fu-console.[ch]
	* plug-ins/script-fu/script-fu-scripts.c
	* plug-ins/script-fu/script-fu-text-console.[ch]
	* plug-ins/script-fu/script-fu.c: use GtkTextBuffer/GtkTextView
	all over the place. GUI code cleanup in the dbbrowser and
	the script-fu console.
2001-07-30 00:46:09 +00:00
Hans Breuer
95a8c72405 updated for GTK2 build
2001-07-28  Hans Breuer  <hans@breuer.org>

	* */*/makefile.msc : updated for GTK2 build

	* app/widgets/makefile.msc : (new file) forgot this one last time

	* plug-ins/common/animationplay.c : reflect that GTK2 has its
	gdk<x|win32|fb>.h files in the back-end sub directories

	* plug-ins/common/gif.c :
	* plug-ins/common/jpeg.c :
	* plug-ins/dbbrowser/dbbrowser_utils.c :
	* plug-ins/gap/gap_dbbrowser_utils.c :
	* plug-ims/gimpressionist/presets.c :
	* plug-ims/gimpressionist/imap_setting.c :
	* plug-ims/gimpressionist/imap_source.c :
	* plug-ims/script-fu/script-fu-console.c :
	* plug-ims/script-fu/script-fu-scripts.c : #define GTK_ENABLE_BROKEN
	and include <gtk/gtktext.h> to make them compile/work again

	* plug-ins/common/spheredesigner.c : gtk_color_selction_set_opacity
	renamed to gtk_color_selction_set_current_alpha

	* plug-ins/gflare/gtkmultioptionmenu.c : ported ny removing the
	virtual draw function and style->xthickness and ythickness via
	direct access, klass field isn't available anymore

	* plug-ins/common/nlfilt.c :
	* plug-ims/gap/gap_movdialog.c :
	* plug-ims/gimpressionist/gimpressionist.c : gtk_widget_set_default_visible is
	neither available nor needed anymore

	* plug-ins/common/plugindetails.c : ported to GtkTextBuffer
	and reflect gtk_paned api changes

	* plug-ims/gimpressionist/imap_preview.c : replace GTK_WIDGET(a)->klass
	access by GTK_WIDGET_GET_CLASS(a)

	* plug-ims/gimpressionist/imap_selection.c :
	* plug-ims/gimpressionist/imap_toolbar.c :
	* plug-ims/gimpressionist/imap_tools.c : gtk_toolbar api changes
2001-07-28 19:40:07 +00:00
Michael Natterer
da88297a01 app/errorconsole.c use GtkTextView.
2001-07-27  Michael Natterer  <mitch@gimp.org>

	* app/errorconsole.c
	* app/user_install.c: use GtkTextView.

	* app/gui/preferences-dialog.c: use GtkTextView correctly :)

	* app/interface.c: a quick hack which enables setting the
	canvas padding color via gtkrc.

	* app/file-utils.c
	* app/plug_in.c
	* app/pdb/fileops_cmds.c
	* tools/pdbgen/pdb/fileops.pdb: s/g_basename/g_path_get_basename/

	* app/tools/gimpinktool.c
	* app/tools/gimppainttool.c: stupid /me disabled all paint tools
	by setting pressure to 0.0 instead of 1.0, fixed now.
2001-07-27 15:18:20 +00:00
Sven Neumann
98f9812ebb fixed typo.
2001-07-25  Sven Neumann  <sven@gimp.org>

	* app/devices.c: fixed typo.

	* app/gdisplay.c
	* app/undo_history.c
	* app/user_install.c
	* app/gui/about-dialog.c
	* app/gui/color-area.c
	* app/gui/gradient-editor.c
	* app/gui/gui.c
	* app/gui/paths-dialog.c
	* app/gui/splash.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpinktool.c
	* app/tools/gimptexttool.c:
	s/gdk_[bit|pix]map_unref/gdk_drawable_unref/

	* app/xcf/xcf-load.c: use GObject functions

	* plug-ins/common/animationplay.c: include GDK backend specific
	headers
2001-07-25 13:21:57 +00:00
Sven Neumann
f5cfbd50da app/nav_window.c app/user_install.c app/pdb/color_cmds.c
2001-07-25  Sven Neumann  <sven@gimp.org>

	* app/nav_window.c
	* app/user_install.c
	* app/pdb/color_cmds.c
	* app/pdb/selection_cmds.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpdrawtool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptool.c
	* app/tools/paint_options.c
	* app/tools/selection_options.c
	* app/tools/tool_manager.c
	* app/tools/transform_options.c
	* app/widgets/gimpdnd.c
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/selection.pdb: use GObject functions.
2001-07-25 00:27:41 +00:00
Michael Natterer
06b16890ba Port to glib/gtk+ 2.0 episode I (every segfault has it's beginning)
2001-07-24  Michael Natterer  <mitch@gimp.org>

	Port to glib/gtk+ 2.0 episode I (every segfault has it's beginning)

	* configure.in: require glib/gtk+ >= 1.3.7, commented out the
	gtkxmhtml stuff.

	From now on, you will need glib, pango, atk and gtk+ HEAD from CVS
	to hack or use GIMP HEAD.

	Beware, it crashes randomly :)

	* app/core/Makefile.am
	* app/core/gimpmarshal.list: new file plus rules to generate
	gimpmarshal.[ch] from it.

	* app/core/*
	* app/tools/*
	* app/widgets/*
	* libgimpwidgets/*: started to use the glib object system. All
	core/ objects are still gtk objects however. All signals are
	created using g_signal_new(). There are many gtk+ artefacts left.
	Finally, we will _not_ use the gtk_signal_foo() wrappers and
	friends any more.

	* app/colormaps.c
	* app/devices.[ch]
	* app/disp_callbacks.c
	* app/errorconsole.c
	* app/file-save.[ch]
	* app/interface.c
	* app/module_db.c
	* app/nav_window.c
	* app/ops_buttons.c
	* app/scroll.c
	* app/user_install.c
	* app/gui/about-dialog.c
	* app/gui/brush-editor.c
	* app/gui/brushes-commands.c
	* app/gui/color-notebook.c
	* app/gui/colormap-dialog.c
	* app/gui/dialogs-commands.c
	* app/gui/dialogs-constructors.c
	* app/gui/file-commands.c
	* app/gui/file-dialog-utils.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/gradients-commands.c
	* app/gui/image-commands.c
	* app/gui/info-dialog.[ch]
	* app/gui/layer-select.c
	* app/gui/layers-commands.c
	* app/gui/menus.c
	* app/gui/offset-dialog.c
	* app/gui/palette-editor.c
	* app/gui/palettes-commands.c
	* app/gui/patterns-commands.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.[ch]
	* app/gui/splash.c
	* app/gui/tips-dialog.c
	* app/gui/tool-options-dialog.c
	* app/gui/toolbox.c
	* app/gui/tools-commands.c
	* libgimp/gimpbrushmenu.c
	* libgimp/gimpmenu.c
	* libgimp/gimppatternmenu.c
	* libgimp/gimpui.c
	* libgimpbase/gimpenv.c: tons and tons of changes like "const
	gchar*", switch from GdkDeviceInfo to GdkDevice (very incomplete
	and currently disables), lots of s/gtk_signal/g_signal/,
	removal/replacement of deprecated stuff,
	s/GtkSignalFunc/GCallback/ and lots of small changes and fixes
	while I was on it, zillions of warnings left...

	* modules/Makefile.am: disabled the water color selector
	temporarily (XInput issues).

	* plug-ins/Makefile.am
	* plug-ins/common/.cvsignore
	* plug-ins/common/Makefile.am
	* plug-ins/common/plugin-defs.pl: simply excluded all plug-ins
	which did not build (including Script-Fu). They are trivial to
	fix.
2001-07-24 21:27:11 +00:00
Hans Breuer
f1199d33b7 more new files
2001-07-22  Hans Breuer  <hans@breuer.org>

	* app/tools/makefile.msc :
	* app/pdb/makefile.msc : more new files
2001-07-22 22:21:28 +00:00
Michael Natterer
b844c98549 removed path_to_beziersel() so this file can be safely included from
2001-07-17  Michael Natterer  <mitch@gimp.org>

	* app/path.[ch]: removed path_to_beziersel() so this file can be
	safely included from core/.

	* app/tools/gimpbezierselecttool.[ch]: added it here.

	* app/core/core-types.h: added a GimpToolOptions typedef. Removes
	deps into tools/ and will later be a core object anyway.

	* app/tools/tools-types.h: removed the ToolOptions typedef here.

	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage.c
	* app/core/gimptoolinfo.[ch]: removed deps into tools/, misc stuff.

	* app/tools/tool_manager.[ch]: some ugly temp hacks. Please ignore.

	* app/widgets/gimpdialogfactory.[ch]: added a "remember_if_open" field
	to the GimpDialogFactoryEntry so we can manage dialogs which should
	not be re-opened on startup.

	* app/gui/dialogs-constructors.c
	* app/gui/dialogs.c: register & create all editor dialog with the
	"global_dialog_factory".

	* app/gui/tool-options-dialog.c
	* app/tools/*: s/ToolOptions/GimpToolOptions/
2001-07-17 20:50:01 +00:00
Michael Natterer
9d87e554de removed the gimp_busy boolean, check whether user_installation is needed
2001-07-10  Michael Natterer  <mitch@gimp.org>

	* app/app_procs.[ch]: removed the gimp_busy boolean, check whether
	user_installation is needed here, not in user_install.c, parse
	gtkrc an friends only if(!no_interface), create the Gimp object
	before parsing gimp's rc files an pas it to the parse functions,
	many other cleanups.

	* app/appenums.h: added MessageHandlerType and StackTraceMode.

	* app/appenv.h: removed MessageHandlerType, declare all global
	variables from main.c (no more hidden global stuff please).

	* app/errors.[ch]: added the fatal message func here (from main.c),
	removed the StackTraceMode enum.

	* app/gimprc.[ch]: renamed functions to gimprc_*(), pass a Gimp
	pointer to some functions.

	* app/gimpunit.c
	* app/unitrc.h: ok, this is ugly: renamed all functions to
	_gimp_unit_*() and made them public. The unit list is part
	of the Gimp object now, so pass a Gimp* to all functions.

	* app/libgimp_glue.[ch]: added EEKy wrappers for all gimp_unit_*()
	functions which are used by widgets.

	* app/main.c: cleaned up the global variables, removed the fatal
	message handler, call app_init() directly, not via the
	user_install stuff, misc. cleanups.

	* app/user_install.[ch]: removed the check if user_installation is
	needed (done by app_procs.c now).

	* app/core/gimp.[ch]: added the user_unit list and the "busy"
	boolean. Moved gimp_[set|unset]_busy() here. Added
	gimp_initialize() which is called after unitrc and gimprc are
	parsed.

	* app/batch.c
	* app/colormaps.c
	* app/devices.c
	* app/disp_callbacks.c
	* app/gdisplay_ops.c
	* app/gimphelp.c
	* app/module_db.c
	* app/nav_window.c
	* app/plug_in.c
	* app/core/gimpcontext.c
	* app/core/gimpdatafiles.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage.c
	* app/core/gimpparasite.c
	* app/core/gimpparasitelist.h
	* app/gui/file-open-dialog.c
	* app/gui/gui.[ch]
	* app/gui/info-dialog.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/gui/session.c
	* app/gui/tips-dialog.c
	* app/gui/toolbox.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimptransformtool.c
	* app/tools/tool_manager.c
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpcursor.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* app/xcf/xcf.c
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/app.pl
	* tools/pdbgen/enums.pl
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/message.pdb
	* tools/pdbgen/pdb/unit.pdb
	* app/pdb/image_cmds.c
	* app/pdb/message_cmds.c
	* app/pdb/unit_cmds.c: changed accordingly, minor cleanups.
2001-07-10 19:16:16 +00:00
Michael Natterer
37ce6b9ac8 app/Makefile.am removed.
2001-07-08  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/drawable.[ch]: removed.

	* app/core/gimpdrawable.[ch]: added the functions here. Made an
	end to the myth that FG/BG and the undo system (!!!) are not
	really part of the core.

	* app/disp_callbacks.c
	* app/floating_sel.c
	* app/image_map.c
	* app/qmask.c
	* app/undo.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-desaturate.c
	* app/core/gimpdrawable-equalize.c
	* app/core/gimpdrawable-invert.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpedit.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage.[ch]
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/gui/channels-commands.c
	* app/gui/gui.c
	* app/gui/layers-commands.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c
	* app/tools/tool_manager.c
	* app/widgets/gimpchannellistitem.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpdrawablelistitem.c
	* app/widgets/gimplayerlistitem.c
	* app/widgets/gimplayerlistview.c
	* app/pdb/channel_cmds.c
	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/edit_cmds.c
	* app/pdb/floating_sel_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/parasite_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/text_tool_cmds.c
	* app/pdb/tools_cmds.c
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/drawable.pdb: changed accordingly. Misc small
	fixes and cleanups.
2001-07-07 22:49:01 +00:00
Michael Natterer
3196563c14 app/Makefile.am removed.
2001-07-07  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimage.[ch]: removed.

	* app/core/gimp.c: s/gimage_new/gimp_image_new/

	* app/gui/gui.c
	* app/tools/tool_manager.c: added the handlers from gimage.c
2001-07-07 18:16:18 +00:00
Michael Natterer
b70ee4b76d put all tool_manager variables into a struct which is attached to a
2001-07-07  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.[ch]: put all tool_manager variables into
	a struct which is attached to a "Gimp". Pass a Gimp* to all
	tool_manager functions.

	* app/disp_callbacks.c
	* app/gdisplay.c
	* app/gimage.c
	* app/scale.c
	* app/scroll.c
	* app/undo.c
	* app/gui/convert-dialog.c
	* app/gui/edit-commands.c
	* app/gui/tool-options-dialog.c
	* app/gui/tools-commands.c: changed accordingly.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptool.c
	* app/tools/gimptransformtool.c: mostly bad hacks for tool dialogs
	which exist without a real context. Needs some more review.
2001-07-07 17:36:00 +00:00
Michael Natterer
5693956664 app/core/Makefile.am new files for gimp_image_crop() and
2001-07-07  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/gimpimage-crop.[ch]: new files for gimp_image_crop()
	and gimp_image_crop_auto_shrink() (should share large portions of
	code with gimp_image_resize()).

	* app/tools/gimpcroptool.[ch]: removed here.

	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/tools.pdb: gimp_crop --> gimp_image_crop

	* app/pdb/image_cmds.c
	* app/pdb/internal_procs.c
	* app/pdb/tools_cmds.c
	* libgimp/gimpimage_pdb.[ch]
	* libgimp/gimptools_pdb.[ch]: regenerated.

	* plug-ins/common/autocrop.c
	* plug-ins/common/gif.c
	* plug-ins/common/guillotine.c
	* plug-ins/common/zealouscrop.c
	* plug-ins/perl/examples/image_tile
	* plug-ins/script-fu/scripts/add-bevel.scm
	* plug-ins/script-fu/scripts/ripply-anim.scm
	* plug-ins/script-fu/scripts/slide.scm: changed accordingly. Some
	cleanups in the plug-ins.
2001-07-07 14:53:42 +00:00
Michael Natterer
1bcd3e1834 app/Makefile.am removed.
2001-07-07  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/context_manager.[ch]: removed.

	* app/app_procs.c: call tool_mananger instead of context_manager
	functions, pass "the_gimp" to some more functions.

	* app/drawable.[ch]: pass a GimpContext to drawable_fill().

	* app/errors.c: behave according to "stack_trace_mode" when using
	the debugging signal handler.

	* app/gimprc.[ch]: removed the core/ config variables.

	* app/selection.c: set the selection's state to INVISIBLE in
	selection_pause().

	* app/core/Makefile.am
	* app/core/gimpcoreconfig.[ch]: new files (the configuration
	variables used by core/).

	* app/core/gimpcontext.[ch]: removed the global contexts (user,
	default, ...) and their functions. It's no longer possible to pass
	NULL to the context functions to manipulate the current context
	(gimpcontext.c doesn't know the current context any more).

	* app/core/gimp.[ch]: added them here. The functions are now called
	gimp_[set|get]_*_context(). Added gimp_create_context() which is
	the only function to create contexts now.

	* app/gui/dialogs.[ch]
	* app/gui/gui.[ch]: pass "gimp" to all functions.

	* app/tools/tool_manager.[ch]
	* app/tools/tools.[ch]: pass "gimp" to lots of functions. Added
	the "global_tool_context" logic and the global/non-global paint
	options switching from the context_manager. Pass "gimp" to all
	tools' "register" functions.

	* app/tools/*: changed accordingly.

	* app/devices.c
	* app/disp_callbacks.c
	* app/file-open.[ch]
	* app/file-save.c
	* app/gdisplay.c
	* app/gimage.c
	* app/libgimp_glue.c
	* app/module_db.c
	* app/nav_window.c
	* app/plug_in.c
	* app/qmask.c
	* app/undo.c
	* app/base/base-config.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpgradient.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimpimage-new.c
	* app/core/gimpimage.c
	* app/core/gimppalette.c
	* app/core/gimptoolinfo.[ch]
	* app/core/gimpundo.c
	* app/gui/brush-select.c
	* app/gui/channels-commands.c
	* app/gui/color-area.c
	* app/gui/dialogs-constructors.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/gradient-select.c
	* app/gui/info-window.c
	* app/gui/layers-commands.c
	* app/gui/menus.c
	* app/gui/palette-editor.c
	* app/gui/palette-import-dialog.c
	* app/gui/palette-select.c
	* app/gui/paths-dialog.c
	* app/gui/pattern-select.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/gui/test-commands.c
	* app/gui/tool-options-dialog.c
	* app/gui/toolbox.c
	* app/gui/tools-commands.c
	* app/xcf/xcf-load.c
	* app/xcf/xcf-save.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdrawablelistview.[ch]
	* app/widgets/gimpimagedock.c
	* app/widgets/gimplayerlistview.c
	* app/pdb/brushes_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/gradients_cmds.c
	* app/pdb/palette_cmds.c
	* app/pdb/patterns_cmds.c
	* app/pdb/procedural_db.c
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/palette.pdb
	* tools/pdbgen/pdb/patterns.pdb: changed accordingly: remove usage
	of gimp_context_[get|set]_*(NULL), create contexts with
	gimp_create_context(). Get the user/current context with
	gimp_get_[user|current]_context(). Added/removed access to the
	global "the_gimp" variable in some places. Get the core's config
	variables from "core_config".
2001-07-07 12:17:23 +00:00
Michael Natterer
0164596064 app/core/Makefile.am app/core/core-types.h added an "application object"
2001-07-04  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimp.[ch]: added an "application object" called Gimp.

	Currently, it contains the image list, the clipboard, the data
	factories, the procedural hashtable and the tool info list.  It's
	the toplevel object of the core object system. Finally, creating a
	Gimp object will return a standalone gimp core engine instance
	with no other global states/variables involved.

	* app/app_procs.[ch]: allocate a "Gimp" instance called "the_gimp" :)
	Removed stuff which is now done by the "Gimp" object. Merged
	gimp_init() into app_init() because gimp_init() is taken now.

	* app/context_manager.[ch]: removed stuff done by "Gimp".

	* app/batch.[ch]
	* app/gimage.[ch]
	* app/xcf/xcf-load.[ch]
	* app/xcf/xcf.[ch]
	* app/core/gimpedit.[ch]
	* app/tools/tool_manager.[ch]: pass around an additional "Gimp"
	argument.

	* app/pdb/procedural_db.[ch]: pass a "Gimp" pointer as first
	parameter to all internal procedures and to all procedural_db_*
	functions.

	* app/core/gimpcontext.[ch]
	* app/core/gimpimage.[ch]: added a "Gimp" pointer to the structs.

	* app/devices.c
	* app/errors.c
	* app/file-open.c
	* app/file-save.c
	* app/gimphelp.c
	* app/gimpunit.c
	* app/image_new.c
	* app/main.c
	* app/nav_window.c
	* app/plug_in.c
	* app/base/base.c
	* app/core/gimpdatafactory.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-mask.c
	* app/core/gimptoolinfo.[ch]
	* app/gui/brush-select.c
	* app/gui/convert-dialog.c
	* app/gui/dialogs-constructors.c
	* app/gui/edit-commands.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/gradient-select.c
	* app/gui/gui.c
	* app/gui/image-commands.c
	* app/gui/info-window.c
	* app/gui/menus.c
	* app/gui/palette-editor.c
	* app/gui/palette-import-dialog.c
	* app/gui/palette-select.c
	* app/gui/paths-dialog.c
	* app/gui/pattern-select.c
	* app/gui/preferences-dialog.c
	* app/gui/test-commands.c
	* app/gui/toolbox.c
	* app/gui/tools-commands.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimppainttool.h
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.h
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpcontainerview-utils.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpimagedock.c: changed accordingly. Cleaned up
	lots of includes. Many files still access the global "the_gimp"
	variable exported by app_procs.h.

	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/palette.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/patterns.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed accordingly. Don't
	use "the_gimp" here because all procedures get passed a "Gimp"
	pointer now.

	* app/pdb/*: regenerated.
2001-07-04 19:31:35 +00:00
Michael Natterer
d26c26686e app/Makefile.am removed.
2001-06-26  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/color_transfer.[ch]: removed.

	* app/tools/Makefile.am
	* app/tools/gimpcolorbalancetool-transfer.[ch]: added.

	* app/tools/gimpcolorbalancetool.c: changed accordingly.

	* app/base/Makefile.am
	* app/base/tile-manager-crop.[ch]: formerly known as crop_buffer().

	* app/tools/gimptexttool.c: changed accordingly.

	* app/context_manager.[ch]: added the global clipboard and the
	named buffer list here.

	* app/app_procs.c: don't call color_transfer_init() and don't free
	the buffer stuff (done by the context manager now).

	* app/errorconsole.c: don't #include "gui/commands.h"

	* app/global_edit.[ch]: removed lots of stuff which is now done by
	gui/edit-commands.* or the new GimpBuffer object. The "paste
	named" dialog will go away and this file will be moved to core/
	soon.

	* app/image_new.c: no need to declare the global_buffer extern any
	more.

	* app/qmask.c: don't #include "global_edit.h"

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpbuffer.[ch]: new object (aka named buffer)

	* app/core/gimpcontext.[ch]: added a GimpBuffer attribute.

	* app/core/gimpimage.[ch]: one s/int/gboolean/.

	* app/core/gimppattern.c: hmm...

	* app/gui/commands.[ch]: split up in small files:

	* app/gui/Makefile.am
	* app/gui/edit-commands.[ch]
	* app/gui/file-commands.[ch]
	* app/gui/image-commands.[ch]
	* app/gui/select-commands.[ch]
	* app/gui/view-commands.[ch]: new files.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: added the named buffer list & grid.

	* app/gui/file-new-dialog.[ch]
	* app/gui/menus.c
	* app/gui/palette-editor.c
	* app/gui/test-commands.c: changed accordingly.

	* app/pdb/edit_cmds.c
	* tools/pdbgen/pdb/edit.pdb: changed for the global_edit stuff.

	* app/widgets/Makefile.am
	* app/widgets/gimpbufferpreview.[ch]
	* app/widgets/gimpbufferview.[ch]
	* app/widgets/gimpcontainereditor.[ch]: new widgets.

	* app/widgets/gimpcontainerview-utils.c
	* app/widgets/gimpdatafactoryview.[ch]
	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpdrawablepreview.c
	* app/widgets/gimplayerlistview.c
	* app/widgets/gimppreview.c
	* app/widgets/widgets-types.h: changed accordingly for the new
	GimpBuffer object and it's views, misc. cleanups.

	* pixmaps/Makefile.am
	* pixmaps/paste-as-new.xpm
	* pixmaps/paste-into.xpm
	* pixmaps/paste.xpm: new pixmaps (they all look the same... Tigert? ;-)

	* po/POTFILES.in: added the new files.
2001-06-26 12:09:43 +00:00
Michael Natterer
3ef20cd842 major cleanup. After being finished, I decided that it needs to be
2001-06-18  Michael Natterer  <mitch@gimp.org>

	* app/nav_window.[ch]: major cleanup. After being finished, I
	decided that it needs to be factored out to a widget (see below),
	so like 90% of this file will go away soon.

	* app/apptypes.h: added opaque NavigationDialog typedef.

	* app/gdisplay.[ch]: Added gdisplay_selection_visibility() which
	is called from gdisplays_selection_visibility(). Capitalized the
	SelectionControl enum values. Cleaned up the GDisplay struct and
	it's initialisation while i was on it.

	* app/gimage.c: gimage_size_changed_handler(): removed stuff which
	is now done by GimpImage itself.

	* app/scale.c
	* app/scroll.c: also update the navigation popup, not only the
	dialog.

	* app/selection.[ch]: major indentation & cleanup attack. Maybe
	found the "Selection vanishes" bug (the timeout id was assinged to
	a gint, not a _guint_).

	* app/undo.c: s/gimp_image_size_changed/gimp_viweable_size_changed/

	* app/core/gimpdrawable.c: invalidate the image's preview from our
	"invalidate_preview" implementation. This means that the image's
	preview is invalidated way too often currently, which cries for
	some general freeze/thaw mechanism on the GimpViewable level.
	(Note that previews are rendered in the idle loop, so this is not
	really a major performance impact, it's just ugly).

	* app/core/gimpimage.[ch]: removed the "size_changed" signal...

	* app/core/gimpviewable.[ch]: ...and added it here.

	* app/core/gimplayer.c: invalidate_preview(): always chain up,
	also if it's a floating selection.

	* app/gui/info-dialog.[ch]
	* app/gui/info-window.c: minor cleanups.

	* app/gui/preferences-dialog.c: no need to invalidate the image
	after we have invalidated all it's layers.

	* app/core/gimpimage-mask.c
	* app/gui/commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c: capitalized the SelectionCommand enum
	values.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpnavigationpreview.[ch]: new widget.

	* app/widgets/gimppreview.[ch]: added a non-working
	non-dot-for-dot mode. Added xres/yres params to the
	gimp_preview_calc_size() helper function.

	Cache the "size" value which was passed to the simple function
	variants (gimp_preview_new() and gimp_preview_set_size()) so we
	can re-calculate the preview's extents on the underlying
	viewable's "size_changed" signal and on gimp_preview_set_viewable().

	* app/widgets/gimpdrawablepreview.c
	* app/widgets/gimpimagepreview.c: changed accordingly.
2001-06-18 13:10:03 +00:00
Sven Neumann
1564c5fd83 fixed typo, closes bug #56200.
2001-06-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmeasuretool.c: fixed typo, closes bug #56200.
2001-06-14 16:28:06 +00:00
Michael Natterer
69491ddc34 added zh_TW.Big5 to ALL_LINGUAS. Added the STRIP_BEGIN and STRIP_END
2001-06-07  Michael Natterer  <mitch@gimp.org>

	* configure.in: added zh_TW.Big5 to ALL_LINGUAS. Added the
	STRIP_BEGIN and STRIP_END macros from gtk+.

	* app/base/makefile.msc: unmodified copy of app/core/makefile.msc
	(just to make "make dist" work).

	* */Makefile.am: use @STRIP_BEGIN@ and @STRIP_END@ all over the
	place. The Makefiles are a bit uglier now but it makes compiling
	output much more readable.
2001-06-07 17:20:50 +00:00
Michael Natterer
3b5ad3aba1 app/Makefile.am app/base/Makefile.am app/core/Makefile.am
2001-06-05  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/gui/Makefile.am
	* app/paint-funcs/Makefile.am
	* app/pdb/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am: no need to build .la objects for
	convenience libraries which are never linked into another dynamic
	library. Create simple .a files instead. Reduces compilation time
	of app/ by about 50%.
2001-06-05 16:14:47 +00:00
Michael Natterer
80dad0fcfa some s/0/FALSE/
2001-06-05  Michael Natterer  <mitch@gimp.org>

	* app/global_edit.c: some s/0/FALSE/

	* app/resize.[ch]: removed resize_scale_implement() and
	resize_check_layer_scaling(), cleanup.

	* app/core/gimpimage.[ch]: added gimp_image_check_scaling().

	* app/gui/commands.c: added image_scale_implement() as static
	function.

	* app/gui/tool-options-dialog.[ch]: add the tool options widgets
	to the dialog when they are first needed. Removed
	tool_options_dialog_add().

	* app/tools/tool_manager.c: don't call tool_options_dialog_add().
2001-06-04 23:11:31 +00:00
Dave Neary
8a4d5f08b1 Made all the global options members of one struct, gimprc.
2001-06-03  Dave Neary  <dneary@eircom.net>

	* app/gimprc.[ch]: Made all the global options members of one
	struct, gimprc.

	* lots of .c files in app, app/core, app/tools, app/widgets &
	app/gui: Changed accordingly.
2001-06-03 20:40:50 +00:00
Dave Neary
e153dd1b6a added a call to by_color_select_close_callback() in _tool_destroy() to
2001-06-01  Dave Neary  <dneary@eircom.net>

	* app/tools/gimpbycolorselecttool.c: added a call to
        by_color_select_close_callback() in _tool_destroy() to close
        the dialog on exiting the tool.
2001-06-01 13:45:30 +00:00
Dave Neary
109abaeed4 app/core/gimpimage.[ch] app/core/gimpimage-mask.c
2001-05-31  Dave Neary  <dneary@eircom.net>

	* app/core/gimpimage.[ch]
	* app/core/gimpimage-mask.c
	* app/tools/gimpbycolorselecttool.c
	* app/undo.c: Added a "mask_changed" signal, to allow
	gimpbycolorselect to update it's dialog properly, and take out a
	silly dependency in gimpimage.

	One outstanding issue is that now the dialog doesn't close
	automatically when the tool context changes. Working on it :)
2001-05-31 19:53:13 +00:00
Michael Natterer
ca6ee05ea3 app/Makefile.am removed.
2001-05-25  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/scan_convert.[ch]: removed.

	* app/core/Makefile.am
	* app/core/gimpscanconvert.[ch]: added. Changed all function names
	and use GimpVector2 instead of ScanConvertPoint.

	* app/base/base-types.h: removed ScanConvertPoint (didn't belong
	here anyway).

	* app/pdb/tools_cmds.c
	* app/tools/gimpfreeselecttool.[ch]
	* app/tools/gimpiscissorstool.c
	* tools/pdbgen/pdb/tools.pdb: changed accordingly.
2001-05-25 18:10:38 +00:00
Michael Natterer
746fc51973 app/Makefile.am removed.
2001-05-25  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimpui.[ch]: removed.

	* app/tools/paint_options.[ch]: removed paint_mode_menu_new().

	* app/widgets/Makefile.am
	* app/widgets/gimpwidgets-constructors.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: added here.

	* app/disp_callbacks.c
	* app/errors.c
	* app/gimphelp.c
	* app/interface.c
	* app/gui/brush-select.c
	* app/gui/channels-commands.c
	* app/gui/commands.c
	* app/gui/file-dialog-utils.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/layers-commands.c
	* app/gui/tool-options-dialog.c
	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphistogramtool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpthresholdtool.c
	* app/tools/gimptransformtool.c
	* app/tools/tool_manager.c
	* app/widgets/gimplayerlistview.c: changed accordingly.
2001-05-25 16:04:54 +00:00
Michael Natterer
3be8f5b5f2 app/tools/Makefile.am removed. new file
2001-05-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tool_options_dialog.[ch]: removed.
	* app/tools/tools.h: new file

	* app/gui/Makefile.am
	* app/gui/tool-options-dialog.[ch]: added.

	* app/tools/tools.c: renamed register_tools() to tools_init(), new
	function tools_exit().

	* app/app_procs.c
	* app/context_manager.c
	* app/tools/tool_manager.c
	* app/gui/dialogs-constructors.c
	* app/gui/gui.c: changed accordingly.
2001-05-25 01:24:12 +00:00
Michael Natterer
170a9cbcab All tools are back :)
2001-05-25  Michael Natterer  <mitch@gimp.org>

	All tools are back :)

	* app/tools/Makefile.am
	* app/tools/brightness_contrast.[ch]
	* app/tools/color_balance.[ch]
	* app/tools/curves.[ch]
	* app/tools/histogram_tool.[ch]
	* app/tools/hue_saturation.[ch]
	* app/tools/levels.[ch]
	* app/tools/posterize.[ch]
	* app/tools/threshold.[ch]: removed...

	* app/tools/gimpbrightnesscontrasttool.[ch]
	* app/tools/gimpcolorbalancetool.[ch]
	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimphistogramtool.[ch]
	* app/tools/gimphuesaturationtool.[ch]
	* app/tools/gimplevelstool.[ch]
	* app/tools/gimpposterizetool.[ch]
	* app/tools/gimpthresholdtool.[ch]: ...and ported to the new tool
	system. Yes, the toolbox looks strange right now.

	* app/tools/gimpimagemaptool.[ch]: base class for all image_map
	tools. Does nothing at all right now.

	* app/tools/gimpbucketfilltool.h: removed _new() function
	declaration.

	* app/tools/gimptool.c: removed obsolete stuff and STUB()s.

	* app/tools/tools.c: register the new tools.

	* app/menus.c: removed the #if 0 around the code which reorders
	the color tool menu entries.

	* app/app_procs.c
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/enums.pl
	* tools/pdbgen/pdb/color.pdb
	* app/pdb/color_cmds.c
	* po/POTFILES.in: changed accordingly.
2001-05-24 23:57:08 +00:00
Michael Natterer
6a5242c0bf config.guess new versions from CVS (at least that's what my debian package
2001-05-24  Michael Natterer  <mitch@gimp.org>

	* config.guess
	* config.sub: new versions from CVS (at least that's what my
	debian package says...)

	* app/Makefile.am
	* app/gimppreviewcache.[ch]: removed.

	* app/core/Makefile.am
	* app/core/gimppreviewcache.c: added.

	* app/core/gimpdrawable.c: reordered #includes

	* app/apptypes.h: make ImageMap a proper opaque typedef, not
	simply a gpointer.

	* app/image_map.[ch]: changed accordingly. cleanup.

	* app/tools/color_balance.h
	* app/tools/curves.h
	* app/tools/gimptool.c
	* app/tools/histogram_tool.h
	* app/tools/hue_saturation.h
	* app/tools/threshold.h: changed here too.

	* libgimpbase/gimpbasetypes.h: /*< skip >*/ GIMP_UNIT_PERCENT as
	it's a UI convenience thing and no unit.

	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.

	* libgimpwidgets/gimpbutton.c: maybe this change makes GimpButton
	behave even more careful when changing GtkButton's private stuff.
2001-05-24 17:09:57 +00:00
Michael Natterer
dd4b03ec29 app/app_procs.c app/datafiles.c app/devices.c app/docindex.c
2001-05-21  Michael Natterer  <mitch@gimp.org>

	* app/app_procs.c
	* app/datafiles.c
	* app/devices.c
	* app/docindex.c
	* app/gdisplay_color.c
	* app/gdisplay_color_ui.c
	* app/gimphelp.c
	* app/main.c
	* app/module_db.c
	* app/plug_in.c
	* app/resize.c
	* app/resolution_calibrate.c
	* app/undo_history.c
	* app/user_install.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpdata.c
	* app/core/gimpgradient.c
	* app/core/gimppalette.c
	* app/gui/about-dialog.c
	* app/gui/file-new-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/layers-commands.c
	* app/gui/menus.c
	* app/gui/palette-editor.c
	* app/gui/session.c
	* app/gui/splash.c
	* app/gui/tips-dialog.c
	* app/pdb/image_cmds.c
	* app/pdb/text_tool_cmds.c
	* app/tools/curves.c
	* app/tools/gimptexttool.c
	* app/tools/levels.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimppreview.c
	* libgimp/gimpcolordisplay.h
	* libgimpbase/gimpbase.h
	* libgimpwidgets/gimpcolorarea.c
	* libgimpwidgets/libgimp-glue.c
	* plug-ins/common/gih.c
	* plug-ins/common/psp.c
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/text_tool.pdb: last checkin didn't get all
	#include "libgimp/i_dont_exist_any_more.h". This one should make
	it compile again without old crap hanging around in <prefix>/include.
2001-05-21 20:30:16 +00:00
Michael Natterer
7d1375e949 Makefile.am configure.in added new directory libgimpbase/
2001-05-21  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* configure.in
	* gimptool-1.4.in: added new directory libgimpbase/

	* app/Makefile.am: link against the new lib.

	* app/appenums.h: removed the PDB enums which are in
	libgimpbase/gimpbasetypes.h now. They are all "Gimp" prefixed.

	* app/apptypes.h: #include "libgimpbase/gimpbasetypes.h"

	* app/[lots]
	* app/core/[of]
	* app/gui/[files]
	* app/tools/: changed includes and all PDB types.

	* app/pdb/*: regenerated.

	* libgimp/Makefile.am: don't build libgimpi.a uglyness any more.

	* libgimp/gimpenv.[ch]
	* libgimp/gimplimits.[hh]
	* libgimp/gimpparasite.[ch]
	* libgimp/gimpparasiteio.[ch]
	* libgimp/gimpprotocol.[ch]
	* libgimp/gimpsignal.[ch]
	* libgimp/gimpunit.h
	* libgimp/gimputils.[ch]
	* libgimp/gimpwire.[ch]: removed...

	* libgimpbase/*: ...and added here as new library.

	* libgimp/gimp.[ch]
	* libgimp/gimpdrawable.[ch]
	* libgimp/gimpenums.h
	* libgimp/gimpimage.[ch]
	* libgimp/gimptile.c
	* libgimp/gimptypes.h
	* libgimp/gimpunit.c: changed accordingly. Added the
	gimp_*_add_new_parasite to gimp.[ch], gimpdrawable.[ch] and
	gimpimage.[ch].

	* libgimpwidgets/gimppatheditor.c
	* libgimpwidgets/gimpquerybox.c
	* libgimpwidgets/gimpsizeentry.c
	* libgimpwidgets/gimpunitmenu.c
	* libgimpwidgets/gimpwidgets.c
	* libgimpwidgets/gimpwidgetstypes.h: changed includes accordingly.

	* plug-ins/*/Makefile.am
	* plug-ins/common/mkgen.pl: link against libgimpbase.

	* tools/pdbgen/Makefile.am: scan libgimpbase/gimpbasetypes.h, so
	the enums are known to pdbgen...

	* tools/pdbgen/enumcode.pl: ...but don't write them out to
	libgimp/gimpenums.h

	* tools/pdbgen/app.pl: include libgimp/gimpbase.h in all *_cmds.c
	files. Added GIMP_ to the type names ganerated in app/.

	* tools/pdbgen/enums.pl: regenerated.

	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/procedural_db.pdb
	* tools/pdbgen/pdb/unit.pdb: changed includes.
2001-05-21 13:58:46 +00:00
Michael Natterer
a6cce18427 app/Makefile.am put the regex and MMX sources to EXTRA_DIST so they get
2001-05-20  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* plug-ins/script-fu/Makefile.am: put the regex and MMX sources to
	EXTRA_DIST so they get distributed unconditionally.

	* tools/pdbgen/pdb/layer.pdb: re-enabled the layer_mask procs but
	let them use accessors (which don't exist)...

	* app/pdb/pdb_glue.h: ... #define the accessors as macros here.

	Yes, this is ugly, but I simply don't fully understand pdbgen
	yoshcode.

	* app/pdb/internal_procs.c
	* app/pdb/layer_cmds.c
	* libgimp/gimplayer_pdb.[ch]: regenerated with the layer_mask
	accessors.

	* app/tools/Makefile.am: add the files which are not built to
	EXTRA_DIST.

	* pixmaps/Makefile.am
	* pixmaps/channel.xbm
	* pixmaps/eye.xbm
	* pixmaps/layer.xbm
	* pixmaps/linked.xbm
	* pixmaps/mask.xbm: removed.

	* plug-ins/Makefile.am: build XJT again because the layer_mask
	stuff is back. Perl also seems to build again.

	* plug-ins/common/aa.c: explicit casting fixes some warnings.

	* plug-ins/script-fu/interp_regex.c: #include "config.h".
2001-05-20 14:15:09 +00:00
Michael Natterer
7dacaa1ddb removed search_in_path() and the unused xstrsep().
2001-05-16  Michael Natterer  <mitch@gimp.org>

	* app/general.[ch]: removed search_in_path() and the unused
	xstrsep().

	* app/plug_in.c: added plug_in_search_in_path(), don't include
	"general.h".

	* app/gimprc.c
	* app/image_render.c
	* app/gui/convert-dialog.c
	* app/gui/palette-editor.c
	* app/gui/paths-dialog.c
	* app/pdb/paths_cmds.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimpsmudgetool.c
	* app/tools/gimptexttool.c
	* tools/pdbgen/pdb/paths.pdb: removed useless includes.
2001-05-16 18:09:45 +00:00
Michael Natterer
62a4c05777 removed (was not used).
2001-05-15  Michael Natterer  <mitch@gimp.org>

	* app/gimpcontextpreview.[ch]: removed (was not used).

	* app/apptypes.h: removed the Guide typedef.

	* app/core/core-types.h: added it here as GimpGuide (everything in
	core/ must be "Gimp"-prefixed).

	* app/gimage.[ch]: removed the global "next_guide_id" variable,
	don't destroy the guides in the "destroy" handler.

	* app/core/gimpimage.[ch]: destroy them in destroy().

	* app/xcf.c: use GimpImage accessors to add the guides, so we
	don't need "next_guide_id".

	* app/gdisplay.[ch]
	* app/undo.c
	* app/core/gimpimage-duplicate.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.[ch]
	* tools/pdbgen/pdb/guides.pdb: s/Guide/GimpGuide/, cleanup.
2001-05-15 19:10:57 +00:00
Michael Natterer
d240f623f1 new directory app/base/
2001-05-15  Michael Natterer  <mitch@gimp.org>

	* configure.in: new directory app/base/

	* app/Makefile.am
	* app/boundary.[ch]
	* app/brush_scale.[ch]
	* app/gimpchecks.h
	* app/gimplut.[ch]
	* app/pixel_processor.[ch]
	* app/pixel_region.[ch]
	* app/pixel_surround.[ch]
	* app/temp_buf.[ch]
	* app/tile.[ch]
	* app/tile_cache.[ch]
	* app/tile_manager.[ch]
	* app/tile_manager_pvt.h
	* app/tile_pvt.h
	* app/tile_swap.[ch]: moved to base/

	* app/base/Makefile.am
	* app/base/base-types.h
	* app/base/*: new directory for the sub-object pixel maniplation
	and storage stuff. Does not include Gtk+ or anything outside
	base/. Did some cleanup in all files.

	* app/appenums.h
	* app/apptypes.h
	* app/core/gimpimage.h: removed types which are now in
	base/base-types.h.

	* app/base/base-config.[ch]
	* app/gimprc.[ch]: put the config variables for base/ to their own
	file so base/ doesn not have to include gimprc.h (does not yet
	work, i.e. the variables are un-configurable right now)

	* app/main.c: set a log handler for "Gimp-Base".

	* app/paint-funcs/Makefile.am
	* app/paint-funcs/paint-funcs.[ch]: removed the color hash which
	maps RGB to color indices because it's a totally standalone system
	which has nothing to do with the paint-funcs and introduced a
	GimpImage dependency.

	paint-funcs/ should be considered on the same sub-object
	(glib-only) level as base/, only in a different directory.

	* app/core/Makefile.am
	* app/core/gimpimage-colorhash.[ch]: put the color hash here.

	* app/gimage.c: don't invalidate the color hash here...

	* app/core/gimpimage.c: ... but in the colormap_changed() default
	inplementation. Initialize the hash in class_init().

	* tools/pdbgen/Makefile.am: scan app/base/base-types.h for enums.

	* tools/pdbgen/enums.pl: regenerated.

	* app/[lots]
	* app/core/[of]
	* app/gui/[files]
	* app/pdb/[all]
	* app/tools/[over]
	* app/widgets/[the]
	* tools/pdbgen/pdb/[place]: changed #includes accordingly. And use
	base_config->value instead of the stuff from gimprc.h.
2001-05-15 11:25:25 +00:00
Sven Neumann
fdbdb390ab app/Makefile.am removed this file ...
2001-05-14  Sven Neumann  <sven@gimp.org>

        * app/Makefile.am
        * app/pixmaps2.h: removed this file ...

        * app/tools/Makefile.am
        * app/tools/icons.h: ... and readded it here with some changes.

        * app/tools/*.c: include the new icons.h file

        * app/pdb/procedural_db.[ch]: declare name as const
2001-05-14 00:04:29 +00:00
Michael Natterer
0cbbef4025 app/Makefile.am removed. Stuff now lives in app_procs.[ch] and in
2001-05-13  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/cursorutil.[ch]: removed. Stuff now lives in app_procs.[ch]
	and in widgets/gimpcursor.[ch]

	* app/appenv.h: added the "gimp_busy" boolean.

	* app/app_procs.[ch]: added the "busy" stuff here.

	* app/gui/gui.[ch]: "busy" stuff for the gui.

	* app/widgets/Makefile.am
	* app/widgets/gimpcursor.[ch]: exports only one function:
	gimp_cursor_new() which returns a GdkCursor which has to be
	destroyed.

	* app/apptypes.h
	* app/appenums.h: removed the cursor types.
	* app/widgets/widgets-types.h: added here.

	* app/tools/gimpeditselectiontool.[ch]: added
	gtkutil_compress_motion() here (will go to some utils file in
	widgets/).

	* app/tools/tools-types.h: #include "widgets/widgets-types.h"

	* app/dialog_handler.c
	* app/disp_callbacks.c
	* app/gdisplay.[ch]
	* app/nav_window.c
	* app/scroll.c
	* app/xcf.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage.c
	* app/gui/file-open-dialog.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimptransformtool.c
	* tools/pdbgen/pdb/image.pdb
	* app/pdb/image_cmds.c: use the new cursor and "busy" functions.

	* app/gdisplay.h
	* app/core/gimpbrush.c: added some ugly cross-includes.

	* app/context_manager.c
	* app/gdisplay_ops.c
	* app/gimprc.c
	* app/core/gimpdrawable-offset.c
	* app/gui/file-save-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/preferences-dialog.c
	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpselectiontool.c: removed inclusion of "cursorutil.h"
2001-05-13 21:51:20 +00:00
Michael Natterer
b86ce96ae4 app/appenums.h app/core/core-types.h moved some more types to core-types.h
2001-05-13  Michael Natterer  <mitch@gimp.org>

	* app/appenums.h
	* app/core/core-types.h
	* app/tools/tools-types.h: moved some more types to core-types.h
	and tools-types.h.  Removed AUXILLARY_CHANNEL from the ChannelType
	enum.

	* app/gdisplay.[ch]: removed the "depth" and "color_type" fields
	from the struct. Cleaned up the header.

	* app/selection.c
	* app/gui/info-window.c: use g_visual->depth instead of
	gdisp->depth.

	* app/gimphelp.c: #include "core/core-types.h"

	* tools/pdbgen/Makefile.am: added app/core/core-types.h to the
	list of files to be scanned for enums.

	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl
	* app/pdb/drawable_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c: regenerated.
2001-05-13 17:25:12 +00:00
Michael Natterer
637c714ab9 removed some forgotten tools types.
2001-05-13  Michael Natterer  <mitch@gimp.org>

	* app/apptypes.h: removed some forgotten tools types.

	* app/tools/tools-types.h: and added them here.

	* app/interface.c
	* app/disp_callbacks.[ch]: ported dropping of drawables to the
	new DND system.

	* app/app_procs.c
	* app/core/gimpdatafactory.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimptoolinfo.h
	* app/gui/gui.c
	* app/tools/tool_options.c
	* app/widgets/gimpchannellistview.c
	* app/widgets/gimplayerlistview.c: removed/fixed includes.

	* app/gui/brush-select.[ch]
	* app/gui/pattern-select.[ch]: removed the display of the current
	name (done by the grid view now).

	* app/gui/palette-select.c: fixed palette preview size.

	* app/gui/dialogs-constructors.c: added get_name() functions for
	brushes, patterns, images and palettes.

	* app/widgets/gimpcontainergridview.[ch]: added a label for the
	name of the active item.

	* app/widgets/gimpdnd.[ch]: removed the old drawable DND preview
	icon code.

	* tools/pdbgen/app.pl: braino: the $tool_eek hack has to be
	initialized to 0 at the beginning of each file, otherwise we end
	up including "tools/tools-types.h" everywhere.

	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/text_tool.pdb
	* tools/pdbgen/pdb/tools.pdb: add "tools/tools-types.h" where needed.

	* app/pdb/color_cmds.c
	* app/pdb/pattern_select_cmds.c
	* app/pdb/patterns_cmds.c
	* app/pdb/plug_in_cmds.c
	* app/pdb/procedural_db_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/undo_cmds.c
	* app/pdb/unit_cmds.c: regenerated.
2001-05-13 11:35:20 +00:00
David Neary
42c3912161 app/tools/gimpbycolorselecttool.[ch] Temporarily fixed an issue with undo
2001-05-10  David Neary  <dneary@eircom.net>

        * app/tools/gimpbycolorselecttool.[ch]
        * app/undo.c: Temporarily fixed an issue with undo when
        there's a bycolorselect mask on the image - since
        gimp_by_color_select_tool_initialize_by_image() should be
        a private function, this needs changing.
2001-05-10 21:01:02 +00:00
David Neary
67564fef93 Activate "Select by color" tool.
2001-05-10  David Neary  <dneary@eircom.net>

        * app/tools/gimpbycolorselecttool.[ch]: Activate
        "Select by color" tool.

        * app/tools/Makefile.am
        * app/tools/tools.c
        * app/tools/gimptool.[ch]
        * app/tools/selection_options.c
        * tools/pdbgen/pdb/tools.pdb: Changed accordingly
2001-05-10 08:10:25 +00:00
Michael Natterer
d1022c34b6 app/Makefile.am removed.
2001-05-10  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/asupsample.[ch]: removed.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/tools/Makefile.am
	* app/tools/tools-types.h: new files.

	* app/tools/gimptoolinfo.[ch]: removed.
	* app/core/gimptoolinfo.[ch]: added here.

	* libgimp/Makefile.am
	* libgimp/gimp.h
	* libgimp/gimpadaptivesupersample.[ch]
	* libgimp/gimpbilinear.[ch]: removed here...

	* libgimpcolor/Makefile.am
	* libgimpcolor/gimpcolortypes.h
	* libgimpcolor/gimpadaptivesupersample.[ch]
	* libgimpcolor/gimpbilinear.[ch]: ..and added here.

	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/paths.pdb

	* app/*.c: changed tons of #include's
2001-05-09 22:34:59 +00:00
Michael Natterer
8985b107c3 configure.in added new directory app/core/ for the core object system.
2001-05-09  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/core/ for the core
	object system.

	* app/gimage_mask.[ch]
	* app/gimpbrush-header.h
	* app/gimpbrush.[ch]
	* app/gimpbrushgenerated.[ch]
	* app/gimpbrushpipe.[ch]
	* app/gimpchannel.[ch]
	* app/gimpcontainer.[ch]
	* app/gimpcontext.[ch]
	* app/gimpdata.[ch]
	* app/gimpdatafactory.[ch]
	* app/gimpdatalist.h
	* app/gimpdrawable-desaturate.[ch]
	* app/gimpdrawable-equalize.[ch]
	* app/gimpdrawable-invert.[ch]
	* app/gimpdrawable-offset.[ch]
	* app/gimpdrawable-preview.[ch]
	* app/gimpdrawable.[ch]
	* app/gimpgradient.[ch]
	* app/gimpimage-convert.[ch]
	* app/gimpimage-duplicate.[ch]
	* app/gimpimage-undo.[ch]
	* app/gimpimage.[ch]
	* app/gimplayer.[ch]
	* app/gimplayermask.[ch]
	* app/gimplist.[ch]
	* app/gimpmarshal.[ch]
	* app/gimpobject.[ch]
	* app/gimppalette-import.[ch]
	* app/gimppalette.[ch]
	* app/gimppattern-header.h
	* app/gimppattern.[ch]
	* app/gimpundo.[ch]
	* app/gimpundostack.[ch]
	* app/gimpviewable.[ch]: removed these files...

	* app/core/*: ...and added them here.

	* app/*.c
	* app/gui/*.c
	* app/pdb/*.c
	* app/tools/*.c
	* app/widgets/*.c
	* plug-ins/common/gbr.c
	* plug-ins/common/gih.c
	* plug-ins/common/pat.c
	* po/POTFILES.in
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/enums.pl
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/*.pdb: changed accordingly.
2001-05-09 02:32:03 +00:00
Michael Natterer
9ecde4ea49 app/Makefile.am removed.
2001-05-08  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimpdnd.[ch]: removed.

	* app/widgets/Makefile.am
	* app/widgets/gimpdnd.[ch]: and moved here.

	* app/devices.c
	* app/docindex.c
	* app/interface.c
	* app/gui/about-dialog.c
	* app/gui/channels-dialog.c
	* app/gui/color-area.c
	* app/gui/color-select.c
	* app/gui/colormap-dialog.c
	* app/gui/gradient-editor.c
	* app/gui/indicator-area.c
	* app/gui/layers-dialog.c
	* app/gui/palette-editor.c
	* app/gui/palette-select.c
	* app/gui/toolbox.c
	* app/tools/gimpblendtool.c
	* app/tools/tool_manager.c
	* app/tools/tool_options_dialog.c: changed #includes accordingly.
2001-05-08 19:29:15 +00:00
Michael Natterer
a229702dfe added ChannelType. removed ChannelType. regenerated.
2001-05-08  Michael Natterer  <mitch@gimp.org>

	* app/appenums.h: added ChannelType.
	* app/gimpimage.h: removed ChannelType.
	* tools/pdbgen/enums.pl: regenerated.

	* app/apptypes.h: don't include libgimpwidgets/gimpwidgetstypes.h
	and widgets/widgets-types.h any more.

	* app/devices.c
	* app/gimpdnd.c
	* app/gimprc.c
	* app/lc_dialog.c
	* app/gui/[many].c: include widgets/widgets-types.h

	* app/tools/histogram_tool.h: include widgets/widgets-types.h here
	because of an ugly dependency from pdb/color_cmds.c

	* app/tools/tool_options_dialog.c

	* app/widgets/widgets-types.h: include
	libgimpwidgets/gimpwidgetstypes.h and apptypes.h so files in
	widgets/ only have to include this file.

	* app/widgets/*.c: include widgets-types.h instead of apptypes.h

	* app/gimpdrawable-preview.c
	* app/gui/gradient-editor.c: removed useless #includes.
2001-05-08 03:48:54 +00:00
Michael Natterer
59b06707bd added GimpDropMode... ...removed from here.
2001-05-06  Michael Natterer  <mitch@gimp.org>

	* app/appenums.h: added GimpDropMode...
	* app/gimpdnd.h: ...removed from here.

	* app/gimpimage.[ch]:
	- New signal "mode_changed".
	- removed "const GimpImage*" from gimp_image_colormap_changed()
	  because a signal emission is never "const" for the object
	  which emits the signal.
	- Fixed gimp_image_[set|get]_component_[active|visible]():
	  ALPHA_CHANNEL maps to ALPHA_PIX only in RGB mode, use
	  ALPHA_G_PIX/ALPHA_I_PIX in GRAY/INDEXED mode.

	* app/gimpimage-convert.c
	* app/undo.c: call gimp_image_mode_changed().

	* app/gimpviewable.c: added an implementation of
	"invalidate_preview" which frees the preview temp_buf which may be
	attached to the viewable. Subclasses need to chain up now.

	* app/gimpdrawable.c
	* app/gimpimage.c: chain up in invalidate_preview().

	* app/widgets/gimpchannellistview.c: connect to the image's
	"mode_changed" signal and rebuild the channel list in the
	callback.

	* app/widgets/gimpcontainerview.h: indentation.

	* app/widgets/gimpdockbook.c: set the dockable's context to NULL
	in gimp_dockbook_remove()

	* app/widgets/gimpimagedock.c: forgot to actually set the dock's
	image in gimp_image_dock_new().

	* app/gui/dialogs-constructors.c: added a get_name_func() for tool
	views which returns the tool's "blurb". It's safe to assume now
	that a dockable's context will exist as long as the dockable
	exists unless it's explicitely set to NULL, so remove ugly hacks
	handling context destruction.

	* app/tools/gimptool.c: removed COMPAT_CRUFT and useless #include's.
2001-05-06 16:14:34 +00:00
David Neary
3543e9904d Ensure that option widgets are set to defaults on first call to the
* app/tools/tool_options.c: Ensure that option widgets are set to
defaults on first call to the _init() function.
2001-04-30 12:54:33 +00:00
David Neary
8676c6acd5 Separated the transform options stuff from the gimptransformtool files so
* app/tools/transform_options.[ch]: Separated the transform
    options stuff from the gimptransformtool files so that each
    of the transform tools to make is available to the other transform
    tools.

  * app/tools/gimptransformtool.c
  * app/tools/gimpscaletool.c
  * app/tools/gimpsheartool.c
  * app/tools/gimprotatetool.c
  * app/tools/gimpperspectivetool.c
  * app/tools/Makefile.am: Changed accordingly
2001-04-28 20:14:32 +00:00
David Neary
24c39e398a Enabled the rest of the transform tools and changed some of the options
Enabled the rest of the transform tools and changed some of
the options stuff in transform_options_new(). There are one or two
outstanding (non-critical) runtime problems in that function.
2001-04-24 18:43:31 +00:00
Michael Natterer
44d41e8e9b app/Makefile.am app/lc_dialogP.h removed stuff that will go away anyway
2001-04-21  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/lc_dialogP.h
	* app/paths_dialogP.h: removed stuff that will go away anyway (put
	the declarations to the public headers).

	* app/gimpui.[ch]: new function gimp_widget_get_callback_context()
	which may only be called from a *_cmd_callback() and returns the
	data we attached with weird methods.

	* app/gui/Makefile.am
	* app/gui/channels-commands.[ch]: callbacks independent from the
	channels dialog and the "new" and "edit channel" dialogs.

	* app/gui/channels-dialog.[ch]
	* app/gui/layers-commands.c
	* app/gui/layers-dialog.[ch]
	* app/lc_dialog.[ch]
	* app/gui/menus.c
	* app/gui/paths-dialog.[ch]
	* app/tools/gimpbezierselecttool.c
	* po/POTFILES.in: changed accordingly.
2001-04-21 02:11:12 +00:00
Michael Natterer
2301e7e1d9 app/tools/Makefile.am app/tools/gimpclonetool.[ch]
2001-04-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpclonetool.[ch]
	* app/tools/gimpconvolvetool.[ch]
	* app/tools/gimppainttool.c
	* app/tools/gimptool.h
	* app/tools/paint_options.c
	* app/tools/tool_manager.c
	* app/tools/tools.c: Applied a patch from Dave Neary
	<dneary@eircom.net> which brings clone and convolve back.

	That's all paint tools, Dudes!
2001-04-19 13:01:44 +00:00
Michael Natterer
ddc9145256 app/Makefile.am app/gui/Makefile.am app/about_dialog.[ch]
2001-04-17  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gui/Makefile.am
	* app/about_dialog.[ch]
	* app/brush_edit.[ch]
	* app/brush_select.[ch]
	* app/channels_dialog.[ch]
	* app/color_area.[ch]
	* app/color_notebook.[ch]
	* app/color_select.[ch]
	* app/colormap_dialog.[ch]
	* app/commands.[ch]
	* app/file_new_dialog.[ch]
	* app/gradient_editor.[ch]
	* app/gradient_select.[ch]
	* app/indicator_area.[ch]
	* app/info_dialog.[ch]
	* app/info_window.[ch]
	* app/layer_select.[ch]
	* app/layers_dialog.[ch]
	* app/menus.[ch]
	* app/palette.[ch]
	* app/palette_import.[ch]
	* app/palette_select.[ch]
	* app/paths_dialog.[ch]
	* app/pattern_select.[ch]
	* app/preferences_dialog.[ch]
	* app/session.[ch]
	* app/test_commands.[ch]
	* app/tips_dialog.[ch]
	* app/toolbox.[ch]: moved to gui/ (s/_/-/ and some more useful
	filenames on the way).

	* app/app_procs.c
	* app/context_manager.c
	* app/convert.c
	* app/disp_callbacks.c
	* app/errorconsole.c
	* app/file-open.c
	* app/file-save.c
	* app/file-utils.c
	* app/gdisplay.c
	* app/gimage.c
	* app/gimprc.c
	* app/image_new.c
	* app/interface.c
	* app/nav_window.c
	* app/path.c
	* app/plug_in.c
	* app/gui/dialogs-constructors.c
	* app/pdb/brush_select_cmds.c
	* app/pdb/convert_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/pattern_select_cmds.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimptransformtool.c
	* app/widgets/gimpcolorpanel.c
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* po/POTFILES.in: changed accordingly.
2001-04-17 21:43:29 +00:00
Michael Natterer
f283b957b1 app/session.[ch] removed the old dialog session management code...
2001-04-17  Michael Natterer  <mitch@gimp.org>

	* app/session.[ch]
	* app/gimprc.c: removed the old dialog session management code...

	* app/widgets/gimpdialogfactory.[ch]: ...and manage all dialogs here.

	* app/gui/dialogs-constructors.[ch]: dialog factory compliant
	constructors for all session managed toplevel dialogs.

	* app/brush_select.[ch]
	* app/devices.[ch]
	* app/docindex.[ch]
	* app/errorconsole.[ch]
	* app/gradient_select.[ch]
	* app/info_dialog.c
	* app/lc_dialog.[ch]
	* app/palette.[ch]
	* app/pattern_select.[ch]
	* app/toolbox.[ch]
	* app/tools/tool_options_dialog.[ch]: all dialog constructors have
	to return the dialog now (even the legacy ones that will go away).
	Removed the session management code as this is now done for the
	dialogs, not by them.

	* app/app_procs.c
	* app/color_select.c
	* app/commands.[ch]
	* app/indicator_area.c
	* app/menus.c
	* app/palette_select.c
	* app/preferences_dialog.c
	* app/gui/dialogs.c
	* app/gui/dialogs-commands.[ch]
	* app/gui/gui.c
	* app/tools/gimptool.c
	* app/widgets/gimpdock.c: changed accordingly.
2001-04-17 16:00:27 +00:00
Michael Natterer
86dc60045c removed the ID system from the pdb/ subdir...
2001-04-13  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.[ch]: removed the ID system from the pdb/
	subdir...

	* app/gimpimage.[ch]: ...and temporarily added it back to GimpImage.

	The ID stuff is not only used by the PDB but is a more general
	type of service which is needed for the PDB, DND and some parts of
	the GUI. Finally, a GimpFactory class with subclasses for data
	objects, images etc. will maintain the ID spaces.

	* app/colormap_dialog.c
	* app/file-open.c
	* app/file-save.c
	* app/gdisplay.c
	* app/gimpdnd.c
	* app/gimpdrawable.c
	* app/info_window.c
	* app/lc_dialog.c
	* app/nav_window.c
	* app/palette_import.c
	* app/paths_dialog.c
	* app/plug_in.c
	* app/xcf.c
	* app/tools/gimptexttool.c
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/image.pdb: use GimpImage's ID functions.

	* app/pdb/channel_cmds.c
	* app/pdb/channel_ops_cmds.c
	* app/pdb/convert_cmds.c
	* app/pdb/display_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/fileops_cmds.c
	* app/pdb/guides_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/parasite_cmds.c
	* app/pdb/paths_cmds.c
	* app/pdb/selection_cmds.c
	* app/pdb/text_tool_cmds.c
	* app/pdb/tools_cmds.c
	* app/pdb/undo_cmds.c: regenerated.
2001-04-13 14:50:43 +00:00
Michael Natterer
330072d625 added a DND type for GimpImage.
2001-04-13  Michael Natterer  <mitch@gimp.org>

	* app/gimpdnd.c: added a DND type for GimpImage.

	* app/tools/tools.c: don't register bezier select twice.

	* app/widgets/gimpdockbook.[ch]: hacked the popup menu a bit.
2001-04-13 12:10:22 +00:00
Michael Natterer
4f69c5a09e app/tools/Makefile.am app/tools/gimpsmudgetool.[ch]
2001-04-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpsmudgetool.[ch]
	* app/tools/gimptool.[ch]
	* app/tools/paint_options.c
	* app/tools/tool_manager.c
	* app/tools/tools.c
	* app/pdb/tools_cmds.c
	* tools/pdbgen/pdb/tools.pdb: applied a (slightly modified) patch
	from Dave Neary <dave.neary@palamon.ie> which reactivates the
	smudge tool.
2001-04-11 17:20:34 +00:00
Michael Natterer
f868d8b813 fixed the dockable names.
2001-04-11  Michael Natterer  <mitch@gimp.org>

	* app/test_commands.c: fixed the dockable names.

	* app/tools/gimpbezierselecttool.c: applied patch from Dave Neary
	which fixes some minor stuff that was forgotten to port.

	* app/widgets/gimpdockbook.c: set the tooltip of the notebook tab
	also if it is a plain label.
2001-04-11 15:39:28 +00:00
Simon Budig
4c2c3a2d0d app/tools/gimppathtool.[ch] app/tools/path_tool.[ch]
2001-04-11  Simon Budig  <simon@gimp.org>

        * app/tools/gimppathtool.[ch]
        * app/tools/path_tool.[ch]

        Some tweaks to make gcc and mitch more happy.
2001-04-11 15:25:49 +00:00
Simon Budig
5957eb4f4a app/path_curves.[ch] app/tools/gimpdrawtool.c app/tools/gimppathtool.[ch]
2001-04-11  Simon Budig  <simon@gimp.org>

        * app/path_curves.[ch]
        * app/tools/gimpdrawtool.c
        * app/tools/gimppathtool.[ch]
        * app/tools/path_tool.[ch]
        * app/tools/path_toolP.h

        At least now it looks as if it could do something sometimes...
2001-04-11 13:28:53 +00:00
Michael Natterer
594496b132 configure.in new directory containing all widgets. Some of them will go to
2001-04-11  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/widgets/*: new directory containing all widgets. Some of them
	will go to libgimpwidgets.

	* app/color_panel.[ch]
	* app/gimpbrushpreview.[ch]
	* app/gimpconstrainedhwrapbox.[ch]
	* app/gimpcontainergridview.[ch]
	* app/gimpcontainerlistview.[ch]
	* app/gimpcontainerview.[ch]
	* app/gimpdatafactoryview.[ch]
	* app/gimpdock.[ch]
	* app/gimpdockable.[ch]
	* app/gimpdockbook.[ch]
	* app/gimpdrawablelistitem.[ch]
	* app/gimpdrawablelistview.[ch]
	* app/gimpdrawablepreview.[ch]
	* app/gimpgradientpreview.[ch]
	* app/gimpimagepreview.[ch]
	* app/gimplayerlistitem.[ch]
	* app/gimplayerlistview.{ch]
	* app/gimplistitem.[ch]
	* app/gimppalettepreview.[ch]
	* app/gimppatternpreview.[ch]
	* app/gimppreview.[ch]
	* app/gimptoolinfopreview.[ch]
	* app/gtkhwrapbox.[ch]
	* app/gtkvwrapbox.[ch]
	* app/gtkwrapbox.[ch]
	* app/histogramwidget.[ch]: removed from here.

	* app/Makefile.am
	* app/appenums.h
	* app/brush_select.c
	* app/channels_dialog.c
	* app/devices.c
	* app/gimpdnd.c
	* app/gimpdrawable-preview.c
	* app/gimphistogram.h
	* app/gradient_editor.c
	* app/gradient_select.c
	* app/indicator_area.c
	* app/info_window.c
	* app/palette.c
	* app/palette_select.c
	* app/pattern_select.c
	* app/qmask.c
	* app/test_commands.c
	* app/toolbox.c
	* app/pdb/color_cmds.c
	* app/tools/paint_options.c
	* app/tools/tool_options_dialog.c
	* tools/pdbgen/pdb/color.pdb: changed accordingly.
2001-04-11 01:13:53 +00:00
Sven Neumann
cca3497143 app/tools/posterize.c plug-ins/common/fractaltrace.c
2001-04-10  Sven Neumann  <sven@gimp.org>

        * app/tools/posterize.c
        * plug-ins/common/fractaltrace.c
        * plug-ins/common/illusion.c
        * plug-ins/flame/flame.c
        * plug-ins/gfig/gfig.c
        * plug-ins/gimpressionist/general.c
        * plug-ins/imagemap/imap_cmd_guides.c
        * plug-ins/mosaic/mosaic.c
        * plug-ins/winsnap/winsnap.c: merged i18n fixes from stable branch
2001-04-10 18:36:37 +00:00
Michael Natterer
f6f1901228 app/paint_funcs.c app/paint_funcs.h removed the old files.
2001-04-07  Michael Natterer  <mitch@gimp.org>

	* app/paint_funcs.c
	* app/paint_funcs.h
	* app/paint_funcs_simd.S: removed the old files.

	* tools/pdbgen/Makefile.am
	* app/app_procs.c
	* app/channel_ops.c
	* app/channels_dialog.c
	* app/desaturate.c
	* app/disp_callbacks.c
	* app/floating_sel.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimpchannel.c
	* app/gimpdrawable-preview.c
	* app/gimpdrawable.c
	* app/gimpimage.c
	* app/gimplayer.c
	* app/gimplayermask.c
	* app/global_edit.c
	* app/image_map.c
	* app/image_new.c
	* app/layers_dialog.c
	* app/temp_buf.c
	* app/toolbox.c
	* app/undo.c
	* app/undo_history.c
	* app/paint-funcs/paint-funcs.c
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppainttool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: changed accordingly.
2001-04-07 15:58:26 +00:00
Simon Budig
e2f373cbd2 app/Makefile.am app/apptypes.h app/path_bezier.[ch] app/path_curves.[ch]
2001-04-07  Simon Budig  <simon@gimp.org>

        * app/Makefile.am
        * app/apptypes.h
        * app/path_bezier.[ch]
        * app/path_curves.[ch]
        * app/pixmaps2.h
        * app/tools/Makefile.am
        * app/tools/gimpdrawtool.[ch]
        * app/tools/path_tool.[ch]
        * app/tools/path_toolP.h
        * app/tools/tools.c

        new files:
        * app/tools/gimppathtool.c
        * app/tools/gimppathtool.h

        Reactivated (at least partially) the old new path tool. It
        will undergo major restructuring. Especially the path data
        will become proper objects. This definitely is work in progress
        and totally unuseable now.
2001-04-07 14:55:39 +00:00
Michael Natterer
eb26cf7830 app/tools/gimpairbrushtool.c app/tools/gimpdodgeburntool.[ch]
2001-04-07  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpairbrushtool.c
	* app/tools/gimpdodgeburntool.[ch]
	* app/tools/gimperasertool.c
	* app/tools/gimppaintbrushtool.[ch]
	* app/tools/gimppenciltool.c
	* app/pdb/tools_cmds.c
	* tools/pdbgen/pdb/tools.pdb: general cleanup of all paint tools we
	have so far: reordered/renamed functions to make them look the same,
	minor fixes in all files.
2001-04-07 11:01:22 +00:00
Michael Natterer
647bf4433b app/tools/Makefile.am back again.
2001-04-01  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpairbrushtool.[ch]: back again.

	* app/tools/gimptool.[ch]
	* app/tools/paint_options.c
	* app/tools/tool_manager.c
	* app/tools/tools.c: changed accordingly.
2001-03-31 23:04:29 +00:00
Michael Natterer
0486fdabe6 app/apptypes.h pass the ToolOptions to the ToolOptionsResetFunc instead of
2001-03-31  Michael Natterer  <mitch@gimp.org>

	* app/apptypes.h
	* app/tools/tool_options_dialog.c: pass the ToolOptions to the
	ToolOptionsResetFunc instead of a useless (void).

	* app/tools/paint_options.[ch]
	* app/tools/selection_options.[ch]: pass ToolOptions pointers here too.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpellipseselecttool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimpinktool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: changed accordingly. Removed many
	"reset" callbacks which just redirected the call to
	paint_options_reset() or selection_options_reset().
2001-03-31 20:41:39 +00:00
Michael Natterer
2824801f78 made undo_pop_paint() work again.
2001-03-31  Michael Natterer  <mitch@gimp.org>

	* app/undo.c: made undo_pop_paint() work again.

	* app/tools/gimppainttool.[ch]: store the tool ID and the tool
	type in the PaintUndo struct.

	* app/tools/gimppenciltool.c: removed unused variable.

	* app/tools/gimptool.c: removed and reordered STUB()s and cruft.
2001-03-31 17:46:59 +00:00
Michael Natterer
f81a8b0024 app/tools/Makefile.am applied a patch from Dave Neary which re-activates
2001-03-31  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpfliptool.[ch]: applied a patch from Dave Neary
	which re-activates this tool. Enabled the tool options too.

	* app/tools/gimpbezierselecttool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimptexttool.c: trivial fixes.

	* app/tools/gimptool.c: removed cruft.

	* app/tools/gimptransformtool.[ch]: a special case for the flip
	tool, cleanup.

	* app/tools/tools.c: register the flip tool.
2001-03-31 17:08:55 +00:00
Michael Natterer
bb134d6ed4 app/tools/bezier_select.[ch] app/tools/bezier_selectP.h
2001-03-31  Michael Natterer  <mitch@gimp.org>

	* app/tools/bezier_select.[ch]
	* app/tools/bezier_selectP.h
	* app/tools/transform_core.[ch]
	* app/tools/transform_tool.[ch]: removed.

	* app/tools/Makefile.am
	* po/POTFILES.in: changed accordingly.

	* app/tools/gimpbezierselecttool.c: indentation fixes.

	* app/tools/gimpdodgeburntool.[ch]: made cursor toggling work
	again, cleanup.

	* app/tools/gimpscaletool.[ch]
	* app/tools/gimptool.c: minor cleanups like removing STUB()s.

	* app/tools/tool_manager.c: applied patch from Dave Neary which
	returns useful PDB strings for the paint tools again.
2001-03-31 15:45:05 +00:00
Michael Natterer
4ee31d0cac re-enabled transform undo. Fixes the transform tool crashes.
2001-03-31  Michael Natterer  <mitch@gimp.org>

	* app/undo.c: re-enabled transform undo. Fixes the transform tool
	crashes.

	* app/tools/gimptool.[ch]: put tool->ID back because the undo
	system uses it. Also, a unique tool serial number will be not too
	bad to have once we have module tools.

	* app/tools/gimptransformtool.[ch]: changed accordingly.
2001-03-31 14:47:44 +00:00
Michael Natterer
47f987f801 app/Makefile.am lowlevel stuff taken out of the transform tool.
2001-03-31  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/pixel_surround.[ch]: lowlevel stuff taken out of the transform
	tool.

	* app/tools/gimpscaletool.[ch]: minor cleanups, declare
	gimp_scale_tool_register() publically.

	* app/tools/gimptransformtool.[ch]: removed the PixelSurround stuff,
	hardcode tr_tool->interactive to TRUE, removed the no_draw() function,
	register the tool options, misc. other fixes and bad hacks that need
	to go away.

	(All this non-interactive stuff needs to be done outside the tool
	system. A "non-interactive tool" is just pure nonsense)

	* app/tools/gimptool.h: spacing.

	* app/tools/tool_manager.c: tool_manager_register_tool_options():
	return after warning, don't simply continue and crash.

	* app/tools/tools.c: register the bezier select tool.
2001-03-31 14:10:22 +00:00
Michael Natterer
c32c14552f app/devices.c app/disp_callbacks.c app/gimprc.c app/scroll.c
2001-03-30  Michael Natterer  <mitch@gimp.org>

	* app/devices.c
	* app/disp_callbacks.c
	* app/gimprc.c
	* app/scroll.c
	* app/tools/gimppainttool.[ch]
	* modules/colorsel_water.c: removed the GTK_HAVE_SIX_VALUATORS stuff
	in preparation of gtk 2.0 migration.
2001-03-30 16:39:14 +00:00
Seth Burgess
ea66f45f59 Bring back the beziers.
Modified Files:
	app/tools/Makefile.am app/tools/gimpiscissorstool.c
 	app/tools/gimptool.c app/Makefile.am app/apptypes.h app/path.c
 	app/path.h app/path_bezier.c app/path_bezier.h
 	app/paths_dialog.c app/paths_dialogP.h ChangeLog
 Added Files:
 	app/tools/gimpbezierselecttool.c
 	app/tools/gimpbezierselecttool.h
2001-03-26 05:31:47 +00:00
Seth Burgess
c0277176fc take away a gtk warning - Dave Neary's patch
ChangeLog app/tools/paint_options.c
2001-03-26 04:39:15 +00:00
Nate Summers
cbbc136380 scale tool! 2001-03-25 04:08:51 +00:00
Seth Burgess
70643cc392 *** empty log message *** 2001-03-24 02:30:58 +00:00
Seth Burgess
868d86a12c Oops. (forgot to commit these 2)
ChangeLog app/tools/gimppainttool.c
2001-03-24 02:30:39 +00:00
Seth Burgess
daa8e33680 Dodge/Burn is back Needs a bit of luvin still, but generally works
Dodge/Burn is back
Needs a bit of luvin still, but generally works
 	ChangeLog app/tools/Makefile.am app/tools/gimpdodgeburntool.c
 	app/tools/gimpdodgeburntool.h app/tools/gimptool.c
 	app/tools/paint_options.c app/tools/tools.c
2001-03-24 02:27:16 +00:00
Stanislav Brabec
c896716259 Bucket fill threshold=0 must be allowed.
2001-03-22  Stanislav Brabec  <utx@penguin.cz>

        * app/tools/gimpbucketfilltool.c: Bucket fill threshold=0 must
        be allowed.
2001-03-21 23:27:48 +00:00
Nate Summers
11238cd298 merged in all the old transform tool code.
* tools/gimptransformtool.[ch]: merged in all the old transform
	tool code.

	* tools/gimptool.h: added dummy GtkTypes for all the transform tools.
2001-03-15 04:57:24 +00:00
Michael Natterer
b5e61322d4 added some help_data and tooltips.
2001-03-12  Michael Natterer  <mitch@gimp.org>

	* app/gimplayerlistview.c: added some help_data and tooltips.

	* app/tools/Makefile.am
	* app/tools/gimperasertool.[ch]: one more.

	* app/tools/gimppaintbrushtool.[ch]
	* app/tools/gimppenciltool.[ch]: made all paint tools look the same.

	* app/tools/gimppainttool.c
	* app/tools/gimptool.[ch]
	* app/tools/paint_options.c
	* app/tools/tools.c: changed accordingly.

	* pixmaps/anchor.xpm: made it a bit smaller.

	* pixmaps/refresh.xpm: replaced with the "Recurrence" icon from
	evolution.
2001-03-12 04:40:17 +00:00
Michael Natterer
16fa029b28 pixmaps/Makefile.am new pixmap. "Someone" needs to go over the pixmaps one
2001-03-12  Michael Natterer  <mitch@gimp.org>

	* pixmaps/Makefile.am
	* pixmaps/edit.xpm: new pixmap. "Someone" needs to go over the
	pixmaps one day ;)

	* app/gimpdatafactoryview.c
	* app/gimpdrawablelistview.c: use the new icon.

	* app/floating_sel.c: stupid: the new gimp_layer_get_opacity()
	accessor speaks in normalized [0.0..1.0] values, so the
	floating selection was invisible after blindly using it.

	* app/gimpimage.c: more stupid: a totally useless sanity clamping
	made the composite preview ugly. Fixed.

	* app/tools/tool_manager.c: why the heck did this never crash before:
	don't dereference a NULL GDisplay pointer.
2001-03-12 01:21:43 +00:00
Seth Burgess
fadadfcf1a Added pencil back.
Modified Files:
 	app/tools/Makefile.am app/tools/gimppenciltool.h
 	app/tools/gimppenciltool.c app/tools/gimptool.c
 	app/tools/gimptool.h app/tools/paint_options.c
 	app/tools/tools.c
2001-03-11 23:28:16 +00:00
Michael Natterer
3eb5ebccfd app/tools/Makefile.am no. 15 is alive.
2001-03-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpiscissorstool.[ch]: no. 15 is alive.

	* app/tools/gimptool.[ch]
	* app/tools/selection_options.c
	* app/tools/tools.c: changed accordingly.
2001-03-11 22:19:06 +00:00
Michael Natterer
543bf74598 minor cleanups.
2001-03-11  Michael Natterer  <mitch@gimp.org>

	* app/gimplayerlistview.c: minor cleanups.

	* app/tools/Makefile.am
	* app/tools/gimpblendtool.[ch]: back again.

	* app/tools/gimptool.[ch]
	* app/tools/paint_options.c
	* app/tools/tools.c: changed accordingly.
2001-03-11 20:01:14 +00:00
Michael Natterer
b51d761fcc app/Makefile.am app/apptypes.h new subclass of GimpDrawableListView (the
2001-03-11  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/apptypes.h
	* app/gimplayerlistview.[ch]: new subclass of GimpDrawableListView
	(the upcoming replacement of the layers dialog). Connects to the
	new GimpLayer signals using the layer container as signal proxy
	(see below).

	* app/gimpcontainerview.[ch]: made "set_container" a virtual
	function.  This is needed by the GimpLayerListView to
	connect/disconnect signals. Subclasses implementing this method
	MUST obey the following order of instructions:

	1. disconnect from signals related to GimpContainerView->container
	2. chain up (!!!)
	3. connect to signals related to GimpContainerView->container

	And yes, I will add DocBook files for all those new objects :)

	* app/gimppreview.[ch]: made "border_color" a GimpRGB instead of
	guchar[3]. Added gimp_preview_set_border_color().

	* app/gimpcontainergridview.c
	* app/gimplayerlistitem.c: use gimp_preview_set_border_color().

	* app/gimpcontainerlistview.c
	* app/gimpdrawablelistview.c: cleanup.

	* app/gimpdrawablelistitem.c: we can safely asume that our parent
	widget is a GimpDrawableListView and use it's "reorder_drawable"
	function pointer (after checking that it's there).

	* app/gimplistitem.c: connect the correct DND type when changing
	the container of a list item with "reorderable" enabled.

	* app/gimplayer.[ch]: added accessors and "*_changed" signals for
	layer->mode, layer->opacity and layer->preserve_trans.

	* app/disp_callbacks.c: fixed a FIXME: use the correct bucket fill
	tool context again.

	* app/tools/paint_options.[ch]: paint_mode_menu_new(): added a
	boolean which toggles the "Behind" item on/off to the same
	constructor can be used for all paint mode menus.

	* app/tools/gimptoolinfo.c: rect. select is the standard tool again.

	* app/brush_select.c
	* app/floating_sel.c
	* app/gimpimage.c
	* app/layers_dialog.c
	* app/pdb/layer_cmds.c
	* app/tools/gimpeditselectiontool.c
	* tools/pdbgen/pdb/layer.pdb: use the new layer accessors and the
	paint_mode_menu constructor.

	* app/commands.c
	* app/gdisplay.c
	* app/menus.c
	* app/undo.c
	* app/tools/gimppainttool.c
	* app/tools/gimptool.c
	* app/tools/paint_options.c
	* app/tools/tool_manager.c: put the #warning's back inside
	#ifdef __GNUC__
2001-03-11 17:24:47 +00:00
Garry R. Osgood
b8a72df54e Garry R. Osgood <grosgood@rcn.com>
* app/Makefile.am
Inclusion of David's MMX code into Makefile now
depends on prior definition of HAVE_ASM_MMX.
* app/pdb/procedural_db.c
Line 276 cast of va_args to type GimpRGB seems
very problematical on SGI, as the va_args macro
expands to Extreme Ugliness and
(GimpRGB)(Extreme Ugliness) does not compile.
RH Linux seems indifferent and accepts either.
* app/commands.c
* app/gdisplay.c
* app/menus.c
* app/plug_in_cmds.c
* app/undo.c
* app/tools/gimppainttool.c
* app/tools/gimptool.c
* app/tools/paint_options.c
* app/tools/tool_manager.c
s|#<remark about extreme buggedness>|
/* #<remark about extreme buggedness> */|
Not all compilers are at peace with non-standard
pre-compiler directives. SGI MIPs compilers are
among the latter species.
2001-03-11 13:15:41 +00:00
Nate Summers
9df89c2581 more transform tool stuff 2001-03-10 07:07:31 +00:00
Michael Natterer
80b55c7e52 app/tools/Makefile.am removed.
2001-03-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/rect_selectP.h: removed.

	* app/tools/gimpfreeselecttool.[ch]
	* app/tools/gimpfuzzyselecttool.[ch]: reactivated.

	* app/tools/gimptool.[ch]: removed STUB()s and old crap.

	* app/tools/tools.c: register the new tools.

	* app/disp_callbacks.c
	* app/tools/selection_options.c: changed accordingly.

	* app/apptypes.h
	* app/tools/gimprectselecttool.c: cleanup.
2001-03-09 17:39:18 +00:00
Nate Summers
6fa118a0fd More transform tool work. 2001-03-09 07:09:12 +00:00
Michael Natterer
6161682563 app/tools/Makefile.am app/tools/gimpellipseselecttool.[ch] new objects
2001-03-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpellipseselecttool.[ch]
	* app/tools/gimprectselecttool.[ch]: new objects based on a (heavily
	modified) patch by Dave Neary <dneary@eircom.net>.

	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimptool.[ch]
	* app/tools/selection_options.c
	* app/tools/tools.c: changed accordingly.
2001-03-08 04:15:32 +00:00
Michael Natterer
469faaf3fe app/apptypes.h app/channel_ops.c app/commands.c app/convert.[ch]
2001-03-08  Michael Natterer  <mitch@gimp.org>

	* app/apptypes.h
	* app/channel_ops.c
	* app/commands.c
	* app/convert.[ch]
	* app/fileops.c
	* app/floating_sel.c
	* app/gimage.h
	* app/gimage_mask.[ch]
	* app/gimpchannel.c
	* app/global_edit.h
	* app/image_map.c
	* app/layer_select.[ch]
	* app/layers_dialogP.h
	* app/lc_dialog.c
	* app/resize.c
	* app/toolbox.c
	* app/undo.h
	* app/undo_history.c
	* app/xcf.c
	* app/tools/gimpbycolorselecttool.h
	* app/tools/gimpcroptool.[ch]
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimppainttool.c
	* app/tools/transform_core.h: removed the GImage typedef, cleanup.
2001-03-08 02:01:52 +00:00
Michael Natterer
1d987a3ba7 app/tools/Makefile.am lots of files renamed to gimp*tool.[ch]
2001-03-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/[almost *]: lots of files renamed to gimp*tool.[ch]

	* app/commands.c
	* app/context_manager.c
	* app/disp_callbacks.c
	* app/gdisplay.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimpdnd.c
	* app/gimprc.c
	* app/global_edit.c
	* app/info_window.c
	* app/scale.c
	* app/scroll.c
	* app/undo.c
	* app/pdb/text_tool_cmds.c
	* app/pdb/tools_cmds.c
	* po/POTFILES.in
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/enums.pl
	* tools/pdbgen/pdb/text_tool.pdb
	* tools/pdbgen/pdb/tools.pdb: changed accordingly.
2001-03-08 01:07:03 +00:00
Michael Natterer
f1d9ba6328 renamed ZoomType to GimpZoomZype and added it here.
2001-03-03  Michael Natterer  <mitch@gimp.org>

	* app/appenums.h: renamed ZoomType to GimpZoomZype and added it
	here.

	* app/commands.c
	* app/disp_callbacks.c
	* app/nav_window.c
	* app/scale.[ch]: changed accordingly.

	* app/tools/Makefile.am
	* app/tools/magnify.[ch]: back as object.

	* app/tools/tool.c: removed the old ToolInfo entry.

	* app/tools/tools.c: register it.
2001-03-03 16:22:18 +00:00
Michael Natterer
5362220ba1 app/tools/Makefile.am new files ported by Dave Neary <dneary@eircom.net>.
2001-03-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/gimpselectiontool.[ch]: new files ported by
	Dave Neary <dneary@eircom.net>. Changed them a bit to inherit
	from GimpDrawTool and added implementations of "modifier_key"
	and "oper_update" because they are shared by 4 of the old
	selection tools.
2001-03-02 15:24:12 +00:00
Michael Natterer
9c85236d55 we need to override GimpDrawTool's "draw" method to actually see
2001-03-01  Michael Natterer  <mitch@gimp.org>

	* app/tools/crop.[ch]: we need to override GimpDrawTool's "draw"
	method to actually see something.

	* app/channels_dialog.c
	* app/layers_dialog.c: fixed the crash introduced by the migration
	of gimage->layers and gimage->channels to GimpContainer.
2001-03-01 16:57:16 +00:00
Nate Summers
da9524e40e started work on TransformCore 2001-03-01 06:56:57 +00:00
Sven Neumann
cde309e45d made it compile again 2001-02-28 15:01:02 +00:00
Seth Burgess
9d13b929ef And he said crop, and there was crop. It was a bit broken though.
app/tools/crop.c app/tools/crop.h app/tools/Makefile.am
 	app/tools/tool.c app/tools/tools.c
2001-02-28 03:29:03 +00:00
Michael Natterer
a138eae7c4 app/gdisplay.c app/gimage.c. #include "tools/tool.h"
2001-02-28  Michael Natterer  <mitch@gimp.org>

	* app/gdisplay.c
	* app/gimage.c. #include "tools/tool.h"

	* app/tools/edit_selection.[ch]: the arrow_key function is not
	a method of edit_selection but of any tool that needs it.

	* app/tools/gimppaintbrushtool.c: removed variables.

	* app/tools/move.c: use the arrow_key function.

	* app/tools/tool_manager.h: removed the include of "tool.h"
2001-02-28 02:53:27 +00:00
Michael Natterer
904d8e2cab app/tools/Makefile.am back as real tool which gets temporarily pushed to
2001-02-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/edit_selection.[ch]: back as real tool which gets
	temporarily pushed to the tool_manager's new tool stack.

	* app/tools/move.c
	* app/tools/text_tool.c: call the edit_selection stuff again.

	* app/tools/tool.c: added a STUB().

	* app/tools/tool_manager.[ch]: implemented tool_manager_push_tool()
	and tool_manager_pop_tool().
2001-02-28 02:29:25 +00:00
Michael Natterer
4e3b5a1e3f app/tools/Makefile.am one more...
2001-02-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/bucket_fill.[ch]: one more...

	* app/tools/fuzzy_select.c: everything commented out except the
	find_region stuff.

	* app/tools/gimpcolorpickertool.c: cosmetic.

	* app/tools/paint_options.c: #include "bucket_fill.h"

	* app/tools/tool.[ch]: removed STUB()'s.

	* app/tools/tools.c: register it.
2001-02-28 01:05:22 +00:00
Michael Natterer
8202cf0203 app/tools/Makefile.am back as object.
2001-02-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/ink.[ch]: back as object.

	* app/tools/paint_options.c: #include "ink.h"

	* app/tools/tool.h: removed the type #define.

	* app/tools/tools.c: register it.
2001-02-28 00:10:58 +00:00
Michael Natterer
3d78cbd56c made the global_paint_options public.
2001-02-28  Michael Natterer  <mitch@gimp.org>

	* app/context_manager.[ch]: made the global_paint_options public.

	* app/tools/gimptoolinfo.[ch]: added a "tool_context" boolean to
	the constructor and create a private context for the tool
	initialized with global_paint_options's values.

	* app/tools/tool_manager.[ch]: changed tool_manager_register_tool()
	accordingly.

	* app/tools/gimpcolorpickertool.c
	* app/tools/measure.c
	* app/tools/move.c
	* app/tools/text_tool.c: changed accordingly.

	* app/tools/paint_options.[ch]: added the fade out and gradient
	options here so they can be used by all paint tools.

	* app/tools/gimppaintbrushtool.c: removed them here. Changed
	the non_gui stuff: removed the non_gui_paint_func and handle
	the non_gui stuff in the normal paint method. Allocate a
	non_gui_paintbrush instead of the old non_gui_paint_core.

	The non_gui stuff will change totally and will be handled
	by GimpPaintTool only.

	* app/tools/tool.c: removed the STUB()'s again.
2001-02-27 23:20:51 +00:00
Michael Natterer
84b634f251 build the measure tool again.
2001-02-27  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am: build the measure tool again.

	* app/tools/gimpcolorpickertool.c: correct prototypes for some
	functions so we don't get warnings about incompatible assignments
	in "class_init", chain up in "control".

	* app/tools/gimpdrawtool.c: added an implementation of "control"
	which can be called from subclasses so we don't need to call
	GimpDrawTool's methods directly from there.

	* app/tools/gimppaintbrushtool.[ch]: create it's tool options so it
	doesn't crash. Commented out the non_gui stuff. We need a different
	interface for this.

	* app/tools/gimppainttool.[ch]: some cleanups: call the draw tool's
	"control" function, fixed "cursor_update", fixed indentation.

	* app/tools/measure.[ch]: made it work again (properly subclass
	GimpDrawTool).

	* app/tools/tool.c: re-added the non_gui paintbrush STUB()'s

	* app/tools/tools.c: don't allocate the non_gui stuff.
	GimpPaintTool is an abstract superclass, so we cannot create
	an instance of it. Moreover, the current non_gui stuff assumes
	that there is something like a "paint_core" and changes it's
	virtual function pointers, breaking the object system totally.
2001-02-27 19:18:01 +00:00
Michael Natterer
8e3259d084 app/apptypes.h app/Makefile.am new widget. The upcoming replacement for
2001-02-27  Michael Natterer  <mitch@gimp.org>

	* app/apptypes.h
	* app/Makefile.am
	* app/gimpdrawablelistview.[ch]: new widget. The upcoming replacement
	for the layers and channels dialogs.

	* app/test_commands.[ch]: put the test dialogs here...

	* app/commands.[ch]: ... and made this one clean again.

	* app/gimpcontainergridview.c
	* app/gimpcontainerlistview.c
	* app/gimpcontainerview.[ch]: some signal handling fine tuning.

	* app/gimpimage.[ch]: emits "active_layer_changed" and
	"active_channel_changed" signals now. The semantics of
	gimage->active_layer and gimage->active_channel have changed a bit.
	We now have either an active layer _or_ and active channel (there
	is no active layer any more if a channel is active).

	* app/channel_ops.c
	* app/floating_sel.c
	* app/gdisplay.c
	* app/layers_dialog.c
	* app/menus.c: changed accordingly.

	* app/tools/gimpcolorpickertool.c: actually assign the draw_class
	vraiable in the class_init function.

	* app/tools/gimpdrawtool.[ch]
	* app/tools/tool.c: removed the _new() functions because these
	objects are abstract superclasses. Did some cleanup.
	Nathan, please configure you editor to _not_ produce any tabs
	in the source code.

	* app/tools/gimppaintbrushtool.[ch]: "blurb" and "help" are tagged
	with _(), not N_(). Put the register function to the header.

	* po/POTFILES.in: made it compile again.
2001-02-27 14:14:13 +00:00
Nate Summers
80a8d5a75f Introduced GimpPaintTool and GimpDrawTool 2001-02-27 05:21:12 +00:00
Michael Natterer
2fd2a4e6b5 app/channel_ops.c app/channels_dialog.c app/commands.c app/floating_sel.c
2001-02-25  Michael Natterer  <mitch@gimp.org>

	* app/channel_ops.c
	* app/channels_dialog.c
	* app/commands.c
	* app/floating_sel.c
	* app/gdisplay.c
	* app/gimpimage.[ch]
	* app/layer_select.c
	* app/layers_dialog.c
	* app/undo.c
	* app/xcf.c
	* app/tools/move.c: remove direct access of gimage->active_layer and
	gimage->active_channel. Reading access is of course harmless, but
	gimp_image_set_active_blah() will trigger a signal emission soon.

	It will probably be neccessary to change the functions to accept
	NULL layers and channels to acheive exactly what weird places like
	floating_sel.c did before by setting it directly.

	* gimptool-1.4.in
	* libgimp/Makefile.am
	* libgimpcolor/Makefile.am
	* libgimpmath/Makefile.am
	* libgimpwidgets/Makefile.am
	* plug-ins/libgck/gck/Makefile.am: made linking against stable
	GIMP installed in the same prefix work again by renaming all our
	libraries explicitly to libgimp<foo>-1.3.* (not as part of the
	libtool revision but as part of the library name). Removed the
	libtool revision to avoid double versioning. This has to be
	hardcoded in the libraries' Makefile.am ...

	* app/Makefile.am
	* plug-ins/FractalExplorer/Makefile.am
	* plug-ins/Lighting/Makefile.am
	* plug-ins/MapObject/Makefile.am
	* plug-ins/bmp/Makefile.am
	* plug-ins/common/Makefile.am
	* plug-ins/common/mkgen.pl
	* plug-ins/dbbrowser/Makefile.am
	* plug-ins/faxg3/Makefile.am
	* plug-ins/fits/Makefile.am
	* plug-ins/flame/Makefile.am
	* plug-ins/fp/Makefile.am
	* plug-ins/gap/Makefile.am
	* plug-ins/gdyntext/Makefile.am
	* plug-ins/gfig/Makefile.am
	* plug-ins/gflare/Makefile.am
	* plug-ins/gfli/Makefile.am
	* plug-ins/gimpressionist/Makefile.am
	* plug-ins/helpbrowser/Makefile.am
	* plug-ins/ifscompose/Makefile.am
	* plug-ins/imagemap/Makefile.am
	* plug-ins/maze/Makefile.am
	* plug-ins/mosaic/Makefile.am
	* plug-ins/pagecurl/Makefile.am
	* plug-ins/plugin-helper/Makefile.am
	* plug-ins/print/Makefile.am
	* plug-ins/rcm/Makefile.am
	* plug-ins/script-fu/Makefile.am
	* plug-ins/sel2path/Makefile.am
	* plug-ins/sgi/Makefile.am
	* plug-ins/webbrowser/Makefile.am
	* plug-ins/xjt/Makefile.am: ... while all other Makefiles can simply
	link against "libgimp<foo>-$(LT_REVISION).la"
2001-02-25 14:37:12 +00:00
Michael Natterer
539ee1fe28 commented out "text_width" and "text_height"
2001-02-24  Michael Natterer  <mitch@gimp.org>

	* app/pixmaps2.h: commented out "text_width" and "text_height"

	* app/tools/Makefile.am
	* app/tools/text_tool.[ch]: "It was really dead, Jim!"

	* app/tools/tool.c: removed STUBs

	* app/tools/tools.c: register it.
2001-02-24 21:06:48 +00:00
Michael Natterer
17335326d5 updated.
2001-02-24  Michael Natterer  <mitch@gimp.org>

	* TODO.xml: updated.

	* app/appenums.h
	* app/apptypes.h: prefixed the cursor stuff with "Gimp", added
	the new stock tool cursor enum. Removed the old ToolType enum.

	* app/cursorutil.[ch]
	* app/gdisplay.[ch]: removed the old ToolType enum and prefixed
	the functions with "gimp_". Also stripped all "toggle cursor"
	stuff from the cursor code, so the new API is easier and not
	depending on the tool system.

	All existing tool cursors can be used via the new stock tool
	cursor enum, so no tool has to fiddle around with bitmap cursors.
	There will be an cursorutil function for registering stock tool
	cursor types on the fly.

	* app/disp_callbacks.c
	* app/scroll.[ch]: moved the display scrollbar callbacks from
	scroll.[ch] to disp_callbacks.c. Removed some crap from scroll.h

	* app/tools/tool.[ch]: removed the BitmapCursor pointers from the
	tool class struct and add cursor and toggle cursor IDs to the
	GimpTool struct. Work in progress.

	* app/dialog_handler.c
	* app/tools/bezier_select.c
	* app/tools/blend.c
	* app/tools/bucket_fill.c
	* app/tools/by_color_select.c
	* app/tools/clone.c
	* app/tools/color_picker.c
	* app/tools/convolve.c
	* app/tools/crop.c
	* app/tools/dodgeburn.c
	* app/tools/edit_selection.c
	* app/tools/ellipse_select.c
	* app/tools/flip_tool.c
	* app/tools/free_select.c
	* app/tools/fuzzy_select.c
	* app/tools/ink.c
	* app/tools/iscissors.c
	* app/tools/magnify.c
	* app/tools/measure.c
	* app/tools/move.c
	* app/tools/paint_core.[ch]
	* app/tools/perspective_tool.c
	* app/tools/rect_select.c
	* app/tools/rotate_tool.c
	* app/tools/scale_tool.c
	* app/tools/shear_tool.c
	* app/tools/text_tool.c
	* app/tools/transform_core.[ch]: changed accordingly. Did this
	"blind" for most tools because they don't compile. The changes are
	minimal, so there should be no conflicts.
2001-02-24 19:29:47 +00:00
Michael Natterer
04f7131848 added cmd_callbacks for the toolbox and the preferences dialog.
2001-02-24  Michael Natterer  <mitch@gimp.org>

	* app/commands.[ch]: added cmd_callbacks for the toolbox and
	the preferences dialog.

	* app/context_manager.c: cleanup.

	* app/gimppreview.[ch]: made gimp_preview_render() public.

	* app/gimptoolinfopreview.c
	* app/tools/gimptoolinfo.c: the tool previews look nice now but
	are still ugly implemented (it renders tons of temp_bufs on each
	state change).

	* app/indicator_area.[ch]: pass a context to the constructor.

	* app/menus.c: don't call the toolbox and the prefs dialog
	directly but dispatch via commands.[ch]

	* app/preferences_dialog.[ch]
	* app/toolbox.[ch]: renamed the constructor / raise function, cleanup.

	* app/tools/color_picker.c: tried to get the shortcut working again.

	* app/tools/paint_options.c: the brush dialog's paint options
	are shown/hidden from the context manager now.
2001-02-24 02:42:09 +00:00
Michael Natterer
3eb62f8756 removed crap from ancient times when tools used to be an enum.
2001-02-23  Michael Natterer  <mitch@gimp.org>

	* app/app_procs.c: removed crap from ancient times when tools
	used to be an enum.

	* app/brush_select.[ch]: cleaned up the gui and made global paint
	mode toggling much simpler by expanding vertically instead of
	reparenting.

	* app/context_manager.c: removed hack by using a tool manager
	accessor function.

	* app/gimpcontext.c: use the new standard tool info object. Tools
	also _behave_ like all other data types now (can e.g. be
	refreshed).

	* app/tools/tool.[ch]

	* app/tools/gimptoolinfo.[ch]: added an "identifier" which is an
	untranslated string with a meaningful prefix and name, e.g.
	"gimp:color_picker_tool". Renamed "tool_name" and "tool_desc"
	to "blurb" and "help", changed the constructor accordingly.
	Added gimp_tool_info_get_standards() to make the context work
	with tool refresh.

	* app/tools/tool_manager.[ch]
	* app/tools/tools.c: removed the global list of tool class
	structures because the tool info list is in place.
	Added tool_manager_register_tool_options() which calls
	tool_options_dialog_add() and registers the options in the
	global_tool_info_list.

	* app/tools/Makefile.am
	* app/tools/paint_options.[ch]
	* app/tools/selection_options.[ch]
	* app/tools/tool_options.[ch]
	* app/tools/tool_options_dialog.[ch]: build them all again. This
	is mostly the old tool options system with minor modifications to
	work with the new stuff. The tool options auto-update with the user
	context now, so there are no update functions any more.

	* app/gimpdnd.c
	* app/toolbox.c
	* app/tools/color_picker.c
	* app/tools/measure.c
	* app/tools/move.c: changed accordingly.
2001-02-23 21:32:47 +00:00
Michael Natterer
69ba1531cb app/Makefile.am app/apptypes.h new widget.
2001-02-23  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/apptypes.h
	* app/gimptoolinfopreview.[ch]: new widget.

	* app/gimppreview.c
	* app/tools/gimptoolinfo.c
	* app/gimpdnd.c: changed for the tool info preview. Still buggy
	and looks a bit funny at the moment :-)

	* app/commands.[ch]
	* app/menus.c: small new feature: shift-X toggles the whole context.
2001-02-23 03:29:53 +00:00
Michael Natterer
9417fa1db7 forgot one s/gimptool/gimptool-1.4/
2001-02-21  Michael Natterer  <mitch@gimp.org>

	* configure.in: forgot one s/gimptool/gimptool-1.4/

	* app/appenums.h: removed "UPDATE_CURSOR" from the ToolAction enum.

	* app/context_manager.c: removed the toolbox toggle button updating
	code here...

	* app/toolbox.c: ...and handle it in the toolbox itself.

	* app/devices.c: removed some obsolete old tool suff.

	* app/tools/Makefile.am
	* app/tools/move.[ch]: reactivated. Disabled the edit_selection
	stuff for now. We need a way to temporary push tools to some stack
	of the tool manager.

	* app/tools/tool.[ch]: removed lot of stuff that is obsolete or
	handled by the GimpToolInfo object now.

	* app/tools/tool_manager.[ch]: stripped all tool options stuff
	because they will be able to follow tool changes themselves.
	Renamed some functions to be consistent.

	* app/tools/tools.c: register the move tool again.

	* app/cursorutil.c
	* app/disp_callbacks.c
	* app/gimage_mask.c
	* app/global_edit.c
	* app/tools/color_picker.c
	* app/tools/measure.[ch]
	* app/tools/tool_options.c: changed accordingly.
2001-02-21 21:56:39 +00:00
Michael Natterer
99c5201870 Made the tool system work again and integrated it back with the
2001-02-21  Michael Natterer  <mitch@gimp.org>

	Made the tool system work again and integrated it back with the
	GimpContext. It's a hack between old, new and freshly hacked
	stuff. There are still lots of warnings but at least we can switch
	tools again.

	* app/tools/Makefile.am
	* app/tools/gimptoolinfo.[ch]: resurrected as real object.
	The GimpToolInfo objects are derived from GimpData, which gives
	us the tool icon stuff for free. Also, we need a list of _objects_
	which is allocated all the time. All tools are required to have
	a "register" function which registers themselves with the list
	of GimpToolInfo objects which is maintained by the tool manager.

	* app/tools/tool.[ch]: made a real GtkObject with properly named
	functions out of it. The former "active_tool_control" is of
	course not the default implementation of the tool's "control"
	method but a hack _around_ it, so it went to the tool manager.

	* app/tools/color_picker.[ch]
	* app/tools/measure.[ch]: ditto. Added "register" functions and
	"destroy" implementations so the tools go away after use.

	* app/tools/tool_manager.[ch]: badly hacked at the moment to keep
	both the list of class structures _and_ the tool info list.

	* app/tools/tools.c: call the tools' register functions.

	* app/gimpcontext.[ch]: store a pointer to a GimpToolInfo object
	as "active_tool" in the context, so we're independent of tools
	being allocated or not. It's treated just like a brush or pattern
	now.

	* app/gimpdnd.[ch]: made tool DND work like all other DND types.

	* app/devices.[ch]: also here: the tool is just a normal data object
	now, resulting in removal of lots of code.

	* app/commands.c
	* app/context_manager.c: updated the tool select and context stuff
	to work again.

	* app/toolbox.c: removed the old pixmap buttons and put GimpPreviews
	inside the tool buttons. Still needs an own preview type to
	look nice.

	* app/disp_callbacks.c
	* app/about_dialog.c
	* app/app_procs.c
	* app/appenums.h
	* app/apptypes.h
	* app/gimage.c
	* app/gimppalette.c
	* app/gimppreview.c
	* app/gimprc.c
	* app/info_window.c
	* app/menus.c
	* app/palette_select.h
	* app/scale.c
	* app/scroll.c: lots of changes to make it work again.
2001-02-21 12:18:09 +00:00
Sven Neumann
9e131cb249 converted gimage->layers and gimage->channels to GimpLists.
2001-02-19  Sven Neumann  <sven@gimp.org>

	* app/gimpimage.[ch]: converted gimage->layers and gimage->channels
	to GimpLists.

	* app/channel_ops.c
	* app/channels_dialog.c
	* app/commands.c
	* app/convert.c
	* app/floating_sel.c
	* app/gdisplay.c
	* app/gimpdrawable.c
	* app/layers_dialog.c
	* app/resize.c
	* app/undo.c
	* app/xcf.c
	* app/pdb/display_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/tools/crop.c
	* app/tools/edit_selection.c
	* tools/pdbgen/pdb/display.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed accordingly
2001-02-19 13:06:09 +00:00
Seth Burgess
72e138b752 Added in measure tool again
Modified Files:
 	ChangeLog app/tools/Makefile.am app/tools/measure.c
 	app/tools/measure.h app/tools/color_picker.c
 	app/tools/color_picker.h app/tools/tools.c
2001-02-17 19:49:44 +00:00
Michael Natterer
22371de3e7 added a note about apptype.h and about not including headers in headers.
2001-02-14  Michael Natterer  <mitch@gimp.org>

	* HACKING: added a note about apptype.h and about not including
	headers in headers.

	* app/apptypes.h: added GimpTool and BitmapCursor.

	* app/cursorutil.h
	* app/devices.h
	* app/draw_core.h
	* app/tools/color_picker.h
	* app/tools/tool.h
	* app/tools/tool_options.h
	* app/gimpcontext.h: removed includes of "tools/tool.h"

	* app/gimprc.[ch]: indentadion cleanup, added
	"module_db_load_inhibit".

	* app/module_db.c: removed the above variable here.

	* app/gimpdata.[ch]: added a vitrual "duplicate" method.

	* app/gimpbrush.[ch]
	* app/gimpbrushgenerated.[ch]
	* app/gimpbrushpipe.[ch]
	* app/gimpgradient.[ch]
	* app/gimppalette.[ch]
	* app/gimppattern.[ch]: all "load", "new" and "get_standard"
	functions return a GimpData pointer now.

	* app/gimpdatafactory.[ch]: made some stuff const.

	* app/gimpdatafactoryview.c: activate the "duplicate" button and
	set the initial button sensitivity correctly.

	* app/brush_select.c
	* app/gradient_select.c
	* app/pattern_select.c: use the new GimpDataFactoryView.

	* libgimp/Makefile.am: grouped the file to sort out what _may_
	go to subdirs or separate libs.

	* libgimp/gimpenv.[ch]: added many "const".

	* app/app_procs.c
	* app/brush_edit.c
	* app/gimpcontext.c
	* app/gimpdnd.c
	* app/gradient_editor.c
	* app/palette.c
	* app/palette_import.c
	* app/user_install.c: many related changes.

	* libgimpmath/gimpmathtypes.h
	* libgimpmath/gimpvector.[ch]: minor cleanups.

	* plug-ins/script-fu/script-fu.c: gimp_data_directory() is const now.
2001-02-14 14:57:14 +00:00
Nate Summers
d234db5419 doh! 2001-02-14 05:19:55 +00:00
Nate Summers
ac6149fb86 forgot a file 2001-02-14 05:16:58 +00:00
Nate Summers
35ac032ff1 prototype for an extension that allows gmodules as plugins. Known bug:
* plug-ins/plugin-helper/*: prototype for an extension that allows
        gmodules as plugins.  Known bug: crashes on gmodules with a static "query" function

        * app/tools/tool.c
        * app/tools/tool.h: created new GimpTool object.  Did away with ToolInfo.
        Most tools still need to be ported over to the new api.
        * plug-ins/script-fu/script-fu-scripts.c: fixed typo in comment.  Pathetic, huh?
2001-02-14 04:55:21 +00:00
Michael Natterer
07300cf385 app/Makefile.am app/gradientP.h removed.
2001-02-10  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gradientP.h
	* app/gradient_header.h: removed.

	* app/gimpgradient.[ch]: new object -- bye bye "gradient_t"

	* app/gradients.[ch]: new files for managing the gradient list.

	* app/gradient.[ch]: containes only the gradient editor now (which
	still badly poked aroung in the GimpGradient structure).

	* app/app_procs.c
	* app/apptypes.h
	* app/devices.c
	* app/gimpcontainerlistview.c
	* app/gimpcontext.[ch]
	* app/gimpcontextpreview.[ch]
	* app/gimpdnd.[ch]
	* app/gradient_select.[ch]
	* app/indicator_area.c
	* app/palette_import.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/gradients_cmds.c
	* app/tools/airbrush.c
	* app/tools/blend.c
	* app/tools/paint_core.c
	* app/tools/paintbrush.c
	* app/tools/pencil.c
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb: changed accordingly, some
	changes to the preview and view stuff.

	* app/gimppreview.[ch]: removed the "context" attribute again
	because it was overkill (a simple gtk_signal-connect_object does
	the same as doing the autoconnection magic inside the GimpPreview
	object).

	* app/commands.[ch]
	* app/menus.c: example views on the gradient container.
2001-02-10 19:35:29 +00:00
Michael Natterer
3675004ef6 app/gimpbrush.[ch] moved the scale and pipe indicator rendering code from
2001-02-07  Michael Natterer  <mitch@gimp.org>

	* app/gimpbrush.[ch]
	* app/gimpbrushpreview.c: moved the scale and pipe indicator
	rendering code from GimpBrush to GimpBrushPreview.
	Removed the "dirty" signal from GimpBrush and use
	"invalidate_preview" of the GimpViewable class.

	* app/brush_edit.c
	* app/brush_select.c
	* app/gimpbrushgenerated.c
	* app/gimpcontext.c
	* app/gimpcontextpreview.c
	* app/tools/paint_core.c: changed accordingly.
2001-02-07 03:14:38 +00:00
Simon Budig
2ce2ed61c7 libgimpwidgets/gimpdialog.c app/tools/tool_options_dialog.c
2001-02-06  Simon Budig  <simon@gimp.org>

        * libgimpwidgets/gimpdialog.c
        * app/tools/tool_options_dialog.c

        Implemented a way to connect the delete-event of a gimpdialog
        without adding an extra button. If you pass "_delete_event_"
        as button text (untranslated) the button will not be created.

        Removed the tool-options "Close" button. Lots of other Close-Buttons
        wait for their removal.
2001-02-06 17:53:33 +00:00
Michael Natterer
f029c6b59f app/Makefile.am app/apptypes.h new object. Everything that can have a
2001-02-04  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/apptypes.h
	* app/gimpviewable.[ch]: new object. Everything that can have a
	preview will be a GimpViewable. The virtual functions are
	"invalidate_preview", "preview" and "preview_new".

	* app/gimpmarshal.[ch]: new marshaller needed for the viewable.

	* app/gimpdrawable.[ch]
	* app/gimpimage.[ch]: derived from GimpViewable. Removed the
	preview stuff from the public interface.

	Made a single boolean out of GimpImage's "comp_preview_valid"
	array because we have only one copposite preview.

	* app/gimplayer.c: made the preview stuff private.

	* app/gimppreviewcache.[ch]: removed gimp_preview_scale()...

	* app/temp_buf.[ch]: ...and added it as temp_buf_scale() here.

	* app/gimpdrawablepreview.[ch]: is a private method of
	GimpDrawable now.

	* app/channels_dialog.c
	* app/convert.c
	* app/drawable.c
	* app/fileops.c
	* app/floating_sel.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimpchannel.c
	* app/gimpcontainer.c
	* app/gimpdnd.c
	* app/layer_select.c
	* app/layers_dialog.c
	* app/lc_dialog.c
	* app/nav_window.c
	* app/palette_import.c
	* app/undo.c
	* app/undo_history.c
	* app/pdb/drawable_cmds.c
	* app/pdb/image_cmds.c
	* app/tools/crop.c
	* app/tools/edit_selection.c
	* app/tools/ink.c
	* app/tools/paint_core.c
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/image.pdb
	* po/POTFILES.in: changed accordingly.
2001-02-04 22:10:54 +00:00
Michael Natterer
78a8bb4c70 app/Makefile.am new object.
2001-02-04  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimppattern.[ch]: new object.

	* app/apptypes.h: added GimpPattern, removed GPattern.

	* app/patterns.[ch]: contains only the "patterns_()" functions for
	the global pattern list, s/pattern_list/global_pattern_list/g

	* app/brushes.[ch]: s/brush_list/global_brush_list/g

	* app/pattern_select.[ch]
	* app/gimpcontext.[ch]: connect to the Patterns' and the pattern
	list's signals.

	* app/brush_select.[ch]
	* app/devices.c
	* app/disp_callbacks.[ch]
	* app/gimpbrush.c
	* app/gimpbrushgenerated.[ch]
	* app/gimpcontextpreview.[ch]
	* app/gimpdnd.[ch]
	* app/indicator_area.c
	* app/pdb/brush_select_cmds.c
	* app/pdb/brushes_cmds.c
	* app/pdb/pattern_select_cmds.c
	* app/pdb/patterns_cmds.c
	* app/tools/bucket_fill.c
	* app/tools/clone.c
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/patterns.pdb
	* po/POTFILES.in: changed accordingly.
2001-02-04 17:34:30 +00:00
Michael Natterer
1994facc9e renamed gimp_container_lookup() back to gimp_container_have(). Virtualized
2001-02-04  Michael Natterer  <mitch@gimp.org>

	* app/gimpcontainer.[ch]: renamed gimp_container_lookup() back
	to gimp_container_have(). Virtualized the "add", "remove",
	"have" and "foreach" methods and removed the "children" list.

	* app/gimplist.[ch]: derived from GimpContainer now.

	* app/Makefile.am
	* app/gimpdatalist.[ch]: new object: an alphabetically sorted
	GimpList with unique names.

	* app/gimpbrushlist.[ch]: removed. It's job is done by the
	GimpDataList now.

	* app/brushes.[ch]: new files. Contain the "brushes_()" functions
	for the global brush list.

	* app/app_procs.c
	* app/apptypes.h
	* app/brush_select.[ch]
	* app/colormap_dialog.[ch]
	* app/context_manager.c
	* app/devices.c
	* app/gimpbrush.c
	* app/gimpcontext.c
	* app/gimpdnd.c
	* app/info_window.c
	* app/lc_dialog.c
	* app/module_db.c
	* app/nav_window.c
	* app/pdb/brush_select_cmds.c
	* app/pdb/brushes_cmds.c
	* app/tools/by_color_select.c
	* app/tools/paintbrush.c
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* po/POTFILES.in: changed accordingly.
2001-02-04 14:10:03 +00:00
Nick Lamb /GIMP
4f89fddec0 add <stdlib.h> and/or <string.h> headers where needed 2001-02-04 04:51:17 +00:00
Michael Natterer
c46bdc37f0 app/Makefile.am removed.
2001-02-03  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimpset.[ch]: removed.

	* app/gimpcontainer.[ch]: some minor fixes, cleanup.

	* app/context_manager.[ch]: made the "image_context" a GimpContainer
	and moved it here...

	* app/appenv.h
	* app/main.c: ...from here.

	* app/app_procs.c
	* app/colormap_dialog.[ch]
	* app/commands.c
	* app/gimage.c
	* app/gimpcontext.c
	* app/gimpimage.c
	* app/info_window.c
	* app/lc_dialog.c
	* app/lut_funcs.c
	* app/module_db.c
	* app/nav_window.c
	* app/palette_import.c
	* app/paths_dialog.c
	* app/pixel_region.c
	* app/scale.c
	* app/scroll.c
	* app/selection.c
	* app/temp_buf.c
	* app/undo.c
	* app/pdb/procedural_db.c
	* app/tools/by_color_select.c
	* app/tools/clone.c
	* app/tools/color_balance.c
	* app/tools/color_picker.c
	* app/tools/convolve.c
	* app/tools/crop.c
	* app/tools/curves.c
	* app/tools/paint_core.c
	* app/tools/transform_core.c: s/GimpSet/GimpContainer/g, removed
	many useless #include "appenv.h".

	* app/gimpdrawablepreview.c
	* app/gdisplay.c: found two badly crashing bugs i have introduced
	with my last changes here.
2001-02-03 22:05:41 +00:00
Michael Natterer
dde74f9735 app/Makefile.am app/gimpchannel.[ch] new files moved here by Yosh.
2001-02-01  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimpchannel.[ch]
	* app/gimplayer.[ch]: new files moved here by Yosh.

	* app/channel.[ch]
	* app/layer.[ch]: removed.

	* app/gdisplay.c: cleanup stuff.

	* app/[lotsa files].c
	* tools/pdbgen/Makefile.am
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/floating_sel.pdb
	* tools/pdbgen/pdb/layer.pdb: changed includes accordingly.
2001-02-01 18:44:22 +00:00
Michael Natterer
227eea67cb app/Makefile.am new file.
2001-01-29  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/undo_history.h: new file.

	* app/apptypes.h: removed the "Channel" typedef.

	* app/channel.[ch]: renamed all functions to gimp_channel_*()

	* app/channel_ops.c
	* app/channels_dialog.c
	* app/commands.c
	* app/disp_callbacks.c
	* app/gdisplay.c
	* app/gimage_mask.[ch]
	* app/gimpdnd.c
	* app/gimphistogram.c
	* app/gimpimage.[ch]
	* app/global_edit.c
	* app/layer.c
	* app/layers_dialog.c
	* app/qmask.c
	* app/scan_convert.c
	* app/scan_convert.h
	* app/toolbox.c
	* app/undo.[ch]
	* app/undo_history.c
	* app/xcf.[ch]
	* app/pdb/channel_cmds.c
	* app/pdb/color_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/pdb_glue.h
	* app/pdb/selection_cmds.c
	* app/pdb/tools_cmds.c
	* app/tools/bezier_select.c
	* app/tools/bezier_selectP.h
	* app/tools/blend.c
	* app/tools/bucket_fill.c
	* app/tools/by_color_select.c
	* app/tools/crop.c
	* app/tools/ellipse_select.c
	* app/tools/free_select.c
	* app/tools/fuzzy_select.c
	* app/tools/fuzzy_select.h
	* app/tools/iscissors.c
	* app/tools/rect_select.c
	* app/tools/text_tool.c
	* app/tools/transform_core.c
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/tools.pdb: changed accordingly.
2001-01-29 02:45:02 +00:00
Michael Natterer
d3dcfadccf app/pdb/Makefile.am new file which contains the stuff that makes PDB code
2001-01-29  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/pdb_glue.h: new file which contains the stuff that makes
	PDB code generation easier but is ugly when used in the app
	(see my comment in the log below).

	Contains:
	gimp_drawable_[layer|layer_mask|channel]()
	[channel|gimp_layer]_[set|get]_[name|tattoo]()

	* app/channel.[ch]
	* app/channels_dialog.c
	* app/gimpdrawable.h
	* app/gimpimage.c
	* app/gimplayermask.h
	* app/layer.c
	* app/layer.h
	* app/toolbox.c
	* app/undo.c
	* app/xcf.c
	* app/pdb/channel_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/layer_cmds.c
	* app/pdb/selection_cmds.c
	* app/tools/bezier_select.c
	* app/tools/bucket_fill.c
	* app/tools/by_color_select.c
	* app/tools/ellipse_select.c
	* app/tools/free_select.c
	* app/tools/fuzzy_select.c
	* app/tools/iscissors.c
	* app/tools/rect_select.c
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/selection.pdb: changed accordingly.
2001-01-29 00:46:04 +00:00
Michael Natterer
a2ae989ff3 removed the "Layer" typedef.
2001-01-29  Michael Natterer  <mitch@gimp.org>

	* app/apptypes.h: removed the "Layer" typedef.

	* app/layer.[ch]: removed the defines of the old function names.

	Don't implement methods of the parent class (get_name, get_tattoo, ...)
	but define them as macros. They will go to a separate "pdb_glue.h"
	header because they are used only by the PDB to simplify code
	generation (no application file should say gimp_layer_get_tattoo()
	but always gimp_drawable_get_tatoo()).

	* app/channel.h
	* app/channel_ops.c
	* app/channels_dialog.c
	* app/commands.c
	* app/convert.c
	* app/disp_callbacks.c
	* app/floating_sel.[ch]
	* app/gdisplay.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimage_mask.h
	* app/gimpdnd.c
	* app/gimpdrawable.h
	* app/gimpimage.[ch]
	* app/gimplayermask.h
	* app/global_edit.c
	* app/image_new.c
	* app/layer_select.c
	* app/layers_dialog.c
	* app/resize.c
	* app/undo.c
	* app/xcf.[ch]
	* app/pdb/drawable_cmds.c
	* app/pdb/floating_sel_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/tools/bucket_fill.c
	* app/tools/by_color_select.c
	* app/tools/clone.c
	* app/tools/crop.c
	* app/tools/edit_selection.c
	* app/tools/ink.c
	* app/tools/move.c
	* app/tools/paint_core.c
	* app/tools/rect_select.c
	* app/tools/text_tool.c
	* app/tools/transform_core.c
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/floating_sel.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed accordingly, cleanup.
2001-01-28 23:25:25 +00:00
Michael Natterer
8ddebdf79a app/Makefile.am new files cut out of layer.[ch]. Renamed all functions to
2001-01-28  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimplayermask.[ch]: new files cut out of layer.[ch]. Renamed
	all functions to gimp_layes_mask_*(). removed artefacts like
	the ref/unref functions.

	* app/apptypes.h: removed the "LayerMask" typedef.

	* app/layer.[ch]: removed the layer mask stuff and renamed all
	functions to gimp_layer_*(). Added temporary typedefs for the old
	function names. The layer mask preview stuff is still there (should
	probably go to new layer_preview.{ch] files).

	* app/gimpimage.[ch]: added
	gimp_image_invalidate_[layer|channel]_previews() formerly known as
	[layer|channel]_invalidate_previews().

	* app/channel.[ch]: moved channel_layer_alpha() and
	channel_layer_mask() here because they are methods of the Channel.

	* app/channel_ops.c
	* app/convert.c
	* app/disp_callbacks.c
	* app/fileops.c
	* app/floating_sel.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimpdnd.c
	* app/global_edit.c
	* app/layers_dialog.c
	* app/preferences_dialog.c
	* app/toolbox.c
	* app/undo.c
	* app/xcf.c
	* app/pdb/drawable_cmds.c
	* app/pdb/image_cmds.c
	* app/pdb/layer_cmds.c
	* app/tools/crop.c
	* app/tools/text_tool.c
	* app/tools/transform_core.c
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/drawable.pdb: changed accordingly, cleanup.
2001-01-28 16:44:22 +00:00
Michael Natterer
7a4260da70 Makefile.am configure.in added the new library below.
2001-01-24  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* configure.in
	* gimptool.in: added the new library below.

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpchainbutton.[ch]
	* libgimpwidgets/gimpcolorarea.[ch]
	* libgimpwidgets/gimpcolorbutton.[ch]
	* libgimpwidgets/gimpdialog.[ch]
	* libgimpwidgets/gimpfileselection.[ch]
	* libgimpwidgets/gimphelpui.[ch]
	* libgimpwidgets/gimppatheditor.[ch]
	* libgimpwidgets/gimppixmap.[ch]
	* libgimpwidgets/gimpquerybox.[ch]
	* libgimpwidgets/gimpsizeentry.[ch]
	* libgimpwidgets/gimpunitmenu.[ch]
	* libgimpwidgets/gimpwidgets.[ch]
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgetstypes.h: new shared library.

	Currently there are some ugly dependencies into libgimp. These
	will be removed and go to a "libgimpglue" library which will be
	a library for functions which share a common interface between
	plug-ins and the app but have different implementations.

	Include "libgimp/gimpunit.h" from "libgimpwidgets/gimpwidgetstypes.h"
	to simulate this upcoming separation.

	* libgimp/Makefile.am
	* libgimp/gimpchainbutton.[ch]
	* libgimp/gimpcolorarea.[ch]
	* libgimp/gimpcolorbutton.[ch]
	* libgimp/gimpdialog.[ch]
	* libgimp/gimpfileselection.[ch]
	* libgimp/gimphelpui.[ch]
	* libgimp/gimppatheditor.[ch]
	* libgimp/gimppixmap.[ch]
	* libgimp/gimpquerybox.[ch]
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimpunitmenu.[ch]
	* libgimp/gimpwidgets.[ch]: removed from here.

	* libgimp/gimpui.h
	* libgimp/gimpuitypes.h
	* libgimp/makefile.mingw.in
	* libgimp/makefile.msc: changed accordingly.

	* app/[all ui files]
	* app/pdb/palette_cmds.c
	* app/pdb/tools_cmds.c
	* tools/pdbgen/pdb/palette.pdb
	* tools/pdbgen/pdb/tools.pdb: #include "libgimpwidgets/gimpwidgets.h"
	and removed useless includes.

	* app/apptypes.h: #include "libgimpwidgets/gimpwidgetstypes.h"

	* app/Makefile.am
	* plug-ins/[all makefiles which link against libgimpui]:
	link against libgimpwidgets.la

	* po-libgimp/POTFILES.in: changed file locations.
2001-01-24 22:36:18 +00:00
Sven Neumann
5439fe5b01 app/tools/airbrush.c app/tools/by_color_select.c include
2001-01-24  Sven Neumann  <sven@gimp.org>

	* app/tools/airbrush.c
	* app/tools/by_color_select.c
	* app/tools/color_picker.c: include gimpcolor/gimpcolor.h

	* libgimpcolor/gimprgb.c: optimized compositing functions.

	* plug-ins/Lighting/lighting_preview.c
	* plug-ins/MapObject/mapobject_preview.c: use gimp_rgb_composite
	functions instead of doing the blending manually

	* plug-ins/MapObject/map_object_shade.c: fixed a rendering bug when
	transparent_background == FALSE
2001-01-24 12:21:50 +00:00
Michael Natterer
cb16697229 Makefile.am configure.in added stuff for the new library below.
2001-01-24  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* configure.in
	* gimptool.in: added stuff for the new library below.

	* libgimpmath/.cvsignore
	* libgimpmath/Makefile.am
	* libgimpmath/gimpmath.def
	* libgimpmath/gimpmath.h
	* libgimpmath/gimpmathtypes.h
	* libgimpmath/gimpmatrix.c
	* libgimpmath/gimpmatrix.h
	* libgimpmath/gimpvector.c
	* libgimpmath/gimpvector.h
	* libgimpmath/makefile.mingw.in
	* libgimpmath/makefile.msc: new shared library. Depends on glib only.

	* libgimp/Makefile.am
	* libgimp/gimp.def
	* libgimp/gimp.h: removed the math stuff.

	* libgimp/gimpmath.h
	* libgimp/gimpmatrix.[ch]
	* libgimp/gimpvector.[ch]: removed.

	* app/Makefile.am
	* plug-ins/Lighting/Makefile.am
	* plug-ins/MapObject/Makefile.am
	* plug-ins/pagecurl/Makefile.am: link against libgimpmath.la

	* app/[many files]
	* libgimpcolor/gimpcolorspace.c
	* libgimpcolor/gimprgb.c
	* libgimp/gimpadaptivesupersample.c
	* libgimp/gimpbilinear.c
	* libgimp/gimpwidgets.c
	* modules/colorsel_gtk.c
	* modules/colorsel_triangle.c
	* modules/colorsel_water.c
	* plug-ins/libgck/gck/gckcolor.c
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/image.pdb: include "libgimpmath/gimpmath.h",
	removed the remaining includes of the old color stuff.
2001-01-23 23:56:18 +00:00
Michael Natterer
e803beddd4 Makefile.am configure.in added stuff for the new library below.
2001-01-23  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* configure.in
	* gimptool.in: added stuff for the new library below.

	* libgimpcolor/.cvsignore
	* libgimpcolor/Makefile.am
	* libgimpcolor/gimpcolor.h
	* libgimpcolor/gimpcolorspace.c
	* libgimpcolor/gimpcolorspace.h
	* libgimpcolor/gimpcolortypes.h
	* libgimpcolor/gimphsv.c
	* libgimpcolor/gimphsv.h
	* libgimpcolor/gimprgb.c
	* libgimpcolor/gimprgb.h: new shared library which both the app
	and plug-ins link against. The library depends only on glib.

	* libgimpcolor/gimpcolor.def
	* libgimpcolor/makefile.mingw.in
	* libgimpcolor/makefile.msc: added Win32 build files which
	definitely don't work.

	* libgimp/Makefile.am
	* libgimp/gimpcolor.[ch]
	* libgimp/gimpcolorspace.[ch]: removed.

	* libgimp/gimp.h
	* libgimp/gimpadaptivesupersample.c
	* libgimp/gimpbilinear.c
	* libgimp/gimppalette.c
	* libgimp/gimptypes.h: include the stuff from libgimpcolor.

	Plug-Ins don't need to include <libgimpcolor/gimpcolor.h>
	explicitely. LibGimp depends on libgimpcolor and thus also includes
	it's headers.

	* libgimp/gimp.def
	* libgimp/makefile.mingw.in: fiddled around with Win32 stuff...

	* app/Makefile.am: link against libgimpcolor.la

	* app/apptypes.h: include "libgimpcolor/gimpcolortypes.h"

	* app/asupsample.c
	* app/channels_dialog.c
	* app/colormap_dialog.c
	* app/commands.c
	* app/convert.c
	* app/devices.c
	* app/disp_callbacks.c
	* app/drawable.c
	* app/gimpcontext.c
	* app/gimpdnd.c
	* app/gimpimage.c
	* app/gimppalette.c
	* app/gimprc.c
	* app/gradient.c
	* app/libgimp_glue.c
	* app/palette.c
	* app/palette_import.c
	* app/qmask.c
	* app/xcf.c
	* app/tools/paint_core.c
	* app/tools/paintbrush.c
	* app/tools/pencil.c: include "libgimpcolor/gimpcolor.h" before all
	gimp includes because it's a standalone library.

	* plug-ins/FractalExplorer/Makefile.am
	* plug-ins/Lighting/Makefile.am
	* plug-ins/MapObject/Makefile.am
	* plug-ins/bmp/Makefile.am
	* plug-ins/common/Makefile.am
	* plug-ins/common/mkgen.pl
	* plug-ins/dbbrowser/Makefile.am
	* plug-ins/faxg3/Makefile.am
	* plug-ins/fits/Makefile.am
	* plug-ins/flame/Makefile.am
	* plug-ins/fp/Makefile.am
	* plug-ins/gap/Makefile.am
	* plug-ins/gdyntext/Makefile.am
	* plug-ins/gfig/Makefile.am
	* plug-ins/gflare/Makefile.am
	* plug-ins/gfli/Makefile.am
	* plug-ins/gimpressionist/Makefile.am
	* plug-ins/helpbrowser/Makefile.am
	* plug-ins/ifscompose/Makefile.am
	* plug-ins/imagemap/Makefile.am
	* plug-ins/maze/Makefile.am
	* plug-ins/mosaic/Makefile.am
	* plug-ins/pagecurl/Makefile.am
	* plug-ins/print/Makefile.am
	* plug-ins/rcm/Makefile.am
	* plug-ins/script-fu/Makefile.am
	* plug-ins/sel2path/Makefile.am
	* plug-ins/sgi/Makefile.am
	* plug-ins/webbrowser/Makefile.am
	* plug-ins/xjt/Makefile.am: add libgimpcolor.la to LDADD.

	* INSTALL: don't recommend to --disable-shared for development.

	* TODO.xml: increased some percentages, added plug-in help stuff.
2001-01-23 18:49:44 +00:00
Sven Neumann
b102101e94 app/convert.c app/floating_sel.c app/gimage_mask.c app/gimpimage.c
2001-01-23  Sven Neumann  <sven@gimp.org>

	* app/convert.c
	* app/floating_sel.c
	* app/gimage_mask.c
	* app/gimpimage.c
	* app/global_edit.c
	* app/image_map.c
	* app/image_new.c
	* app/layer.c
	* app/paint_funcs.c
	* app/pixel_region.c
	* app/tile_manager.c
	* app/tile_manager.h
	* app/tile_manager_pvt.h
	* app/undo.c
	* app/xcf.c
	* app/pdb/tools_cmds.c
	* app/tools/flip_tool.c
	* app/tools/perspective_tool.c
	* app/tools/rotate_tool.c
	* app/tools/scale_tool.c
	* app/tools/shear_tool.c
	* app/tools/text_tool.c
	* app/tools/transform_core.c
	* tools/pdbgen/pdb/tools.pdb: made all files execpt xcf.c use the
	TileManager accessor functions instead of accessing the TileManager
	struct directly.
2001-01-23 13:01:48 +00:00
Michael Natterer
d5221dae9a app/Makefile.am removed.
2001-01-23  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/edit_selection.[ch]: removed.

	* app/tools/Makefile.am
	* app/tools/edit_selection.[ch]: added.
2001-01-23 01:07:50 +00:00
Michael Natterer
75760de9d1 libgimp/Makefile.am libgimp/gimp.h libgimp/gimpadaptivesupersample.[ch]
2001-01-23  Michael Natterer  <mitch@gimp.org>

	* libgimp/Makefile.am
	* libgimp/gimp.h
	* libgimp/gimpadaptivesupersample.[ch]
	* libgimp/gimpbilinear.[ch]: new files cut out of LibGCK.

	* plug-ins/libgck/gck/gck.h
	* plug-ins/libgck/gck/gckcolor.c: removed the bilinear and
	supersample code.

	* app/apptypes.h
	* app/asupsample.[ch]
	* app/tools/blend.c: made the adaptive_supersample interface the
	same as in libgimp but don't use the libgimp function yet.

	The libgimp function takes total transparancy into account when
	weighting the 4 resulting RGBA values, the app function always
	weights them equally. Please have a look at the code.

	* plug-ins/Lighting/lighting_image.c
	* plug-ins/MapObject/mapobject_apply.c
	* plug-ins/MapObject/mapobject_image.[ch]: changed accordingly.

	* app/disp_callbacks.c: paranoia cleanups.
2001-01-23 00:53:12 +00:00
Michael Natterer
234aca2406 app/tools/Makefile.am new files for the tool options dialog.
2001-01-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tool_options_dialog.[ch]: new files for the tool
	options dialog.

	* app/tools/tools.[ch]: removed from here.

	* app/app_procs.c
	* app/commands.c
	* app/toolbox.c
	* po/POTFILES.in: adjusted.
2001-01-22 05:08:44 +00:00
Michael Natterer
cf15da5729 app/Makefile.am removed.
2001-01-22  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/selection_options.h: removed.

	* app/tools/Makefile.am
	* app/tools/selection_options.h: added.

	* app/tools/selection_options.c
	* app/tools/paint_options.c: new files cut out of tool_options.c

	* app/tools/tool_options.c: removed the paint & selection
	options code.

	* app/tools/tool_options.h
	* app/tools/paint_options.h: cleanup.

	* po/POTFILES.in: added selection_options.c and paint_options.c
2001-01-22 04:17:17 +00:00
Sven Neumann
fafae590e3 configure.in app/Makefile.am moved all tool sources to app/tools
2001-01-22  Sven Neumann  <sven@gimp.org>

        * configure.in
        * app/Makefile.am
        * app/tools/Makefile.am: moved all tool sources to app/tools

        * app/app_procs.c
        * app/brush_select.c
        * app/commands.c
        * app/context_manager.c
        * app/convert.c
        * app/cursorutil.c
        * app/devices.c
        * app/disp_callbacks.c
        * app/edit_selection.c
        * app/gdisplay.c
        * app/gimage.c
        * app/gimage_mask.c
        * app/gimpbrush.c
        * app/gimpbrushgenerated.c
        * app/gimpbrushpipe.c
        * app/gimpdnd.c
        * app/gimprc.c
        * app/global_edit.c
        * app/info_window.c
        * app/interface.c
        * app/menus.c
        * app/path.c
        * app/paths_dialog.c
        * app/paths_dialogP.h
        * app/scale.c
        * app/scroll.c
        * app/undo.c
        * app/pdb/color_cmds.c
        * app/pdb/text_tool_cmds.c
        * app/pdb/tools_cmds.c
        * po/POTFILES.in
        * tools/kernelgen.c
        * tools/pdbgen/Makefile.am
        * tools/pdbgen/enums.pl
        * tools/pdbgen/pdb/color.pdb
        * tools/pdbgen/pdb/text_tool.pdb
        * tools/pdbgen/pdb/tools.pdb: changed accordingly
2001-01-22 01:46:28 +00:00
Sven Neumann
6a31b131d1 changed destdir for app-side PDB wrappers to app/pdb
2001-01-21  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/app.pl: changed destdir for app-side PDB wrappers to
	app/pdb

	* app/Makefile.am: don't create libgimpim.a in app.

	* configure.in
	* app/pdb/Makefile.am
	* app/pdb/internal_procs.[ch]
	* app/pdb/procedural_db.[ch]
	* app/pdb/*_cmds.c: moved PDB functions into their own subdirectory.

	* app/internal_procs.[ch]
	* app/procedural_db.[ch]
	* app/*_cmds.c: removed here

	* app/app_procs.c
	* app/batch.c
	* app/bezier_select.c
	* app/brush_select.c
	* app/bucket_fill.c
	* app/colormap_dialog.c
	* app/fileops.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimphelp.c
	* app/gradient_select.c
	* app/info_window.c
	* app/invert.c
	* app/lc_dialog.c
	* app/menus.c
	* app/nav_window.c
	* app/palette_import.c
	* app/paths_dialog.c
	* app/pattern_select.c
	* app/plug_in.h
	* app/text_tool.c
	* app/xcf.c
	* po/POTFILES.in: changed accordingly
2001-01-21 21:58:16 +00:00
Michael Natterer
c31d2639e3 made gradient_get_color_at() use GimpRGB.
2001-01-20  Michael Natterer  <mitch@gimp.org>

	* app/gradient.[ch]: made gradient_get_color_at() use GimpRGB.

	* app/airbrush.c
	* app/blend.c
	* app/gimpcontextpreview.c
	* app/gradient_select.c
	* app/paint_core.[ch]
	* app/paintbrush.c
	* app/palette.c
	* app/pencil.c

	* app/gradients_cmds.c
	* app/gradient_select_cmds.c
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb: changed accordingly.
2001-01-20 16:28:05 +00:00
Michael Natterer
8571f45c77 app/color_notebook.[ch] app/gimpcontext.[ch] made the _set_color() and
2001-01-20  Michael Natterer  <mitch@gimp.org>

	* app/color_notebook.[ch]
	* app/gimpcontext.[ch]
	* app/gimpdnd.h: made the _set_color() and _drop_color() functions
	take a "const GimpRGB *" parameter.

	* app/by_color_select.c
	* app/channels_dialog.c
	* app/color_area.c
	* app/color_panel.c
	* app/color_picker.c
	* app/color_select.c
	* app/colormap_dialog.c
	* app/disp_callbacks.[ch]
	* app/gimpimage.h
	* app/palette.c: changed accordingly.

	* app/gradient.c
	* app/gradientP.h
	* app/gradient_header.h: use GimpRGB internally.
2001-01-20 15:37:26 +00:00
Sven Neumann
7e4c298080 enable drags from and disable drops to the ColorArea in the color_info
2001-01-15  Sven Neumann  <sven@gimp.org>

        * app/color_picker.c: enable drags from and disable drops to
        the ColorArea in the color_info dialog. Changed the cursor_update
        function so it only displays the bad cursor when outside the image.
2001-01-15 19:30:42 +00:00
Sven Neumann
943847677c rewritten as proper widget derived from GimpColorButton
2001-01-15  Sven Neumann  <sven@gimp.org>

	* app/color_panel.[ch]: rewritten as proper widget derived from
	GimpColorButton

	* app/channels_dialog.c
	* app/color_picker.c
	* app/qmask.c: use new GimpColorPanel widget

	* libgimp/gimpcolorarea.[ch]
	* libgimp/gimpcolorbutton.[ch]: some changes needed to derive from
	GimpColorButton

	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/MapObject/mapobject_ui.c
	* plug-ins/common/colorify.c
	* plug-ins/common/colortoalpha.c
	* plug-ins/common/exchange.c
	* plug-ins/common/film.c
	* plug-ins/common/grid.c
	* plug-ins/common/mapcolor.c
	* plug-ins/common/nova.c
	* plug-ins/common/papertile.c
	* plug-ins/common/sinus.c
	* plug-ins/gdyntext/gdyntext_ui.c
	* plug-ins/ifscompose/ifscompose.c
	* plug-ins/script-fu/script-fu-scripts.c: follow API changes of
	GimpColorButton and GimpColorArea
2001-01-15 06:24:24 +00:00
Michael Natterer
dc9cf1a222 app/color_notebook.[ch] app/color_panel.[ch] app/gimpcontext.[ch] use
2001-01-15  Michael Natterer  <mitch@gimp.org>

	* app/color_notebook.[ch]
	* app/color_panel.[ch]
	* app/gimpcontext.[ch]
	* app/gimpdnd.[ch]: use GimpRGB instead of a random selection out of
	guchar, gint, guchar[], blah...

	* app/blend.c
	* app/by_color_select.c
	* app/channel_ops.c
	* app/channels_dialog.c
	* app/color_area.c
	* app/color_picker.c
	* app/color_select.c
	* app/colormap_dialog.c
	* app/commands.c
	* app/devices.[ch]
	* app/disp_callbacks.[ch]
	* app/drawable.c
	* app/gimpimage.c
	* app/gimprc.c
	* app/gradient.c
	* app/paint_core.c
	* app/palette.c
	* app/palette_cmds.c
	* app/qmask.c
	* tools/pdbgen/pdb/palette.pdb: changed accordingly.
2001-01-15 01:48:53 +00:00
Simon Budig
84bb0a5a15 Reordered some tools. It is IMHO more logical to group the "paint-style"
2001-01-14  Simon Budig  <simon@gimp.org>

        * app/tools.c:
        Reordered some tools. It is IMHO more logical to group the
        "paint-style" and the "blur/smudge"-Tools together.
        The Ordering up to now was a "historical" ordering: Not good...

        I am thinking about grouping the "Non-image modifying"-tools
        (Magnify, Colorpicker, Measure tool) together...
2001-01-14 22:48:15 +00:00
Michael Natterer
3220f9ec94 app/channel.[ch] app/drawable.[ch] app/gdisplay.[ch] app/gimpdrawable.[ch]
2001-01-14  Michael Natterer  <mitch@gimp.org>

	* app/channel.[ch]
	* app/drawable.[ch]
	* app/gdisplay.[ch]
	* app/gimpdrawable.[ch]
	* app/layer.[ch]:

	- Removed all "typedef drawable_function gimp_drawable_function".
	- Renamed all *_get_ID() functions to *_get_by_ID().
	- For symmetry reasons, renamed drawable_ID() to gimp_drawable_get_ID().
	- Removed the *_get_ID() functions of GimpLayer, GimpLayerMask
	  and GimpChannel.

	* app/airbrush.c
	* app/bezier_select.c
	* app/blend.c
	* app/brightness_contrast.c
	* app/bucket_fill.c
	* app/by_color_select.c
	* app/clone.c
	* app/color_balance.c
	* app/color_picker.c
	* app/convert.c
	* app/convolve.c
	* app/crop.c
	* app/curves.c
	* app/desaturate.c
	* app/dodgeburn.c
	* app/edit_selection.c
	* app/eraser.c
	* app/fileops.c
	* app/flip_tool.c
	* app/floating_sel.c
	* app/fuzzy_select.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/gimphistogram.c
	* app/gimpimage.c
	* app/global_edit.c
	* app/histogram_tool.c
	* app/hue_saturation.c
	* app/image_map.c
	* app/ink.c
	* app/invert.c
	* app/layer_select.c
	* app/layers_dialog.c
	* app/levels.c
	* app/paint_core.c
	* app/paintbrush.c
	* app/pencil.c
	* app/plug_in.c
	* app/posterize.c
	* app/scan_convert.c
	* app/smudge.c
	* app/text_tool.c
	* app/threshold.c
	* app/transform_core.c
	* app/undo.c
	* app/undo_history.c

	* app/channel_cmds.c
	* app/channel_ops_cmds.c
	* app/color_cmds.c
	* app/display_cmds.c
	* app/drawable_cmds.c
	* app/edit_cmds.c
	* app/floating_sel_cmds.c
	* app/image_cmds.c
	* app/layer_cmds.c
	* app/parasite_cmds.c
	* app/selection_cmds.c
	* app/text_tool_cmds.c
	* app/tools_cmds.c
	* libgimp/gimpdrawable_pdb.c
	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/channel_ops.pdb
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/tools.pdb: changed accordingly.
2001-01-14 21:11:52 +00:00
Sven Neumann
99e80ca55c app/apptypes.h app/brush_select_cmds.c app/brushes_cmds.c app/layer_cmds.c
2001-01-09  Sven Neumann  <sven@gimp.org>

	* app/apptypes.h
	* app/brush_select_cmds.c
	* app/brushes_cmds.c
	* app/layer_cmds.c
	* app/layers_dialog.c
	* app/paint_funcs.c
	* app/tool_options.c
	* app/tools_cmds.c
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: applied patch from <oliver@zeroknowledge.com>
	that adds new blending modes (Dodge/Burn/Hardlight). Please play with
	these new modes and check if they are useful and well-implemented.
2001-01-09 02:45:27 +00:00
Michael Natterer
ab014f8b3a app/by_color_select.c app/channels_dialog.c app/color_area.c
2001-01-07  Michael Natterer  <mitch@gimp.org>

	* app/by_color_select.c
	* app/channels_dialog.c
	* app/color_area.c
	* app/color_notebook.[ch]
	* app/color_panel.[ch]
	* app/color_picker.c
	* app/color_select.c
	* app/colormap_dialog.i.c
	* app/devices.c
	* app/disp_callbacks.[ch]
	* app/gimpdnd.[ch]
	* app/palette.c
	* app/qmask.c

	* libgimp/gimpcolorselector.h

	* modules/colorsel_gtk.c
	* modules/colorsel_triangle.c
	* modules/colorsel_water.c: made the color_notebook, the color_area
	and DND speak in terms of RGBA instead of GRB. The alpha value is
	not used yet, only the API changed. Everything should work exactly
	as before.
2001-01-07 21:07:14 +00:00
Michael Natterer
9b3bbdfe14 app/bezier_select.c removed the obscure unused "extend" variable from the
2001-01-07  Michael Natterer  <mitch@gimp.org>

	* app/bezier_select.c
	* app/bezier_selectP.h: removed the obscure unused "extend" variable
	from the Bezier Tool structure.
2001-01-07 14:43:04 +00:00
Michael Natterer
f9c8140164 reverted the behaviour of the "Reset" button back to resetting the current
2001-01-03  Michael Natterer  <mitch@gimp.org>

	* app/levels.c: reverted the behaviour of the "Reset" button back
	to resetting the current channel only. Resetting all channels was
	broken and IMHO cannot work the way it was implemented.
2001-01-03 02:59:57 +00:00
Simon Budig
15c239274c use floor() before casting to gint when calculating the current brush
2001-01-02  Simon Budig  <simon@gimp.org>

	* app/paint_core.c: use floor() before casting to gint when
	calculating the current brush coordinates. Fixes the jagged brush
	stroke when stroking a path that leaves the image at the top or left
	edge (bug #6043).

telephone-committed by Sven <sven@gimp.org>
2001-01-02 20:25:10 +00:00
Daniel Egger
b4630d410e Use the new _clear function and more cleanups.
2001-01-02  Daniel Egger  <egger@suse.de>

        * app/clone.c:
	* app/gimpimage.c:
	* app/temp_buf.c: Use the new _clear function and more cleanups.
2001-01-02 19:14:24 +00:00
Daniel Egger
b4fc329302 Add a new function "temp_buf_data_clear" to get a nulled chunk of memory.
2001-01-02  Daniel Egger  <egger@suse.de>

        * app/temp_buf.c:
	* app/temp_buf.h: Add a new function "temp_buf_data_clear" to
	get a nulled chunk of memory.

	* app/iscissors.c: Use it here instead of two expensive for
	loops. Clean up the source a little.
2001-01-02 17:01:30 +00:00
Michael Natterer
efc880a3dd app/bezier_select.c app/bezier_selectP.h moved the integer "extend"
2001-01-02  Michael Natterer  <mitch@gimp.org>

	* app/bezier_select.c
	* app/bezier_selectP.h
	* app/selection_options.h: moved the integer "extend" variable from
	SelectionOptions to the BezierSelect structure because it does not
	have a UI widget. Also initialize it with "0" (was used
	uninitialized before). I have no idea what it does.
2001-01-02 15:41:25 +00:00
Michael Natterer
79112edc39 app/selection_options.h made a correct tool toption out of "Interactive"
2001-01-02  Michael Natterer  <mitch@gimp.org>

	* app/selection_options.h
	* app/tool_options.c: made a correct tool toption out of
	"Interactive" (added a default value and the "Reset" function,
	set unused pointers to NULL).

	* app/iscissors.c: fixed indentation and spacing.
2001-01-02 15:22:22 +00:00
Daniel Egger
578b0cb5d8 Applied patch by laramieleavitt@onetel.net.uk to add an interactive update
2001-01-02  Daniel Egger  <egger@suse.de>

        * app/iscissors.c:
	* app/selection_options.h:
	* app/tool_options.c: Applied patch by laramieleavitt@onetel.net.uk to add
	an interactive update to the iscissors tool.
2001-01-02 14:50:11 +00:00
Michael Natterer
4245ab65d3 plug-ins/libgck/gck/gck.h removed the GckRGB color type and all it's
2001-01-01  Michael Natterer  <mitch@gimp.org>

	* plug-ins/libgck/gck/gck.h
	* plug-ins/libgck/gck/gckcolor.c: removed the GckRGB color type
	and all it's functions.

	* libgimp/Makefile.am
	* libgimp/gimpcolor.[ch]: new files containing the new GimpRGB color
	type and assorted functions.

	* libgimp/gimpcolorspace.[ch]: colorspace conversion routines for
	the new GimpRGB type. Also taken from LibGCK.

	* libgimp/gimp.h
	* libgimp/gimptypes.h: #include "gimpcolor.h". It's ugly to include
	it in both files but unavoidable to follow our new "*.c" file include
	policy. This will go away as libgimp will be chopped up into pieces
	anyway.

	* app/apptypes.h
	* app/asupsample.[ch]
	* app/blend.c
	* app/color_transfer.h
	* app/gradient_header.h: removed "color_t" and use GimpRGB instead.

	* plug-ins/Lighting/lighting_apply.c
	* plug-ins/Lighting/lighting_image.c
	* plug-ins/Lighting/lighting_image.h
	* plug-ins/Lighting/lighting_main.c
	* plug-ins/Lighting/lighting_main.h
	* plug-ins/Lighting/lighting_preview.c
	* plug-ins/Lighting/lighting_shade.c
	* plug-ins/Lighting/lighting_shade.h
	* plug-ins/MapObject/mapobject_apply.c
	* plug-ins/MapObject/mapobject_image.c
	* plug-ins/MapObject/mapobject_image.h
	* plug-ins/MapObject/mapobject_main.c
	* plug-ins/MapObject/mapobject_main.h
	* plug-ins/MapObject/mapobject_preview.c
	* plug-ins/MapObject/mapobject_shade.c
	* plug-ins/MapObject/mapobject_shade.h
	* modules/colorsel_triangle.c: s/GckRGB/GimpRGB/g

	* plug-ins/gdyntext/gdyntextcompat.h: check also for GIMP's minor
	version when deciding if to add a missing PDB wrapper.
	(All this compat cruft including libgimp/gimpcompat.h should go
	away ASAP)
2001-01-01 18:35:09 +00:00
Michael Natterer
40916e0951 More preparation for LibGCK removal:
2000-12-31  Michael Natterer  <mitch@gimp.org>

	More preparation for LibGCK removal:

	* libgimp/gimpcolorspace.[ch]: added a "_int" suffix to all functions
	operating on 3 gint pointers, just like the gdouble functions have
	a "_double" suffix.

	* app/color_balance.c
	* app/hue_saturation.c
	* app/paint_funcs.c
	* modules/colorsel_triangle.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/scatter_hsv.c
	* plug-ins/common/sparkle.c
	* plug-ins/common/vinvert.c
	* plug-ins/gflare/gflare.c: changed accordingly.
2000-12-31 14:58:08 +00:00
Michael Natterer
f16e01a237 cleaned up a bit.
2000-12-31  Michael Natterer  <mitch@gimp.org>

	* app/apptypes.h: cleaned up a bit.

	* app/asupsample.[ch]
	* app/blend.[ch]
	* app/channel.h
	* app/gimpprogress.[ch]
	* app/layer.h
	* app/perspective_tool.c
	* app/plug_in.h
	* app/rotate_tool.c
	* app/scale_tool.c
	* app/shear_tool.c
	* app/transform_core.[ch]: s/gimp_progress/GimpProgress/g and some
	changes related to the apptypes.h cleanup.
2000-12-31 05:31:43 +00:00
Michael Natterer
2db8881557 app/airbrush.[ch] app/bezier_select.c app/bezier_selectP.h app/blend.[ch]
2000-12-31  Michael Natterer  <mitch@gimp.org>

	* app/airbrush.[ch]
	* app/bezier_select.c
	* app/bezier_selectP.h
	* app/blend.[ch]
	* app/boundary.h
	* app/brightness_contrast.[ch]
	* app/bucket_fill.c
	* app/by_color_select.c
	* app/clone.[ch]
	* app/color_balance.c
	* app/color_picker.c
	* app/commands.c
	* app/convolve.[ch]
	* app/crop.c
	* app/crop.h
	* app/curves.c
	* app/dodgeburn.[ch]
	* app/edit_selection.[ch]
	* app/ellipse_select.c
	* app/eraser.[ch]
	* app/flip_tool.[ch]
	* app/free_select.[ch]
	* app/fuzzy_select.[ch]
	* app/gdisplay.c
	* app/gimage.c
	* app/histogram_tool.[ch]
	* app/hue_saturation.[ch]
	* app/image_map.[ch]
	* app/ink.[ch]
	* app/iscissors.c
	* app/levels.c
	* app/magnify.[ch]
	* app/move.c
	* app/nav_window.[ch]
	* app/paint_core.[ch]
	* app/paintbrush.[ch]
	* app/path_bezier.[ch]
	* app/path_tool.c
	* app/pencil.[ch]
	* app/perspective_tool.[ch]
	* app/posterize.c
	* app/rect_select.[ch]
	* app/rotate_tool.[ch]
	* app/scale_tool.[ch]
	* app/selection.[ch]
	* app/shear_tool.[ch]
	* app/smudge.[ch]
	* app/text_tool.[ch]
	* app/threshold.c
	* app/tools.[ch]
	* app/transform_core.[ch]: removed the "gdisp_ptr" madness and
	useless casts all over the place. Introduced a "PaintState" enum
	instead of #define's. Various cleanups.
2000-12-31 04:07:42 +00:00
Michael Natterer
4a0f7c5866 removed all the "typedef gimage_function gimp_image_function" stuff so we
2000-12-30  Michael Natterer  <mitch@gimp.org>

	* app/gimage.[ch]: removed all the
	"typedef gimage_function gimp_image_function" stuff so we can clearly
	see what is really a GImage function.
	Removed gimage_get_ID(). Use pdb_id_to_image() instead.

	* app/airbrush.c
	* app/desaturate.c
	* app/disp_callbacks.c
	* app/equalize.c
	* app/fileops.c
	* app/floating_sel.c
	* app/gdisplay_ops.c
	* app/gimpdrawable.c
	* app/global_edit.c
	* app/image_map.c
	* app/invert.c
	* app/lc_dialog.c
	* app/paths_dialog.c
	* app/plug_in.c
	* app/xcf.c

	* app/color_cmds.c
	* app/convert_cmds.c
	* app/image_cmds.c
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/image.pdb: changed accordingly.
2000-12-30 00:16:50 +00:00
Michael Natterer
8d6c335f8f app/Makefile.am app/channel_pvt.h app/drawable_pvt.h app/gdisplayF.h
2000-12-29  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/channel_pvt.h
	* app/drawable_pvt.h
	* app/gdisplayF.h
	* app/gimpdrawableP.h
	* app/gimpimageP.h
	* app/layer_pvt.h
	* app/toolsF.h: removed these files.

	* app/apptypes.h
	* tools/pdbgen/enums.pl: added tons of opaque typedefs and enums.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/channel.pdb
	* tools/pdbgen/pdb/color.pdb
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/display.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/patterns.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/tools.pdb
	* app/*: chainsaw #include cleanup:

	- Never (never!!) include stuff in header files except where we
	  need access to structures' contents (like derived objects).
	- Added prototypes and proper formating in many files.
	- The #include order in *all* *.c files is as follows:

	#include "config.h"

	#include <system stuff>

	#include <gtk/gtk.h>

	#include "apptypes.h"

	#include "gimp stuff"

	#include "libgimp stuff"

	#include "libgimp/gimpintl.h"

	By following this scheme we can easily see a file's dependencies
	from it's #include's and can grep for the inclusion to find out
	where a file is used.

	* tools/pdbgen/app.pl: changed to follow the include scheme above.

	* libgimp/Makefile.am
	* libgimp/gimpuitypes.h: new file, included from libgimp/gimpui.h
	and from app/apptypes.h.

	* libgimp/gimpcolorbutton.[ch]
	* libgimp/gimpdialog.[ch]
	* libgimp/gimphelpui.[ch]
	* libgimp/gimpparasite.[ch]
	* libgimp/gimppatheditor.[ch]
	* libgimp/gimpprotocol.c
	* libgimp/gimpquerybox.[ch]
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimptypes.h
	* libgimp/gimpui.h
	* libgimp/gimpunit.h
	* libgimp/gimpunitmenu.[ch]
	* libgimp/gimpwidgets.[ch]: changed accordingly.

	* plug-ins/FractalExplorer/Dialogs.c
	* plug-ins/gdyntext/message_window.c
	* plug-ins/imagemap/imap_default_dialog.c
	* plug-ins/imagemap/imap_file.c: these files used to include
	"libgimp/gimpui.h" without including "libgimp/gimp.h". This is
	no longer possible because the libgimpui headers don't inlcude
	"libgimp/gimpunit.h" any more.
2000-12-29 15:22:01 +00:00
Michael Natterer
0d440e1040 app/channel.[ch] app/drawable.h app/gimpdrawable.[ch] app/gimpdrawableP.h
2000-12-28  Michael Natterer  <mitch@gimp.org>

	* app/channel.[ch]
	* app/drawable.h
	* app/gimpdrawable.[ch]
	* app/gimpdrawableP.h
	* app/gimpimage.[ch]
	* app/gimpimageP.h
	* app/layer.[ch]
	* app/layer_pvt.h: started a major cleanup of all image/drawable
	files. Added tons of "const GimpImage *" declarations and properly
	formated the headers.

	* app/bezier_select.c
	* app/channels_dialog.c
	* app/crop.c
	* app/fileops.[ch]
	* app/fuzzy_select.c
	* app/gdisplay.c
	* app/layers_dialog.c
	* app/move.c
	* app/paint_funcs.[ch]
	* app/qmask.c
	* app/undo.c: changed accordingly plus the usual portion of coding
	style paranoia. This is not finished but Sven promised to buy me
	a beer if I commit now ;)
2000-12-28 16:19:55 +00:00
Michael Natterer
7355ee111c app/bezier_select.[ch] massive cleanup (prototypes, indentation, ...)
2000-12-28  Michael Natterer  <mitch@gimp.org>

	* app/bezier_select.[ch]
	* app/bezier_selectP.h: massive cleanup (prototypes, indentation, ...)
2000-12-27 23:40:34 +00:00
Michael Natterer
f8769ee5e2 cleanup, proper prototypes, ...
2000-12-28  Michael Natterer  <mitch@gimp.org>

	* app/measure.c: cleanup, proper prototypes, ...
2000-12-27 23:25:51 +00:00
Michael Natterer
274a33a063 This is not my day :) 2000-12-24 16:55:13 +00:00
Sven Neumann
336e10aed0 applied a patch from David Hodson that reverts the curves tool back to its
2000-12-19  Sven Neumann  <sven@gimp.org>

	* app/curves.c: applied a patch from David Hodson that reverts
	the curves tool back to its old behaviour (start with the identical
	transform), but keeps the fix for bug #33403.
2000-12-19 16:31:49 +00:00
Michael Natterer
3c85607e6a app/Makefile.am removed.
2000-12-19  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimphistogramP.h: removed.

	* app/gimphistogram.[ch]
	* app/histogramwidget.[ch]: Histogram cleanup: replaced the
	channel #define's by a properly named enum and use this enum
	type as parameter in functions instead of "int".

	* app/curves.c
	* app/histogram_tool.c
	* app/levels.c: changed accordingly.
2000-12-19 14:43:54 +00:00
Sven Neumann
3cff8419db Jens Lautenbacher <jtl@gimp.org>
2000-12-18  Sven Neumann  <sven@gimp.org>
	    Jens Lautenbacher <jtl@gimp.org>

	* app/Makefile.am

	* app/gimpbrushlistP.h
	* app/gimpbrushpipeP.h
	* app/gimpobjectP.h: removed these three files

	* app/parasitelistP.h
	* app/channels_dialog.c
	* app/docindex.c
	* app/gimpdrawable.c
	* app/gimpdrawableP.h
	* app/gimpimage.c
	* app/gimpimageP.h
	* app/gimplist.[ch]
	* app/gimpobject.c
	* app/gimpobject.h
	* app/gimpsetP.h: changed according to header removal

	* app/airbrush.c
	* app/brush_select.[ch]
	* app/brushes_cmds.c
	* app/gimpbrush.[ch]
	* app/gimpbrushgenerated.[ch]
	* app/gimpbrushlist.[ch]
	* app/gimpbrushpipe.[ch]
	* app/gimpcontextpreview.c
	* app/paint_core.c
	* app/paintbrush.c
	* app/pencil.c
	* tools/pdbgen/pdb/brushes.pdb: Big Brushes Cleanup.

	The GimpBrush* object hierarchy and the file formats were broken by
	"design". This made it overly difficult to read and write pixmap
	brushes and brush pipes, leading to the situation that The GIMP was
	not able to read it's very own file formats. Since the GimpBrush
	format did support arbitrary color depths, the introduction of a
	file format for pixmap brushes was unnecessary.

	The GimpBrushPixmap object is dead. GimpBrush has an additional
	pixmap temp_buf and handles pixmap brushes transparently. The file
	format of pixmap brushes is not any longer a grayscale brush plus
	a pattern, but a simple brush with RGBA data. The old brushes can
	still be loaded, but the .gpb format is deprecated.

	GimpBrushPipe derives from GimpBrush. The fileformat is still a text
	header, followed by a number of brushes, but those brushes are stored
	in the new GimpBrush format (no pattern anymore). The pipe does not
	care about the depth of the contained GimpBrushes, so we get
	grayscale BrushPipes for free. Since the brush loader still loads the
	old format, old .gih files can also still be loaded.

	Since the brushes in the GimpBrushPipe do not any longer contain a
	pointer to the pipe object, we do only temporarily switch brushes
	in the paint_core routines. This is not very elegant, but the best
	we can do without a major redesign.

	* app/patterns.[ch]: changed the loader to work with a filedescriptor
	instead of a filehandle to make it work with the new brush loading
	code.

	* plug-ins/common/.cvsignore
	* plug-ins/common/Makefile.am
	* plug-ins/common/plugin-defs.pl
	* plug-ins/common/gih.c: new plug-in that saves GIH files in the
	new format (loader will follow soon)

	* plug-ins/common/gpb.c: removed since Pixmap Brushes are no longer
	supported as a special file format.

	* plug-ins/common/gbr.c: load and save brushes in the new brush format
	which allows RGBA brushes too.

	* plug-ins/common/pat.c: load and save grayscale patterns too
2000-12-18 15:14:08 +00:00
Sven Neumann
6639e17c0d preview the curve settings in the image window when initializing the tool.
2000-12-17  Sven Neumann  <sven@gimp.org>

	* app/curves.c: preview the curve settings in the image window when
	initializing the tool. This way the new curves behaviour (init with
	last settings) is visible.

	* app/user_install.c: check that strings are non-NULL before passing
	them to strcmp.

	* libgimp/gimpfileselection: do not try to pass a NULL text to
	gtk_entry_set_text, use an empty string instead.
2000-12-17 00:28:32 +00:00
Sven Neumann
dfa2bed505 Last-minute cleanup:
2000-12-16  Sven Neumann  <sven@gimp.org>

	Last-minute cleanup:

	* app/gimpdrawableF.h
	* app/gimphistogramF.h
	* app/gimpimageF.h
	* app/gimplistF.h
	* app/gimplutF.h
	* app/gimpobjectF.h
	* app/gimpsetF.h
	* app/layerF.h
	* app/parasitelistF.h: removed these files

	* app/Makefile.am
	* tools/pdbgen/Makefile.am: changed accordingly

	* app/[almost every file]: include cleanup
2000-12-16 21:37:03 +00:00
Sven Neumann
2458bfcbba app/color_picker.c app/convert.c app/curves.c app/gimpdrawable.c
2000-12-13  Sven Neumann  <sven@gimp.org>

        * app/color_picker.c
        * app/convert.c
        * app/curves.c
        * app/gimpdrawable.c
        * app/gimpimage.c
        * app/gimpimage.h
        * app/image_map.c
        * app/info_window.c
        * app/layer.c
        * app/undo.c: couldn't resist: renamed TYPE_HAS_ALPHA() to
        GIMP_IMAGE_TYPE_HAS_ALPHA()

        * plug-ins/common/sunras.c
        * plug-ins/common/xwd.c: small cleanups
2000-12-13 18:53:35 +00:00
Sven Neumann
01412f0ba2 clamp scale factor between 0.0 and 1.0 to avoid problems with broken
2000-12-11  Sven Neumann  <sven@gimp.org>

	* app/paint_core.c: clamp scale factor between 0.0 and 1.0 to avoid
	problems with broken XInput drivers. Should fix bug #18913.
2000-12-11 19:30:22 +00:00
Sven Neumann
ed707bea13 app/edit_selection.c app/gimpimage.c app/layer_select.c when computing a
2000-12-11  Sven Neumann  <sven@gimp.org>

	* app/edit_selection.c
	* app/gimpimage.c
	* app/layer_select.c
	* app/layers_dialog.c: when computing a preview, limit the scale ratio
	to a maximum of 1.0. By doing so we avoid to scale drawables up if the
	image (canvas) size becomes larger than the drawable. Fixes bug #31098.

	* app/gimppreviewcache.[ch]: indented
2000-12-11 03:33:25 +00:00
GMT 2000 Andy Thomas
fb4fb8c014 app/curves.c app/levels.c
Thu Nov 30 23:26:07 GMT 2000 Andy Thomas <alt@gimp.org>

	* app/curves.c
        * app/levels.c

	Fix for gimp bug #33403. The curves and levels dialogs should now
	work in GRAYA images.
2000-11-30 23:23:59 +00:00
Austin Donnelly
9a3f33f6f0 Applied patch from David Hodson <hodsond@ozemail.com.au> to fix Bug#33399:
2000-11-29  Austin Donnelly  <austin@gimp.org>

	* app/curves.c: Applied patch from David Hodson
	    <hodsond@ozemail.com.au> to fix Bug#33399: GIMP crashes when
	    applying curve to Grayscaled image when preview is off.
	    Previously the curves tool attempted a reset when changing
	    image, but didn't correctly do this.  Now it has the
	    (more useful) behaviour of doing a partial reset, where the
	    curve remains the same across multiple invocations, allowing
	    you to apply the same tweak to multiple images.  The internal
	    state relevant to image type/depth is correctly reset,
	    stopping the segfault behaviour seen before.

	    Still no fix for Bug#33403: Curves/Levels Tool does not work
	    on GRAYA-Images.
2000-11-29 16:19:43 +00:00
Garry R. Osgood
18871b798e 2000-11-24 Garry R. Osgood <gosgood>@idt.net *
* app/smudge.c
Defer tool initialization to first motion event.
Fixes latency problem that gave rise to
Shift-smudge bug. Closes #30778.
2000-11-24 17:49:03 +00:00
Michael Natterer
cdd0a5147d app/fileops.c Make sure that we don't try to destroy query_boxes twice or
2000-11-18  Michael Natterer  <mitch@gimp.org>

	* app/fileops.c
	* libgimp/gimpquerybox.[ch]: Make sure that we don't try to destroy
	query_boxes twice or try to disconnect not-any-more connected
	handlers.

	* app/color_notebook.c
	* app/gimpcontext.[ch]
	* app/gimphelp.[ch]
	* app/lc_dialog.[ch]
	* app/menus.h
	* app/preferences_dialog.c
	* app/tools.[ch]
	* libgimp/gimpcolorbutton.[ch]
	* libgimp/gimpdialog.[ch]
	* libgimp/gimpexport.[ch]
	* libgimp/gimpfileselection.[ch]
	* libgimp/gimphelpui.[ch]
	* libgimp/gimppatheditor.[ch]
	* libgimp/gimppixmap.[ch]
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimpui.[ch]
	* libgimp/gimpunitmenu.[ch]
	* libgimp/gimpwidgets.[ch]: in a coding attack, changed help_data
	and many other strings passed to UI functions to (const gchar *).
	As a consequence, I had to fix lots of warnings ;)

	* plug-ins/common/tga.c
	* plug-ins/imagemap/imap_main.c: fixed warnings.

	Code cleanup and indentation all over the place.
2000-11-18 00:25:42 +00:00
Sven Neumann
f6fb459511 use gdk_fonset_load() as we do in text_render(). Supposed to fix #31099.
2000-11-07  Sven Neumann  <sven@gimp.org>

	* app/text_tool.c (text_get_extends): use gdk_fonset_load() as we
	do in text_render(). Supposed to fix #31099.
2000-11-07 18:37:28 +00:00
Sven Neumann
746c37eb7e moved the new enum Garry introduced recently from the header to the .c
2000-11-06  Sven Neumann  <sven@gimp.org>

	* app/convolve.[ch]: moved the new enum Garry introduced recently
	from the header to the .c file so it does not get exported to the
	PDB by enumgen.pl.

and some updates to the italian translation as sent by Daniele Medri.
2000-11-06 12:40:07 +00:00
Garry R. Osgood
2bcc63533c Garry R. Osgood <gosgood>@idt.net
Convolution tool can now operate
in two-pixel regions at the edge
of images. Closes #19285. See
http://idt.net/~gosgood/gimp-patch/patch08.html
2000-11-04 17:54:01 +00:00
Sven Neumann
8cfac64aac avoid modulo operation on negative values.
2000-10-26  Sven Neumann  <sven@gimp.org>

	* app/channel_ops.c (offset_ok_callback): avoid modulo operation on
	negative values.

	* app/channel_ops.c
	* app/crop.c
	* app/file_new_dialog.c
	* app/layers_dialog.c
	* app/preferences_dialog.c
	* app/rotate_tool.c
	* app/scale_tool.c: use RINT() when assigning the result of
	gimp_size_entry_get_refval() to an integer.
2000-10-26 22:02:44 +00:00
Sven Neumann
27a4faa0b2 plugged memleak (similar to the one that was present in
2000-10-22  Sven Neumann  <sven@gimp.org>

	* app/edit_selection.[ch]: plugged memleak (similar to the one that
	was present in gtkutil_compress_motion()) in the key snooper.

	Round moves to nearest integer instead of truncating the value.
	This seems to fix the reported redraw problems when moving
	selections at low zoom levels.

	Cleaned up the code a little and converted enum values to uppercase.

	* app/bezier_select.c
	* app/free_select.c
	* app/fuzzy_select.c
	* app/move.c
	* app/rect_select.c
	* app/text_tool.c: updated to use the new EditType enum values.

	* app/gimprc.c: minor optimization in the GList handling.

	* app/layer.[ch]: removed unused functions.

	* app/menus.c: removed "Dump Items (Debug)" menu entry.
2000-10-23 09:05:45 +00:00
Daniel Egger
b07c7184ed New dialog_hide functions which are utilised from convert.c to hide
New dialog_hide functions which are utilised from convert.c to hide
 dialogs before converting an image to indexed. Bug #23104.
2000-09-29 01:22:27 +00:00
Sven Neumann
aa5d61c24d use gimp_dialog_hide() instead of gtk_widget_hide(). Closes bug #19164.
2000-07-30  Sven Neumann  <neo@wintermute.ochsenblut.de>

* app/tools.c (tool_options_close_callback): use
gimp_dialog_hide() instead of gtk_widget_hide(). Closes bug #19164.
2000-07-30 00:24:40 +00:00
Michael Natterer
a17cf3bd0b cursors/background.xbm cursors/background_mask.xbm cursors/foreground.xbm
2000-07-29  Michael Natterer  <mitch@gimp.org>

	* cursors/background.xbm
	* cursors/background_mask.xbm
	* cursors/foreground.xbm
	* cursors/foreground_mask.xbm
	* cursors/pattern.xbm
	* cursors/pattern_mask.xbm: new files.

	* cursors/gimp-tool-cursors.xcf
	* app/cursorutil.[ch]: new cursor modifiers for bucket_fill.

	* app/bucket_fill.c: use the new modifiers. Closes #17871.

	* app/convolve.c
	* app/dodgeburn.c: added cursor_update functions which update the
	tools' "toggled" state before they call the cursor_update "method"
	of the paint_core "class" -- eek -- I-want-real-objects!
	Closes #17872 and #17873.

	* app/tools.h: added SELECTION_ANCHOR to the SelectOps enum.

	* app/free_select.c
	* app/rect_select.c: use the new enum value in the "oper_update"
	and "cursor_update" functions. In the "motion" function, set the
	tool's operation type back to SELECTION_REPLACE if the tool is
	active and call the "cursor_update" function explicitly.
	Closes #17870.

	* app/by_color_select.c: fixed warning caused by the new enum value.
2000-07-29 16:12:40 +00:00
Seth Burgess
24542e8c9c app/levels.c : changed reset to reset all channels, not just currently
active one.  Fixes #15042.
2000-07-05 01:26:10 +00:00
BST 2000 Andy Thomas
3ed86a7343 app/paint_core.c
Tue Jun 27 22:26:30 BST 2000 Andy Thomas <alt@gimp.org>

	* app/paint_core.c

	Fixed problem with coloured brushes/grayscale images and painting
	close to the edge. Fixes bug #14159
2000-06-27 21:26:59 +00:00
Matt Wilson
74fdc62e2a allocate the tool's paint_core with g_new0. This prevents us from having
2000-06-22  Matt Wilson  <msw@redhat.com>

	* app/paint_core.c (paint_core_new): allocate the tool's
	paint_core with g_new0.  This prevents us from having cruft in
	unused tools.  Systems with sensitive FPUs (Alpha) will raise
	exception in the paint_core_cursor_update if paint_core->last{x,y}
	are messy.

	* app/bezier_select.c (tools_new_bezier_select)
	* app/blend.c (blend_options_new)
	* app/brightness_contrast.c (tools_new_brightness_contrast)
	* app/bucket_fill.c (tools_new_bucket_fill)
	* app/by_color_select.c (tools_new_by_color_select)
	* app/color_balance.c (tools_new_color_balance)
	* app/color_panel.c (color_panel_new)
	* app/color_picker.c (tools_new_color_picker)
	* app/crop.c (tools_new_crop)
	* app/curves.c (tools_new_curves)
	* app/ellipse_select.c (tools_new_ellipse_select)
	* app/free_select.c (tools_new_free_select)
	* app/fuzzy_select.c (tools_new_fuzzy_select)
	* app/histogram_tool.c (tools_new_histogram_tool)
	* app/hue_saturation.c (tools_new_hue_saturation)
	* app/ink.c (tools_new_ink)
	* app/iscissors.c (tools_new_iscissors)
	* app/levels.c (tools_new_levels)
	* app/magnify.c (tools_new_magnify)
	* app/measure.c (tools_new_measure_tool)
	* app/move.c (tools_new_move_tool)
	* app/path_tool.c (tools_new_path_tool)
	* app/posterize.c (tools_new_posterize)
	* app/rect_select.c (tools_new_rect_select)
	* app/resize.c (resize_widget_new)
	* app/threshold.c (tools_new_threshold)
	* app/transform_core.c (transform_core_new)
	* app/xinput_airbrush.c (tools_new_xinput_airbrush): likewise (it
	can only help and it really isn't slow.)

	* app/color_area.c: #include <string.h> for memcpy declaration

	* app/gimphelp.c: #include <string.h> for strlen declaration
2000-06-23 00:14:07 +00:00
BST 2000 Andy Thomas
7434c9bc8b app/edit_selection.c
Fri Jun 16 23:47:00 BST 2000 Andy Thomas <alt@gimp.org>

	* app/edit_selection.c

	A better fix for the problem with the selection outline.
	It should now cope with offsets in the image as well as
	scaling the image while moving the selection.

	These problems occurred both when moving the selection as a layer
	and just moving the selection outline.
2000-06-16 22:48:10 +00:00
Michael Natterer
7890b7ace9 Makefile.am cursors/gimp-tool-cursors.xcf cursors/perspective_small.xbm
2000-06-16  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* cursors/gimp-tool-cursors.xcf
	* cursors/perspective_small.xbm
	* cursors/perspective_small_mask.xbm
	* cursors/rotate_small.xbm
	* cursors/rotate_small_mask.xbm
	* cursors/shear_small.xbm
	* cursors/shear_small_mask.xbm: new cursors.

	* app/tools.c
	* app/transform_core.c: use them.
2000-06-16 11:38:45 +00:00
Sven Neumann
858715f64d Dodge/Burn seems to handle animated brushes quite well, so set
2000-06-16  Sven Neumann  <sven@gimp.org>

        * app/dodgeburn.c (tools_new_dodgeburn): Dodge/Burn
        seems to handle animated brushes quite well, so set
        TOOL_CAN_HANDLE_CHANGING_BRUSH.
2000-06-16 01:45:08 +00:00
Michael Natterer
35e55cf16d app/convolve.c app/dodgeburn.c app/eraser.c app/paint_core.c fixed my tool
2000-06-14  Michael Natterer  <mitch@gimp.org>

	* app/convolve.c
	* app/dodgeburn.c
	* app/eraser.c
	* app/paint_core.c
	* app/tools.[ch]: fixed my tool toggle braino: the paint_core
	cannot decide which cursor to show from the state of the modifier
	keys.

	Added a boolean "toggled" variable to the Tool structure,
	set it in the toggleable paint tools and evaluate it in the
	paint_core.
2000-06-14 14:22:47 +00:00
Michael Natterer
1a2cfc0ff8 Makefile.am cursors/gimp-tool-cursors.xcf cursors/anchor.xbm new cursor
2000-06-14  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* cursors/gimp-tool-cursors.xcf
	* cursors/anchor.xbm
	* cursors/anchor_mask.xbm: new cursor modifier for the move tool.

	* app/cursorutil.[ch]
	* app/move.c: use the new modifier for anchoring floating selections.
2000-06-14 13:57:17 +00:00
Michael Natterer
b8ee0c8c82 Makefile.am app/cursorutil.[ch] app/tools.c added lots of new cursors and
2000-06-14  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* app/cursorutil.[ch]
	* app/tools.c
	* cursors/*: added lots of new cursors and removed old ones.

	* app/gdisplay.[ch]: enabled the cursor setting parameters in
	gdisplay_install_tool_cursor().

	* app/bezier_select.c
	* app/blend.c
	* app/bucket_fill.c
	* app/by_color_select.c
	* app/clone.c
	* app/color_picker.c
	* app/crop.c
	* app/disp_callbacks.c
	* app/edit_selection.c
	* app/eraser.c
	* app/flip_tool.c
	* app/ink.c
	* app/iscissors.c
	* app/magnify.c
	* app/measure.c
	* app/move.c
	* app/paint_core.c
	* app/rect_select.c
	* app/text_tool.c
	* app/transform_core.c: use the new cursors. Only the transform
	tools are still using old cursors.

	* app/layers_dialog.c: a tooltip for "Keep Trans."

	* app/user_install.c: set the ctree's selection mode to BROWSE.
2000-06-14 10:59:16 +00:00
Michael Natterer
db76b885a2 another cursor fix.
2000-06-15  Michael Natterer  <mitch@gimp.org>

	* app/crop.c (crop_cursor_update): another cursor fix.
2000-06-14 10:59:13 +00:00
Michael Natterer
af1bd5e367 Makefile.am app/cursorutil.[ch] app/tools.c added lots of new cursors and
2000-06-14  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* app/cursorutil.[ch]
	* app/tools.c
	* cursors/*: added lots of new cursors and removed old ones.

	* app/gdisplay.[ch]: enabled the cursor setting parameters in
	gdisplay_install_tool_cursor().

	* app/bezier_select.c
	* app/blend.c
	* app/bucket_fill.c
	* app/by_color_select.c
	* app/clone.c
	* app/color_picker.c
	* app/crop.c
	* app/disp_callbacks.c
	* app/edit_selection.c
	* app/eraser.c
	* app/flip_tool.c
	* app/ink.c
	* app/iscissors.c
	* app/magnify.c
	* app/measure.c
	* app/move.c
	* app/paint_core.c
	* app/rect_select.c
	* app/text_tool.c
	* app/transform_core.c: use the new cursors. Only the transform
	tools are still using old cursors.

	* app/layers_dialog.c: a tooltip for "Keep Trans."

	* app/user_install.c: set the ctree's selection mode to BROWSE.
2000-06-14 10:59:13 +00:00
BST 2000 Andy Thomas
be17b30bce app/edit_selection.c
Tue Jun 13 22:38:22 BST 2000 Andy Thomas <alt@gimp.org>

	* app/edit_selection.c

	Fixed problem with selection outline. The outline drawing did not
	take acount of the display offset so that if you moved a selection
	to the edge of an image that cause the image to scroll in the viewing
	window the section outline was drawn incorrectly.
2000-06-13 21:44:48 +00:00
Jay Cox
49424610cd These files should have been commited in my 2000-05-08 commit but somehow
2000-06-13  Jay Cox  <jaycox@gimp.org>

        These files should have been commited in my 2000-05-08 commit
	but somehow they didnt make it.

	* app/hue_saturation.c
	* app/levels.c
	* app/posterize.c
	* app/threshold.c: Add a call to image_map_clear in the
	preview toggle button callback.  This makes the preview toggle
	button behave as expected.

	* app/histogram_tool: remove an unnecessary include.
2000-06-13 09:13:16 +00:00
Michael Natterer
d0a551bbf8 Cursor patch II: This is only the logic inside the cursor system and not
2000-06-09  Michael Natterer  <mitch@gimp.org>

	Cursor patch II:
	This is only the logic inside the cursor system and not yet used.

	* app/cursorutil.[ch]: [gimp]_change_win_cursor() take lots of
	parameters now and compose cursors from up to three cursor
	bitmaps/masks.

	* app/gdisplay.[ch]: As a test, create a hardcoded example cursor
	if "Cursor Mode" is set to "Tool Icon with Crosshair" in prefs.

	* app/curves.c
	* app/dialog_handler.c
	* app/scroll.c: changed the calls to the win_cursor function.

	* app/tools.[ch]: added a cursor and a toggle cursor to the ToolInfo
	structure of all tools.

	* app/toolsF.h: new ToolType TOOL_TYPE_NONE.

	* app/gimpdnd.c
	* app/interface.c: check for silly filenames in the file dnd
	callback. Closes #13733.

	* Makefile.am
	* cursors/bucket_fill_small.xbm
	* cursors/bucket_fill_small_mask.xbm
	* cursors/crop_small.xbm
	* cursors/crop_small_mask.xbm
	* cursors/crosshair_small.xbm
	* cursors/crosshair_small_mask.xbm
	* cursors/ellipse_select_small.xbm
	* cursors/ellipse_select_small_mask.xbm
	* cursors/eraser_small.xbm
	* cursors/eraser_small_mask.xbm
	* cursors/free_select_small.xbm
	* cursors/free_select_small_mask.xbm
	* cursors/fuzzy_select_small.xbm
	* cursors/fuzzy_select_small_mask.xbm
	* cursors/intersect.xbm
	* cursors/intersect_mask.xbm
	* cursors/minus.xbm
	* cursors/minus_mask.xbm
	* cursors/move.xbm
	* cursors/move_mask.xbm
	* cursors/paintbrush_small.xbm
	* cursors/paintbrush_small_mask.xbm
	* cursors/pencil_small.xbm
	* cursors/pencil_small_mask.xbm
	* cursors/plus.xbm
	* cursors/plus_mask.xbm
	* cursors/rect_select_small.xbm
	* cursors/rect_select_small_mask.xbm
	* cursors/resize_small.xbm
	* cursors/resize_small_mask.xbm
	* cursors/zoom.xbm
	* cursors/zoom_mask.xbm
	* cursors/zoom_small.xbm
	* cursors/zoom_small_mask.xbm: new files extracted from Tigert's
	gimp-tool-cursors.xcf created at GimpCon.

	Tigert, I'll commit the xcf as soon as I've added empty layers
	with the names of the cursors that are missing.

	* cursors/mouse.xbm
	* cursors/mouse_mask.xbm: made it 32x32 to allow for cursor
	composition.
2000-06-09 12:31:19 +00:00
Sven Neumann
8630a62302 as suggested by Daniel Egger, set TOOL_CAN_HANDLE_CHANGING_BRUSH for the
2000-06-08  Sven Neumann  <sven@gimp.org>

	* app/eraser.c: as suggested by Daniel Egger, set
	TOOL_CAN_HANDLE_CHANGING_BRUSH for the eraser tool.
	Fixes bug #13172.
2000-06-07 23:13:39 +00:00
Sven Neumann
a43f448b9d indentation, no real changes
2000-06-05  Sven Neumann  <sven@gimp.org>

        * app/paint_core.[ch]: indentation, no real changes

        * plug-ins/gap/README
        * plug-ins/gap/gap_mov_dialog.c
        * plug-ins/gap/gap_mov_exec.c: applied a patch from Wolfgang
        Hofer

        * plug-ins/imagemap/imap_csim.y: applied a patch from
        Maurits Rijk which promises to fix bug #10090.
        Yosh, could you regenerate the C code, please...?!

        * tips/gimp_tips.txt: applied gimp-quinet-20000508-0.patch,
        an update to the english tips file provided by Raphael Quinet.
2000-06-05 22:08:45 +00:00
Manish Singh
f764c56d03 Be smarter about emitting the "invalidate_preview" signal.
comitted using Yosh's account...


--Sven
2000-06-03 18:19:22 +00:00
Sven Neumann
9529e1e696 app/Makefile.am app/paint_core.c moved brush subsampling kernels into its
2000-05-29  Sven Neumann  <sven@gimp.org>

        * app/Makefile.am
        * app/paint_core.c
        * app/paint_core_kernels.h: moved brush subsampling kernels
        into its own header file and generated a slightly different
        kernel (using the new kernelgen tool, see below). The new
        kernel simulates a circular brush instead of a rectangular
        one and gives slightly different (lighter) results.

        * app/gimage_mask.c: when stroking a selection, offset the
        points by 0.5 to align the brushes with the pixel grid. This
        lets you create 1-pixel wide rectangles and ellipses.

        * tools/Makefile.am
        * tools/kernelgen.c: simple hack to generate subsampling
        kernels.
2000-05-29 08:40:29 +00:00
Sven Neumann
95500f2d40 moved Magnify into the Transformation tools category. This is not entirely
2000-05-22  Sven Neumann  <sven@gimp.org>

* app/tools.c: moved Magnify into the Transformation tools
category. This is not entirely correct, but at least the
tools are now grouped as they appear in the toolbox.

* plug-ins/common/flarefx.c: applied modified version of
gimp-timecop-200005-4.flarefx which adds a scaled down
flarefx to tthe preview.


--Sven
2000-05-22 17:39:15 +00:00
Michael Natterer
9c6b0b0c33 These changes enable help support for 3rd party plug-ins which install
2000-05-21  Michael Natterer  <mitch@gimp.org>

	These changes enable help support for 3rd party plug-ins which
	install their help files outside GIMP's main help dir.

	Instead of calling gimp_help(), gimp_plugin_help_func() etc.,
	all help callbacks now have to call gimp_standard_help_func()
	which has different implementations in the app and in libgimp.

	There is a new function gimp_plugin_help_register() which can
	be called during plug-in query. plug_in.c keeps a list of
	executable_name/help_path pairs. Plug-ins have to pass their
	exec. name to gimp_help() which uses the list to find the plug-in's
	help directory.

	* app/gimphelp.[ch]: gimp_help() now takes a help_path parameter.
	help_path == NULL means the standard help directory. Various
	changes to pass the help_path to the help browser.

	* app/gimprc.c: save the plug-in's help_path in the pluginrc file.

	* app/menus.c: ugly hack to enable help_paths in the "F1" callback.

	* app/plug_in.[ch]: many help_path related changes. Use g_basename()
	instead of strrchr(str,G_DIR_SEPARATOR), cosmetic cleanups.

	* app/internal_procs.c
	* app/gimphelp_cmds.c
	* tools/pdbgen/pdb/gimphelp.pdb: new procedure
	gimp_plugin_help_register(). gimp_help() takes a second parameter
	which is the executable name (not the help_path).

	* app/color_notebook.c
	* app/commands.c
	* app/lc_dialog.c
	* app/preferences_dialog.c
	* app/tools.c: call gimp_standard_help_func() instead of gimp_help().

	* libgimp/gimp.c: new function gimp_get_progname() which returns
	the full path of the plug-in's executable.

	* libgimp/gimp.h: export the new function,
	removed gimp_plugin_help_func(), gimp_help() takes the executable
	name as second parameter.

	* libgimp/gimpcompat.h: added gimp_plugin_help_func().

	* libgimp/gimphelp.c: a wrapper for gimp_plugin_help_register(),
	changed the calls to gimp_help.

	* libgimp/gimphelpui.[ch]: call gimp_standard_help_func() instead
	of gimp_help().

	* plug-ins/helpbrowser/helpbrowser.c: now called with an additional
	help_path parameter. Various changes to enable
	help_path != gimp_standard_help_path.

	Unrelated stuff:

	* app/batch.h: added missing GPL header.

	* app/gimpunit.c: had a LGPL header, merged some fprintf's into
	one call.

	* app/procedural_db.[ch]: cosmetic: g* types, s/g_malloc/g_new/,
	prototypes, indentation.

	* app/resize.c: use less packing widgets. didn't find the "offset"
	redraw bug :(
2000-05-21 17:41:02 +00:00
Sven Neumann
03b2e9d08a when transforming a selection in an indexed image, we used to create an
2000-05-20  Sven Neumann  <sven@gimp.org>

* app/transform_core.c (transform_core_cut): when transforming
a selection in an indexed image, we used to create an indexed
tile_buffer. This gives strange (black) results later when we
use layer_new_from_tiles() since that function assumes that a
TileManager is always RGB or GRAY. Eeek!!

Instead of fixing it correctly by changing the TileManager
struct, I've unset the keep_indexed flag when calling
gimage_mask_extract(), so whatever layer_new_from_tiles()
assumes becomes true. Fixes bug #10762.


--Sven
2000-05-20 10:49:03 +00:00
jaycox
af0c94abf6 new function image_map_clear that removes the preview without freeing the
* app/image_map.[ch]: new function image_map_clear that removes
	the preview without freeing the image_map.

	* app/brightness_contrast.c
	* app/color_balance.c
	* app/curves.c
	* app/hue_saturation.c
	* app/levels.c
	* app/posterize.c
	* app/threshold.c: Add a call to image_map_clear in the
	preview toggle button callback.  This makes the preview toggle
	button behave as expected.

	* app/histogram_tool: remove an unnecessary include.
2000-05-09 05:43:29 +00:00
Sven Neumann
a907871937 gimprc.in gimprc.win32 set default image size back to 256x256, default to
* gimprc.in
* gimprc.win32
* app/gimprc.c: set default image size back to 256x256, default
to local paint options and info-window-follows-mouse.

* app/brightness_contrast.c
* app/docindex.c
* app/hue_saturation.c: picky changes on some labels.

* app/tips_dialog.c: applied (sort of) gimp-quinet-20000504-0,
which replaces the message "Show tip next time" in the
Tip Of The Day dialog with "Show tip next time GIMP starts".


--Sven
2000-05-07 10:06:27 +00:00
Manish Singh
e35436426b applied gimp-quinet-000427-0, draw the straight line preview in the center
* app/paint_core.c: applied gimp-quinet-000427-0, draw the straight
line preview in the center of the start and end pixels at high zoom
levels.

-Yosh
2000-05-01 18:10:20 +00:00
Michael Natterer
c73b233f8a app/color_select.c app/colormaps.[ch] removed unused global variables
2000-04-26  Michael Natterer  <mitch@gimp.org>

	* app/color_select.c
	* app/colormaps.[ch]
	* app/context_manager.c: removed unused global variables
	[foreground|background]_pixel and [old|new]_color_pixel.

	Initialize the colormap and visual stuff with GdkRGB instead of
	GtkPreview functions (which are deprecated).

	* app/[62 files]: removed #include's (started with colormaps.h and
	couldn't stop). Also ordered them consistently and did some small
	unrelated cleanups.
	Removed variuos <stdlib.h> et.al. but checked the files carefully
	before doing so. If I was too radical and you get warnings on your
	platform, please flame me or just put them back :)
2000-04-27 17:27:28 +00:00
Michael Natterer
3ed7073f9a fill empty "default" with a "break" (#9431). g_path_is_absolute wants a
2000-04-26  Michael Natterer  <mitch@gimp.org>

	* app/free_select.c: fill empty "default" with a "break" (#9431).
	* libgimp/gimpenv.c: g_path_is_absolute wants a parameter (#9400).
2000-04-26 00:17:54 +00:00
Sven Neumann
763e495d06 cleaned up the messy spanish translation someone added
fixed compiler warnings, changed some gints to gbooleans

cleaned up namespace and documentation

updated libgimp documentation



--Sven
2000-04-22 19:46:23 +00:00
Garry R. Osgood
0b0742afdc app/bezier_select.c Closes the most recent bezier segfault report; about
2000-04-22 Garry R. Osgood <gosgood@idt.net>
* app/bezier_select.c
Closes the most recent bezier segfault report;
about plotting anchor points on- and off-image.
unable to cite because bugs.gnome.org is not
well. Andrew Thomas handled the only other
buglet I'm aware of at this time.
2000-04-22 18:48:51 +00:00
BST 2000
dfb76fdb64 app/bezier_select.c
Sat Apr 22 14:01:06 BST 2000 <alt@gimp.org>

	* app/bezier_select.c

	Fixed problem pointed out by Garry R. Osgood (manipulating
	control points where curve is closed). Thanks
	again Garry for pointing it out.
2000-04-22 13:09:44 +00:00
Michael Natterer
63dc6ed333 app/fuzzy_select.c app/selection_options.h moved the "Threshold" scale
2000-04-20  Michael Natterer  <mitch@gimp.org>

	* app/fuzzy_select.c
	* app/selection_options.h
	* app/tool_options.c: moved the "Threshold" scale from the fuzzy
	select options to the selection options structure, so none of the
	selection tools needs it's own tools options structure.

	* app/bucket_fill.c: moved "Threshold" after "Sample Merged" as in
	the fuzzy select options.
2000-04-20 15:57:13 +00:00
Michael Natterer
236e4856c0 app/bucket_fill.c app/by_color_select.c app/fuzzy_select.c made the
2000-04-19  Michael Natterer  <mitch@gimp.org>

	* app/bucket_fill.c
	* app/by_color_select.c
	* app/fuzzy_select.c
	* app/preferences_dialog.c: made the "default_threshold" gimprc
	variable work as advertized:

	- initialize the thresholds with it.
	- use it for "Reset".
	- added a widget to the "Tool Options" preferences page.
	- noticed that the "Reset" button of "By Color Select" doesn't
	  behave like all the other "Reset" buttons and changed it to
	  reset the ui, not the selection.
	  (There is now a "None" button and because it was so trivial, I
	  couldn't resist to add "All" and "Invert" buttons, too)

	* libgimp/Makefile.am
	* libgimp/gimpui.c: new file.
	* libgimp/gimpui.h: new function gimp_ui_init() which will be
	called by all plugins which have a ui (not only by those with a
	preview because plugins should always follow gimp's colormap
	installation policy).

	Could someone please check if the FIXME stuff in the function
	is the right thing to do (TM). Does GdkRGB allocate the correct
	colors for the widgets in all cases or do we have to find another
	way to ensure this across processes (gtk instances)?
2000-04-19 14:02:05 +00:00
jtl
5c816c6b38 *** empty log message *** 2000-04-16 12:10:24 +00:00
Michael Natterer
74156c69bd one more fix... 2000-04-13 00:38:04 +00:00
Michael Natterer
b88a1ff1ff push an undo group when adding horizontal and vertical guides with
2000-04-13  Michael Natterer  <mitch@gimp.org>

	* app/measure.c: push an undo group when adding horizontal and
	vertical guides with Ctrl+Alt.
2000-04-13 00:23:10 +00:00
Sven Neumann
9a55c77635 use GIMP_HAVE_PARASITES instead of _PARASITES_H, which wasn't defined
* plug-ins/common/gif.c: use GIMP_HAVE_PARASITES instead of
_PARASITES_H, which wasn't defined anymore. Makes comment
parasites work with GIFs again.

* app/measure.c: pressing ALT anywhere outside the handles allows
to move the measure lines.


--Sven
2000-04-12 21:21:36 +00:00
Sven Neumann
31df3ca344 various minor fixes and updates to the german translation
--Sven
2000-04-11 16:34:42 +00:00
Sven Neumann
949b6e3f34 changed GIMP_MIN_RESOLUTION to 5e-3,
a bunch of small cleanups here and there


--Sven
2000-04-06 18:59:48 +00:00
Sven Neumann
743516bfb0 if we cannot load the font we'd like to use, use the gtk+ default font.
* app/app_procs.c: if we cannot load the font we'd like to use,
use the gtk+ default font. Fixes bug #8359.

* app/about_dialog.c
* app/install.c: properly ref/unref fonts

* app/text_tool.[ch]: code cleanup (do not rely on TRUE being 1)

* app/tips_dialog.c: code cleanup and less resizing


--Sven
2000-04-05 22:59:44 +00:00
Michael Natterer
8ed5f8ce06 app/color_panel.[ch] app/color_picker.c removed the public function
2000-04-03  Michael Natterer  <mitch@gimp.org>

	* app/color_panel.[ch]
	* app/color_picker.c
	* app/qmask.c: removed the public function color_panel_free() and
	fake a real widget's behaviour by connecting to the panel widget's
	"destroy" signal.

	* app/channels_dialog.c
	* app/layers_dialog.c: cleaned up and sync'ed the code where
	possible (without changing the logic).
2000-04-03 15:40:30 +00:00
Andy Thomas
a677128f0a Sun Apr 2 16:55:47 BST 2000
* app/bezier_select.c

	Curves/Path tool
	Fixed propblem with deleting points. You can now delete the first
	and last point on any open curve (as well as mid-points).

	Also fixed some problems where some points would leave the markers
	on screen after they had been deleted.

	Note you have always been able to delete whole curves by pressing
	the "shift" key when over a point to be deleted in "remove mode".
2000-04-02 16:33:28 +00:00
Garry R. Osgood
b9afb940c2 gimp/app/bezier_select.c No fooling, #6903 was not that hard to close; in
2000-04-01 Garry R. Osgood <gosgood@idt.net>

* gimp/app/bezier_select.c
No fooling, #6903 was not that hard to close;
in bezier_edit_point_on_curve(),when point
deletion reduces a curve below the minimum
with which the implementation can cope (2
anchors, four controls) we put it out of its
misery with an invocation of delete_whole_curve().
2000-04-02 01:33:26 +00:00
Manish Singh
5bbe56d364 use the proper local variable on creation, not the uninitialized one.
* app/by_color_select.c: use the proper local variable on creation, not the
uninitialized one. Fixes bug #8149.

-Yosh
2000-03-31 12:23:11 +00:00
Michael Natterer
c497d9c140 app/bezier_select.h app/bezier_selectP.h app/by_color_select.[ch]
2000-03-29  Michael Natterer  <mitch@gimp.org>

	* app/bezier_select.h
	* app/bezier_selectP.h
	* app/by_color_select.[ch]
	* app/ellipse_select.[ch]
	* app/free_select.[ch]
	* app/move.[ch]
	* app/rect_select.[ch]: kindof selection tools code review:

	- use SelectOps instead of int.
	- removed some unused prototyped and callbacks.
	- don't show the SELECTION_MOVE_MASK cursor if there is no
	  selection and don't try to move the mask in that case.
	- re(?)-enabled moving the selection mask even if there is a
	  floating selection.
	- usual bunch of cleanups.
2000-03-28 23:39:32 +00:00
Sven Neumann
b7940e1ebf new function gimp_dialog_hide() that calls gdk_window_withdraw() after
gtk_widget_hide() so dialogs actually go away even if the user iconified
them before. Should fix bugs #2961, #5293, #6441 and #7849.


--Sven
2000-03-28 23:02:05 +00:00
Sven Neumann
e585b34327 hide the file_selector when the main dialog is unmapped
* app/curves.c:
* app/levels.c: hide the file_selector when the main dialog is unmapped

* app/fileops.c: indentation


--Sven
2000-03-27 19:57:02 +00:00
Michael Natterer
e89a344148 the button_press and cursor_update functions were still doing checks on
2000-03-27  Michael Natterer  <mitch@gimp.org>

	* app/transform_core.c: the button_press and cursor_update
	functions were still doing checks on the active layer instead of
	the active drawable.
	Fixing this automatically made the layers mask transformable.
2000-03-27 00:55:28 +00:00
Garry R. Osgood
3baaaaa33b gimp/app/bezier_select.c in bezier_add_point(), when a BEZIER_MOVE type
2000-03-26 Garry R. Osgood <gosgood@idt.net>

* gimp/app/bezier_select.c
in bezier_add_point(), when a BEZIER_MOVE type
point is being added to a path with at least
one extant segment, the point is re-typed
to a BEZIER_ANCHOR (which is old behavior)
and designated as the current anchor
(which is new behaviour). With this change,
motion events move the (second) control point
and indicia are properly updated. This closes
#6225.
2000-03-26 22:42:14 +00:00
Michael Natterer
5735b2adcd add an "add_alpha" parameter to allow selected regions to be extracted
2000-03-26  Michael Natterer  <mitch@gimp.org>

	* app/gimage_mask.[ch] (gimage_mask_extract): add an "add_alpha"
	parameter to allow selected regions to be extracted without having
	an alpha channel added.

	* app/global_edit.c: pass add_alpha = TRUE.

	* app/transform_core.[ch]: made the transform core work on
	non-layer drawables even if no selection is present. Fixes #7485
	and #7555.

	- transform_core_cut(): extract the mask without alpha if
	  operating on a non-layer without having a selection.
	- transform_core_paste(): return a boolean indicating success
	  instead of a layer and handle channels correctly.
	- transform_core_do(): if the "floating_tiles" passed to the
	  function are from an un-floated non-layer, treat the whole
	  non-layer as alpha channel and never enter the loop which
	  transforms the (not present) color channels.
	  Also clip the result to ensure that the channel never grows
	  larger then the image.

	* app/tools_cmds.c
	* tools/pdbgen/pdb/tools.pdb: transform_core_paste() returns a
	gboolean now.
2000-03-26 18:39:03 +00:00
Michael Natterer
3e64ff6a1b new global variable "gimp_busy" which gets set/unset whenever busy cursors
2000-03-25  Michael Natterer  <mitch@gimp.org>

	* app/cursorutil.[ch]: new global variable "gimp_busy" which gets
	set/unset whenever busy cursors are added/removed.

	* app/info_dialog.c: register the info dialogs with the dialog
	handler.

	* app/fuzzy_select.[ch]: cleanups.

	Here starts the ugly workaround which simulates something like
	locking. If it works, it will close lots of bugs, if not, it's
	easy to remove again.

	So far, I didn't find strange side effects but Gimp is told to be
	a complex program :-) Please test this.

	* app/context_manager.c: don't allow tool changes if gimp_busy
	is TRUE.

	* app/disp_callbacks.c: don't allow mouse and key events in the
	display_canvas if gimp_busy is TRUE.
	(except if the current tool is FUZZY_SELECT and it is ACTIVE,
	 which is very ugly)
	Also block other stuff like dropping colors/patterns etc.

	* app/gdisplay_ops.c: don't close any display while Gimp is
	busy. This is not really what we want but at least it prevents
	crashes.
2000-03-25 18:17:01 +00:00
Stanislav Brabec
b08f5860df i18n fix 2000-03-25 13:12:01 +00:00
Michael Natterer
919958e6b8 really cleaning up this time
--Mitch
2000-03-21 17:47:32 +00:00
Sven Neumann
c6b6cd9d7a app/fileops.c when reverting an image, reconnect all affected views to the
* app/fileops.c
* app/gdisplay.[ch]: when reverting an image, reconnect all
  affected views to the reverted version. This fixes one of the
  bugs Tigert pointed out at GUADEC.

* app/gimage_mask.[ch]
* app/flip_tool.c: cleanups


--Sven & Mitch
2000-03-21 03:19:11 +00:00
SHIRASAKI Yasuhiro
22634f1990 added missing argument for error message.
* app/text_tool.c: added missing argument for error message.

-- yasuhiro
2000-03-16 10:03:01 +00:00
Sven Neumann
c104ee5fda renamed "Custom from Editor" to "Custom Gradient" and added the
possibility to drop gradients onto the blend tooloptions to set
the blend mode and the gradient in one move.


--Sven
2000-03-10 01:57:10 +00:00
Sven Neumann
79757c8248 for indexed images set Index in the info_window to N/A if sample_merged or
* app/color_picker.c: for indexed images set Index in the info_window
  to N/A if sample_merged or sample_average is active.


--Sven
2000-03-09 13:02:11 +00:00
Sven Neumann
ad55aef27e gimp_drawable_get_color_at() now silently returns NULL again if the
* app/gimpdrawable.c: gimp_drawable_get_color_at() now silently
returns NULL again if the coordinates are out of range. A lot of
code using this function relies on this feature and correctly
checks the return value. No need to emit critical warnings here.

The GTK_CHECK_TYPE macro test for obj != NULL, no need to do this
check twice. Removed lots of unnecessary calls to g_return_if_fail().

* app/color_picker.c: with the old behaviour of
gimp_drawable_get_color_at() the code is a bit simpler.

* app/fuzzy_select.c: fuzzy_select relied on drawable_offsets()
returning off_x = off_y = 0 if drawable == NULL. Decided to change
this here, fixes bug #7077.

* app/gimpimage.[ch]: Even though we made bad experiences with the
changes in gimpdrawable.c, I have introduced similar argument checks
here.

* app/image_map.c: indentation


--Sven
2000-03-09 11:58:03 +00:00
Tor Lillqvist
85f0393bae app/cursorutil.c (gtkutil_compress_motion) Guard against gdk_event_get
2000-03-08  Tor Lillqvist  <tml@iki.fi>

* app/cursorutil.c (gtkutil_compress_motion)
* app/edit_selection.c (process_event_queue_keys): Guard against
gdk_event_get returning NULL (which can happen at least on Win32).

* libgimp/gimp.def: Add a couple of new entry points.

* plug-ins/makefile.{cygwin,msc}: Update according to the source
file changes. Fix some typos in the .msc file.

Fixes by Hans Breuer:

* app/resize.c: Add some more includes.

* libgimp/gimpenv.c
* plug-ins/gflare/gflare.c: Win32 header lossage fixup.
2000-03-08 18:32:31 +00:00
Michael Natterer
5759a5fff6 immediate cursor_update feedback on modifier events.
2000-03-07  Michael Natterer  <mitch@gimp.org>

	* app/by_color_select.c: immediate cursor_update feedback on
	modifier events.

	* libgimp/gimpwidgets.c: one more s/private_tip/help_data/
2000-03-07 20:00:07 +00:00
Michael Natterer
21e95fdf43 Makefile.am cursors/selection_move.xbm cursors/selection_move_mask.xbm new
2000-03-04  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* cursors/selection_move.xbm
	* cursors/selection_move_mask.xbm
	* app/cursorutil.[ch]: new cursor for moving the selection
	mask. Looks imho nicer than the ugly GDK_DIAMOND_CROSS.

	* app/move.c
	* app/rect_select.c: use the new cursor.

	* app/paint_core.c: check for the statusbar's context_id in the
	cursor_update function. Fixes gdk_criticals with the line preview
	(which doesn't need a mouse click). Minor cleanups.

	* app/tool_options.c: put the paint_pressure options in a
	GtkHWrapBox instead of a GtkHBox. Makes the size of the dialog a
	bit less locale-dependent.

	* plug-ins/common/xbm.c: use accessor functions instead of using
	the parasite's fields directly.
2000-03-05 00:06:11 +00:00
Manish Singh
da1069cac2 I lied. Real 1.1.18 stuff
-Yosh
2000-03-04 03:39:19 +00:00
Michael Natterer
83bb5a38b8 s/"Only"/"only"/
2000-03-03  Michael Natterer  <mitch@gimp.org>

	* app/crop.c: s/"Only"/"only"/

	* app/iscissors.c: one more cursor_update fix. This time I don't
	claim that it's _really_ correct.

	* app/tool_options.c: don't add a separator after
	opacity/paint_mode if a paint pressure options box follows.

	* cursors/bad.xbm
	* cursors/bad_mask.xbm: made it FAT (no need to use thin lines
	which show as much as possible of the image below because the
	cursor indicates that no operation is possible).

	* libgimp/gimpprotocol.[ch]: s/int/gboolean/ where appopriate,
	indentation paranoia.

	_gp_*_read(): free the already allocated parts of the message if
	reading a subsequent part fails. These cleanups will probably occur
	shortly before the process crashes, but at least they make the
	search for real leaks easier.

	* plug-ins/common/uniteditor.c: some more tooltips.

	* plug-ins/common/xbm.c: store the image comment in the
	"gimp-comment" parasite and the hot spot in the new "hot-spot"
	parasite. Added ui for entering the hot spot.

	* docs/parasites.txt: documented the new "hot-spot" parasite.
2000-03-04 00:24:39 +00:00
Michael Natterer
f4917054a9 this time cursor_update feedback is _really_ correct: for closed curves,
2000-03-03  Michael Natterer  <mitch@gimp.org>

	* app/iscissors.c: this time cursor_update feedback is _really_
	correct: for closed curves, show the "point" cursor if a mouse
	click will modify the curve and the "bad" cursor if a mouse click
	will do nothing. Seems it was not too hard to understand how it
	works...

	* plug-ins/common/uniteditor.c: for consistency, did a
	s/"Delete","Undelete"/"Don't Save","Save"/.
2000-03-03 13:01:49 +00:00
Michael Natterer
6e48bd16b7 Iscissors was using rect_select_cursor_update which is totally wrong since
2000-03-02  Michael Natterer  <mitch@gimp.org>

	* app/iscissors.c: Iscissors was using rect_select_cursor_update
	which is totally wrong since the oper_update_func tool method was
	introduced (in fact it didn't even give correct feedback before).

	Added oper_update_func, modifier_key_func, cursor_update_func for
	Iscissors which give correct cursor_update feedback now. The only
	remaining inconsistency occurs when a curve is closed: There's no
	way to find out if the mouse is over a control point/line or
	outside (without touching the Iscissors engine, which I didn't
	want to do because I don't understand how it works ;-).
2000-03-02 20:09:12 +00:00
Sven Neumann
ea39b49cc8 fixed my latest "fix"
--Sven
2000-03-02 00:03:28 +00:00
Michael Natterer
9004346179 added a modifier_key_func which gives immediate cursor_update feedback on
2000-03-02  Michael Natterer  <mitch@gimp.org>

	* app/rect_select.[ch]: added a modifier_key_func which gives
	immediate cursor_update feedback on modifier key events.

	* app/ellipse_select.c
	* app/free_select.c
	* app/fuzzy_select.c
	* app/rect_selectP.h: call the new function.
	Added current_[x|y] fields to the tools' structures which get
	updated from the "motion" functions. They have to appear in the
	same order in all structures because the modifier_key_func treats
	them all as rectangular selection tools.
	This is ugly and cries for a object hierarchy of tools.
2000-03-01 23:22:43 +00:00
Michael Natterer
723662a460 Makefile.am a proper naming scheme for all cursor files. Added zoom_in and
2000-03-01  Michael Natterer  <mitch@gimp.org>

	* Makefile.am
	* cursors/*: a proper naming scheme for all cursor files. Added
	zoom_in and zoom_out cursors.

	* app/bezier_select.c
	* app/by_color_select.c
	* app/cursorutil.[ch]
	* app/rect_select.c
	* app/scale.[ch]: changed according to the new cursor names. Some
	minor fixes.

	* app/magnify.[ch]: made the zoom_in/zoom_out toggle a proper
	tool_toggle and show cursors for the two modes.

	* plug-ins/print/print-util.c: patch from Robert Kravitz which
	fixes printing layers with alpha.
2000-03-01 19:32:41 +00:00
Sven Neumann
9a8a390b65 return without warning if popup_timeout is already set. Suppresses warning
* app/gimpcontextpreview.c: return without warning if popup_timeout
   is already set. Suppresses warning that occured on double-click.

 * app/layers_dialog.[ch]
 * app/menus.c: added "Delete Mask" menu entry and removed dialog
   asking if mask is to applied or discarded on "Apply Mask".

 * app/tools.c: Magnify is not a transform tool


--Sven
2000-02-29 23:19:14 +00:00
Sven Neumann
e00de7cbb9 fixed off-by-one error for the x coordinate fixed scaling without
* app/measure.c: fixed off-by-one error for the x coordinate
* app/transform_core.c: fixed scaling without interpolation (bug #6681)


--Sven
2000-02-28 22:56:06 +00:00
GMT 2000 Adam D. Moss
f5b589820b added gtkutil_compress_motion() utility function to seek and destroy
Mon Feb 28 19:11:39 GMT 2000  Adam D. Moss <adam@gimp.org>

	* app/cursorutil.c app/cursorutil.h:
	added gtkutil_compress_motion() utility function to seek and
	destroy outstanding pointer motion events from the gdk event queue
	for a given widget.

	* app/edit_selection.c:305: Use gtkutil_compress_motion() to
	do a more thorough job of tracking motion (something recently
	started interleaving our motion events with others, largely
	nullifying the effectiveness of GDK_POINTER_MOTION_HINT_MASK).

	* app/edit_selection.c:704: Yikes, the key-press snooping code
	was turning part of the event queue back-to-front with each
	compressed key-press.  (Still looks a bit bogus overall; looks
	as though it could transplant a whole chunk of the start of
	the event queue right onto the end.  I'll probably disable it
	unless someone points out that I'm a doofus.)
2000-02-28 19:25:42 +00:00
Garry R. Osgood
bdbb45d87c gimp/app/by_color_select.c gimp/app/color_picker.c gimp/app/gimpdrawable.c
2000-02-27 Garry R. Osgood <gosgood@idt.net>

* gimp/app/by_color_select.c
* gimp/app/color_picker.c
* gimp/app/gimpdrawable.c
* gimp/app/image_map.c
* gimp/app/paint_core.c
Inadvertent logic error in g_return_val_if_fail()
style sanity checks implemented in
gimp_drawable_get_color_at() gave rise to
segment violation reported in #6624;
error admitted out-of-bounds x&y that
do not map to tiles. Closes #6624.
GTK-critical warnings which result from
this new sanity check require that
gimp_drawable_get_color_at() clients
perform initial culling of out-of-bounds
x & y coordinates.
2000-02-28 02:40:44 +00:00
Michael Natterer
ae38b99c21 another leak: don't allocate the PaintPressureOptions structure twice for
2000-02-24  Michael Natterer  <mitch@gimp.org>

	* app/tool_options.c: another leak: don't allocate the
	PaintPressureOptions structure twice for one tool.
2000-02-24 02:11:10 +00:00
Sven Neumann
40779fe370 quick GUI fix for the text_tool
--Sven
2000-02-24 00:51:00 +00:00
Sven Neumann
8dead13522 fixed bug #6526
--Sven
2000-02-23 23:42:25 +00:00
Michael Natterer
863b24917c it's more intelligent to implement the parent_context stuff with
2000-02-22  Michael Natterer  <mitch@gimp.org>

	* app/gimpcontext.[ch]: it's more intelligent to implement the
	parent_context stuff with gtk_signal_connect_object() instead of
	having internal callbacks for each context attribute.
	Exported the existing gimp_context_*_changed() functions and
	changed them to do nothing but emitting the signal.

	* app/app_procs.c
	* app/tools.c
	* app/transform_tool.c: use gimp_context_tool_changed() instead of
	gtk_signal_emit_by_name().
2000-02-22 17:06:44 +00:00
Sven Neumann
e836901c83 more places with Solaris compilation problems
--Sven
2000-02-21 12:05:45 +00:00
Michael Natterer
0a5fadee17 app/perspective_tool.c app/rotate_tool.c app/scale_tool.c app/shear_tool.c
2000-02-21  Michael Natterer  <mitch@gimp.org>

	* app/perspective_tool.c
	* app/rotate_tool.c
	* app/scale_tool.c
	* app/shear_tool.c
	* plug-ins/common/gauss_iir.c
	* plug-ins/common/gauss_rle.c: fix Solaris compilation problems
	reported by Ludovic Poitou <ludovic.poitou@france.sun.com>.

	* libgimp/gimppixmap.[ch]: new function gimp_pixmap_set().

	* plug-ins/gfig/gfig.c: hacked the ui to use the libgimp widgets &
	constructors and slightly reorganized it to use fewer screen
	space (not yet perfect). Did a general namespace & code cleanup.

	* plug-ins/FractalExplorer/FractalExplorer.c: use a GimpPathEditor
	widget.
2000-02-21 11:54:33 +00:00
Sven Neumann
65f23289dc do not ignore the mask of the tool icons
--Sven
2000-02-20 02:46:53 +00:00
Sven Neumann
c878108f4a ignore motion_events in a time-window of 100ms after the last event. Was
* app/fuzzy_select.c: ignore motion_events in a time-window of
  100ms after the last event. Was intended as a workaround for bug
  #5949, but IMO it makes the tool more responsive and easier to
  control.

* app/nav_window.c: as a workaround for bug #5955 move the
  navigation popup on screen if used to close to the screen borders.
  Moving the cursor will make the image scroll by a large amount
  eventually, but IMHO this is better than having a nonfunctional
  navigation popup.

* plug-ins/common/curve_bend.c
* plug-ins/gap/gap_decode_xanim.c: fixed typos


--Sven
2000-02-19 13:19:08 +00:00
Michael Natterer
bf72684e5a app/paint_options.h put the pointer to tool's private context to the
2000-02-18  Michael Natterer  <mitch@gimp.org>

	* app/paint_options.h
	* app/tool_options.h: put the pointer to tool's private context to
	the PaintOptions structure instead of attaching it to the
	paint_mode optionmenu (which does not exist for all paint tools
	which have a private context). Fixes bug #6308.
2000-02-18 21:22:13 +00:00
Sven Neumann
defbe35de6 forgot to exclude airbrush_blob.[ch] from the build
* app/Makefile.am: forgot to exclude airbrush_blob.[ch] from the build

* app/gimpbrushgenerated.c
* app/ink.c
* app/measure.c
* app/rotate_tool.c: use gimp_rad_to_deg and gimp_deg_to_rad macros


--Sven
2000-02-18 18:20:04 +00:00
Sven Neumann
fde312118a Cleaned up the Path header mess.
--Sven
2000-02-16 13:52:33 +00:00
Sven Neumann
1cde0279ff Moved some functions out of paths_dialog.c into the new file
paths.c and did a general namespace cleanup:
s/PATHP/Path*/  s/PATHIMAGELISTP/PathList/ and friends.

Paths are now copied on image duplicate (fixes bug #5726).

Removed Path Tool and XInput Airbrush from the build and
renamed "Layers & Channels" to "Layers, Channels & Paths".

Applied patch from Wolfgang Hofer to xjt.c that enables loading
and saving of paths based on Andy's change explained below.


--Sven
2000-02-16 01:47:22 +00:00
Michael Natterer
2715fd15c8 app/Makefile.am removed.
2000-02-14  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/vector2d.[ch]: removed.

	* app/gimpbrush.h
	* app/paint_core.c: use the vectors from libgimp.
2000-02-14 18:09:33 +00:00
Michael Natterer
260d7b2d1d plug-ins/libgck/gck/Makefile.am plug-ins/libgck/gck/gckcommon.h
2000-02-14  Michael Natterer  <mitch@gimp.org>

	* plug-ins/libgck/gck/Makefile.am
	* plug-ins/libgck/gck/gckcommon.h
	* plug-ins/libgck/gck/gcklistbox.[ch]
	* plug-ins/libgck/gck/gckmath.[ch]
	* plug-ins/libgck/gck/gckvector.[ch]: removed.

	* plug-ins/libgck/gck/gck.h
	* plug-ins/libgck/gck/gcktypes.h: modified accordingly.

	* libgimp/Makefile.am
	* libgimp/gimpvector.[ch]: new files. Modified the vector
	functions from GCK. Changed the licence to LGPL, if there are any
	objections, please let me know.

	* libgimp/gimp.h: #include "gimpvector.h"

	* libgimp/gimpmath.h: added deg <-> rad conversion macros.

	* libgimp/gimpmatrix.[ch]: added a 4x4 vector to rotation angle
	function from GCK,
	s/GimpMatrix,gimp_matrix/GimpMatrix3,gimp_matrix3/

	* plug-ins/Lighting/*
	* plug-ins/MapObject/*:
	s/GckVector,gck_vector/GimpVector,gimp_vector/

	* app/pathsP.h
	* app/paths_dialog.c
	* app/perspective_tool.[ch]
	* app/rotate_tool.[ch]
	* app/scale_tool.[ch]
	* app/shear_tool.[ch]
	* app/tools_cmds.c
	* app/transform_core.[ch]
	* tools/pdbgen/pdb/tools.pdb:
	s/GimpMatrix,gimp_matrix/GimpMatrix3,gimp_matrix3/
2000-02-14 16:29:41 +00:00
Michael Natterer
2b92a59e64 po/POTFILES.in app/Makefile.am removed.
2000-02-13  Michael Natterer  <mitch@gimp.org>

	* po/POTFILES.in
	* app/Makefile.am
	* app/buildmenu.[ch]: removed.

	* app/blend.c
	* app/brush_select.c
	* app/curves.c
	* app/histogram_tool.c
	* app/layers_dialog.c
	* app/lc_dialog.c
	* app/levels.c
	* app/paint_options.h
	* app/paintbrush.c
	* app/tool_options.c: use the libgimp option menu
	constructor. Removed paint_mode_menu_set_history().

	* app/colormap_dialog.i.c
	* app/colormap_dialog.p.h: use a popup menu as in the palette
	dialog instead of a pulldown menu.

	* app/channels_dialog.c: made color dnd to a channel widget work
	again.

	* libgimp/gimpwidgets.[ch]: new function
	gimp_option_menu_set_history() which sets the history according to
	user_data as passed to gimp_option_menu_new().
2000-02-13 22:26:41 +00:00
Michael Natterer
f0ae0dccd4 app/brush_select.c app/paint_options.h use new function
2000-02-13  Michael Natterer  <mitch@gimp.org>

	* app/brush_select.c
	* app/paint_options.h
	* app/tool_options.c: use new function
	paint_mode_menu_set_paint_mode() instead of
	gtk_option_menu_set_history() because the order of paint modes in
	the menu is different from the one in the LayerModeEffects enum
	(fixes bug #6190). Create the menu with the libgimp menu
	constructor.
2000-02-13 13:14:34 +00:00
Sven Neumann
1b0928ec7b fixed bug #6092
--Sven
2000-02-10 14:43:51 +00:00
Sven Neumann
630fe55d17 Cleaned up after Adam ;-)
* app/edit_selection.c: Finally moved selections snap to the
   guides again. Layer moves are slightly faster than before, if no
   guides are present.

 * app/gdisplay.c
 * app/gdisplay.h
 * app/gdisplayP.h: Use doubles for snap_to_point. Less rounding
   makes the result much better on low resolution. If it snaps, the
   result should be exactly the guide in almost all cases now. Only
   at very low resolutions, you may end up with an error of 1 pixel.
   Some code cleanup while I was on it... Fixes bug #2353.


--Sven
2000-02-10 14:23:11 +00:00
Marc Lehmann
287455a398 *** empty log message *** 2000-02-10 04:16:52 +00:00
Michael Natterer
22f266494b you can now drag the active tool out of the tool options dialog title.
2000-02-10  Michael Natterer  <mitch@gimp.org>

	* app/tools.c: you can now drag the active tool out of the tool
	options dialog title. Added a tooltip.
2000-02-10 01:49:45 +00:00
Sven Neumann
b20f154ac8 app/interface.c app/pixmaps2.h use new icons courtesy by Tigert.
* app/interface.c
 * app/pixmaps2.h
 * app/tools.c: use new icons courtesy by Tigert.

 * plug-ins/common/gauss_iir.c
 * plug-ins/common/gauss_rle.c
 * plug-ins/common/spread.c: enlarged maximum values

--Sven
2000-02-10 01:49:45 +00:00
Sven Neumann
d517927260 Use static GdkPixmaps in the image_window and for the tool icons.
--Sven
2000-02-08 23:45:20 +00:00
Michael Natterer
3a0da284c8 show our selection mode cursors (REPLACE, ADD, ...) depending on the
2000-02-08  Michael Natterer  <mitch@gimp.org>

	* app/by_color_select.c: show our selection mode cursors (REPLACE,
	ADD, ...) depending on the modifier state and the "Selection Mode"
	toggles in the tool's dialog.
2000-02-08 23:35:41 +00:00
Sven Neumann
6fe8e7ee61 unref gdk_pixmaps and gdk_bitmaps
cosmetics


--Sven
2000-02-08 20:48:48 +00:00
Sven Neumann
a1aeeda486 make it behave like the other non-toolbox tools
--Sven
2000-02-08 12:14:53 +00:00
Michael Natterer
ef17866973 app/* libgimp/* plug-ins/* did a global s/GUnit/GimpUnit/ and
2000-02-07  Michael Natterer  <mitch@gimp.org>

	* app/*
	* libgimp/*
	* plug-ins/*
	* tools/pdbgen/*: did a global s/GUnit/GimpUnit/ and
	s/GimpSizeEntryUP/GimpSizeEntryUpdatePolicy/

	* libgimp/gimpcolorspace.c: renamed the parameter names to match
	the names in the header.

	* libgimp/gimphelpui.h
	* libgimp/gimpimage.c
	* libgimp/gimpmatrix.h
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimpunit.[ch]
	* libgimp/gimpunitmenu.[ch]
	* libgimp/gimpwidgets.[ch]: added documentation and use g* types
	all over the place (enables cross-referencing with the glib and
	gtk+ html documentation).

	* plug-ins/common/exchange.c
	* plug-ins/common/max_rgb.c: small cleanups.

	* plug-ins/common/mapcolor.c: the color buttons were attached in
	the wrong order.
2000-02-07 20:35:13 +00:00
Stanislav Brabec
ce6050ad5f win32 purification, rgb<->hsv remove 2000-02-07 15:49:54 +00:00
Sven Neumann
c9482821ab mostly header cleanup and i18n
--Sven
2000-01-31 23:59:05 +00:00
Michael Natterer
ebd978825c app/blend.c app/brightness_contrast.c app/color_balance.c
2000-02-01  Michael Natterer  <mitch@gimp.org>

	* app/blend.c
	* app/brightness_contrast.c
	* app/color_balance.c
	* app/color_picker.c
	* app/crop.c
	* app/curves.c
	* app/flip_tool.c
	* app/histogram_tool.c
	* app/hue_saturation.c
	* app/levels.c
	* app/magnify.c
	* app/measure.c
	* app/move.c
	* app/path_tool.c
	* app/posterize.c
	* app/text_tool.c
	* app/threshold.c
	* app/tool_options.c
	* app/transform_tool.c: unify the usage of "Selection" and
	"<blah> Tool" and removed the word "Options" from all tool option
	title strings because the dialog title already says "Options".
2000-01-31 21:27:00 +00:00
Sven Neumann
7d837ccf67 added submenus to the tools menu
--Sven
2000-01-31 21:09:42 +00:00
Michael Natterer
03015f85d7 merged the table attach helper functions into one function.
2000-02-01  Michael Natterer  <mitch@gimp.org>

	* libgimp/gimpwidgets.[ch]: merged the table attach helper
	functions into one function.

	* app/*
	* plug-ins/*: changed the calls to gimp_table_attach_aligned()
	accordingly. Did minimal ui updates (spacing and stuff) in some
	files.
2000-01-31 03:13:02 +00:00
Sven Neumann
07cd86c451 use color_conversion routines out of libgimp
--Sven
2000-01-30 23:56:04 +00:00
Sven Neumann
4e38e85594 i18n
--Sven
2000-01-30 02:48:50 +00:00
Michael Natterer
4923047146 removed BOUNDS, MINIMUM and MAXIMUM. No need to include both <glib.h> and
2000-01-25  Michael Natterer  <mitch@gimp.org>

	* app/appenv.h: removed BOUNDS, MINIMUM and MAXIMUM. No need to
	include both <glib.h> and <gtk/gtk.h>.

	* app/*
	* tools/pdbgen/pdb/text_tool.pdb: s/BOUNDS/CLAMP/,
	same for MIN and MAX.

	* app/preferences_dialog.c: the "Check Size" widget was connected
	to the transparency_type variable.

	* plug-ins/common/sobel.c: removed definitions of MIN and ROUND.

	* libgimp/gimp.h: #include "gimplimits.h" and "gimpcolorspace.h".

	* plug-ins/*: don't include the two files.
2000-01-25 23:06:12 +00:00
Michael Natterer
fa30ba04c7 configure.in po-plug-ins/POTFILES.in plug-ins/common/Makefile.am
2000-01-25  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* po-plug-ins/POTFILES.in
	* plug-ins/common/Makefile.am
	* plug-ins/common/plugin-defs.pl
	* plug-ins/megawidget/*: removed. (There were only 3 functions
	left which were used by ~5 plugins, so I moved the resp. functions
	to the plugins). More preview stuff to come...

	* app/airbrush_blob.c
	* modules/colorsel_triangle.c
	* modules/colorsel_water.c: use G_PI instead of M_PI.

	* app/procedural_db.h
	* libgimp/gimpenums.h
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: new PDB return value STATUS_CANCEL which
	indicates that "Cancel" was pressed in a plugin dialog. (Useful
	only for file load/save plugins).

	* app/fileops.[ch]
	* app/menus.c: changes to handle STATUS_CANCEL correctly. Did some
	code cleanup in fileops.[ch]. Pop up a warning if File->Save
	failed.

	* app/plug_in.c: return_val[0] is of type PDB_STATUS, not
	PDB_INT32.

	* libgimp/gimpmath.h: new constant G_MAXRAND which equals to
	RAND_MAX if it exists or to G_MAXINT otherwise.

	* libgimp/gimpwidgets.[ch]: new function gimp_random_seed_new()
	which creates a spinbutton and a "Time" toggle.
	Call the function which does the "set_sensitive" magic from the
	radio button callback.

	* plug-ins/[75 plugins]:

	- Return STATUS_CANCEL in all file load/save dialogs if "Cancel"
	  was pressed.
	- Standardized the file plugins' "run" functions.
	- Use G_PI and G_MAXRAND everywhere.
	- Added tons of scales and spinbuttons instead of text entries.
	- Applied uniform packing/spacings all over the place.
	- Reorganized some UIs (stuff like moving the preview to the top
	  left corner of the dialog).
	- Removed many ui helper functions and callbacks and use the stuff
	  from libgimp instead.
	- I tried not to restrict the range of possible values when I
	  replaced entries with spinbuttons/scales but may have failed,
	  though in some cases. Please test ;-)
	- #include <libgimp/gimpmath.h> where appropriate and use it's
	  constants.
	- Indentation, s/int/gint/ et.al., code cleanup.

	RFC: The plugins are definitely not useable with GIMP 1.0 any
	     more, so shouldn't we remove all the remaining compatibility
	     stuff ??? (like "#ifdef GIMP_HAVE_PARASITES")
2000-01-25 17:46:56 +00:00
GMT 2000 Austin Donnelly
c5c95ff976 update my entry. I maintain newsprint.
Sat Jan 22 22:14:18 GMT 2000  Austin Donnelly  <austin@gimp.org>

	* MAINTAINERS: update my entry.
	* PLUGIN_MAINTAINERS: I maintain newsprint.

	* app/fuzzy_select.c: fix so if you move the pointer back to
	   where you started, the selection is also the same.  Can people
	   (tigert?) give this a spin - if it isn't as intuitive as the
	   old way we should roll this back.

	* plug-ins/common/jpeg.c: use volatile to get rid of "clobber"
	   warnings from GCC.  Also, fix handling of multiple COM
	   sections, so can load images such as
	   /usr/share/pixmaps/backgrounds/space/clem_full_moon_strtrk.jpg or
	   /usr/share/pixmaps/backgrounds/space/apollo08_earthrise.jpg
	   which used to segv the jpeg plugin.

	* plug-ins/common/newsprint.c: update my email address.

	* plug-ins/common/ps.c: applied gimp-kirchgessner-000116-0.patch:
	   save using PostScript level 2 features which result in files
	   60% smaller than naive level 1 method.  Peter added a
	   checkbutton to the UI to revert to level 1 algorithm, but we
	   default to level 2.  Almost everyone should have a level 2
	   printer, new printers and ghostscript are level 3 these days.
2000-01-22 22:26:20 +00:00
Seth Burgess
cf7cf417e2 Fix for NULL pointer dereference by Steinar (sesse)
Modified Files:
 	ChangeLog app/transform_core.c
2000-01-22 03:01:46 +00:00
Sven Neumann
aedefe422a laod and save for the curves tool
--Sven
2000-01-20 12:22:54 +00:00
Sven Neumann
2f445a6fc5 exchanged the big fat bigcirc cursors against a new one in the style of
the others


--Sven
2000-01-19 20:40:58 +00:00
Garry R. Osgood
61bbabc6ad gimp/app/disp_callbacks.c gimp/app/ellipse_select.c gimp/app/free_select.c
2000-01-19  Garry R. Osgood <gosgood@idt.net>
* gimp/app/disp_callbacks.c
* gimp/app/ellipse_select.c
* gimp/app/free_select.c
* gimp/app/fuzzy_select.c
* gimp/app/rect_select.c
* gimp/app/rect_select.h
* gimp/app/rect_selectP.h
* gimp/app/tools.c
* gimp/app/tools.h
* gimp/app/toolsF.h

Boolean selection operations, (adding to,
subtracting from, or intersecting with
pre-existing functions) now occur regardless
of the setting of "Disable Cursor Update"
toggle button in Interface/Image Window
category. Introduced a new tool action type,
OperUpdateFunc, To provide a distinct context
for such activity. see
http://idt.net/~gosgood/gimp-patch/patch05.html
for full details. Closes #2568.
2000-01-19 19:06:13 +00:00
Tor Lillqvist
5b51c7dbfe Add Win32 workaround for yasuhiro's "i18n fix" change that introduced an
2000-01-18  Tor Lillqvist  <tml@iki.fi>

* app/text_tool.c: Add Win32 workaround for yasuhiro's "i18n fix"
change that introduced an X11 dependency.
2000-01-18 23:12:26 +00:00
SHIRASAKI Yasuhiro
14c3c191e2 plug-ins/common/wmf.c small i18n fixes.
* plug-ins/common/wmf.c
* app/text_tool.c: small i18n fixes.

-- yasuhiro
2000-01-15 18:06:15 +00:00
Sven Neumann
baf3933a9d fixed bug #5176 (smudge tool crash)
--Sven
2000-01-14 18:45:36 +00:00
Michael Natterer
fbfdf4b309 app/Makefile.am removed.
2000-01-14  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/tool_options_ui.h: removed.

	* app/tool_options.c
	* libgimp/gimpwidgets.[ch]: moved some more ui utility functions
	to libgimp.

	* app/airbrush.c
	* app/blend.c
	* app/bucket_fill.c
	* app/channel_ops.c
	* app/clone.c
	* app/color_picker.c
	* app/convolve.c
	* app/crop.c
	* app/dodgeburn.c
	* app/eraser.c
	* app/file_new_dialog.[ch]
	* app/flip_tool.c
	* app/image_new.[ch]
	* app/ink.c
	* app/layers_dialog.c
	* app/magnify.c
	* app/measure.c
	* app/paintbrush.c
	* app/pencil.c
	* app/smudge.c
	* app/text_tool.c
	* app/tool_options.c
	* app/transform_tool.c
	* app/xinput_airbrush.c: use the libgimp functions (esp. the radio
	button group constructor), some code cleanup.

	* plug-ins/common/csource.c
	* plug-ins/common/despeckle.c
	* plug-ins/common/diffraction.c
	* plug-ins/common/jpeg.c
	* plug-ins/common/png.c
	* plug-ins/unsharp/unsharp.c: more plugin ui tuning.

	* plug-ins/unsharp/Makefile.am
	* plug-ins/unsharp/dialog_f.[ch]
	* plug-ins/unsharp/dialog_i.[ch]: removed.
2000-01-14 12:41:00 +00:00
David Monniaux
e447b6f310 Clearer tool-tip for the transform tool. 2000-01-12 23:13:00 +00:00
Garry R. Osgood
16d1795918 app/disp_callbacks.c app/gimage_mask.c app/global_edit.c app/interface.c
2000-01-11  Garry R. Osgood <gosgood@idt.net>
* app/disp_callbacks.c
* app/gimage_mask.c
* app/global_edit.c
* app/interface.c
* app/layer.c
* app/layer.h
* app/transform_core.c  Followup to #4708. Some clients
of layer_new_from_tiles() need to specify the
kind of layer they need; added a GimpImageType
parameter for this purpose. Closes #5045.
* app/paths_dialog.c paths_dialog_set_default_op()
now checks for the existence of the path_dialog
before manipulating its internals. Closes #5049;
2000-01-11 20:08:45 +00:00
Sven Neumann
a579edc9ad some small fixes and the new GAP VCR Navigator
--Sven
2000-01-10 23:27:25 +00:00
Sven Neumann
cf608d5182 i18n fix and german po update 2000-01-10 14:36:29 +00:00
Sven Neumann
9a9ee85e28 allow the user to choose the default for "Dot for Dot"
--Sven
2000-01-09 17:31:00 +00:00
Sven Neumann
2ad8a17e7e app/gdisplay.c app/gimage_cmds.c fixed typos
* app/gdisplay.c
 * app/gimage_cmds.c
 * tools/pdbgen/pdb/gimage.pdb: fixed typos

 * app/gimphistogram.c: indentation

 * app/histogramwidget.c: grab the pointer in the histogramwidget,
   so a button_release outside the widget is noticed correctly

 * app/levels.c: instead of undoing the user action, simply don't
   allow the user to set the range in the histogram_widget


--Sven
2000-01-09 12:40:10 +00:00
Michael Natterer
884f223569 app/[all files using the dialog or action area constructors] added a
2000-01-06  Michael Natterer  <mitch@gimp.org>

	* app/[all files using the dialog or action area constructors]
	* libgimp/gimpdialog.[ch]: added a "slot_object" agrument to the
	constructors' va_args lists to allow the action area buttons to be
	connected wich gtk_signal_connect_object().

	* libgimp/gimphelp.c: show the correct help page for plugins.

	* plug-ins/common/CEL.c
	* plug-ins/common/CML_explorer.c
	* plug-ins/common/Makefile.am
	* plug-ins/common/aa.c
	* plug-ins/common/align_layers.c
	* plug-ins/common/animationplay.c
	* plug-ins/common/apply_lens.c
	* plug-ins/common/blinds.c
	* plug-ins/common/blur.c
	* plug-ins/common/bumpmap.c
	* plug-ins/common/checkerboard.c
	* plug-ins/common/colorify.c
	* plug-ins/common/colortoalpha.c
	* plug-ins/common/compose.c
	* plug-ins/common/convmatrix.c
	* plug-ins/common/csource.c
	* plug-ins/common/cubism.c
	* plug-ins/common/curve_bend.c
	* plug-ins/common/decompose.c
	* plug-ins/common/deinterlace.c
	* plug-ins/common/depthmerge.c
	* plug-ins/common/despeckle.c
	* plug-ins/common/destripe.c
	* plug-ins/common/diffraction.c
	* plug-ins/common/displace.c
	* plug-ins/common/grid.c
	* plug-ins/helpbrowser/Makefile.am
	* plug-ins/helpbrowser/helpbrowser.c: use the dialog constructor
	and enable the "F1" help key.
2000-01-06 16:40:17 +00:00
Michael Natterer
1b2b43aba8 I'm maintaining the helpbrowser (Sven, I dared to add your name, too :-)
2000-01-05  Michael Natterer  <mitch@gimp.org>

	* PLUGIN_MAINTAINERS: I'm maintaining the helpbrowser (Sven, I
	dared to add your name, too :-)

	* app/context_manager.c
	* app/flip_tool.[ch]
	* app/perspective_tool.[ch]
	* app/rotate_tool.[ch]
	* app/scale_tool.[ch]
	* app/shear_tool.[ch]
	* app/transform_core.[ch]
	* app/transform_tool.[ch]
	* app/tools_cmds.c
	* tools/pdbgen/pdb/tools.pdb

	- Show the correct help pages in the transform tools' dialogs.
	- The transform tool button of the toolbox is now always pressed
	  if a transform tool is active (not only for "rotate").
	- Replaced the transform action (CREATING, HANDLE_1, ...) and the
	  transform state (INIT, MOTION, ...) #define's with typed enums.
	- Changed the return type of the *_recalc functions to "void"
	  instead of "void *" and the return type of the *_transform
	  functions to "TileManager *" instead of "void *".
	  (I probably removed an artefact here because all *_recalc
	   functions returned "(void *) 1").
	- Use gboolean instead of int where appropriate.
	- Code cleanup, indentation.
2000-01-05 11:18:38 +00:00
Tor Lillqvist
a075daa211 Add gimpcolorspace object.
2000-01-04  Tor Lillqvist  <tml@iki.fi>

* libgimp/makefile.{cygwin.msc}: Add gimpcolorspace object.

* libgimp/gimp.def: Add functions from it.

Fixes from Hans Breuer:

* app/datafiles.c: redefine the executable flag for Win32
to _S_IREAD, to get _all_ files from the plug-in dirs as
executables (including scripts)

* app/main.c: Win32-specific changes to allow building Gimp as a
console application, with all its benefits (like inheriting the
console), but hide it if the user doesn't want it. Also, if stdout
goes to a console, give the user a chance to read the help or
version messages. (tml: I am not convinced that it is better to
build gimp as a console application, but let's try it this way for
a while.)

* app/makefile.{cygwin,msc}: Build as console application, and
link with shell32 library.

* app/paint_core.c (paint_core_motion): Pass the value of a call
to the function gimage_active_drawable() to the paint_func,
instead of just passing the address of gimage_active_drawable...

(tml: This code is only called when the TOOL_TRACES_ON_WINDOW flag
is on, and only the clone tool sets that, and the clone tool's
paint_func doesn't use the drawable argument, so this hasn't
caused any trouble.)

* app/plug_in.c: On Win32, to support scripts, use new function
xspawn() instead of _spawnv. Add some more code to properly kill
plug-ins.

* libgimp/color_display.h: Add G_MODULE_EXPORT declarations.
2000-01-04 17:46:41 +00:00
Sven Neumann
3fc4eb846c libgimp/gimpcolorspace.c Prefixed all functions with gimp_ to avoid
* libgimp/gimpcolorspace.c
* libgimp/gimpcolorspace.h: Prefixed all functions with gimp_
  to avoid namespace collisions.

Changed the License in the header to LGPL. If you don't like this,
please remove those files! (But I would like them to stay since this
moving those functions into libgimp is something that should have
happened much earlier.) Nice work, Daniel!
2000-01-03 01:58:43 +00:00
Marc Lehmann
14d6add3d8 *** empty log message *** 2000-01-02 22:30:20 +00:00
Tor Lillqvist
b48c534756 Some clarifications.
2000-01-02  Tor Lillqvist  <tml@iki.fi>

* README.win32: Some clarifications.

* app/makefile.{cygwin,msc}
* libgimp/makefile.{cygwin,msc}
* plug-ins/makefile.{cygwin,msc}: Changes corresponding to the GTk+
source reorg. Add new files.

* app/text_tool.c: Remove now unnecessary workaround for Win32
POINTS identifier clash.
2000-01-02 11:56:56 +00:00
Sven Neumann
a34415cb7b Removed the obsolete drawable argument from layer_from_tiles.
The layer_type is now taken from the base_type of the image.
Also changed the name to layer_new_from_tiles.


--Sven
2000-01-01 18:33:40 +00:00
Sven Neumann
e713f9bae3 Use our new (sligtly compressed) layout of gtk_file_selection all over the
place.


--Sven
1999-12-30 20:16:58 +00:00
Sven Neumann
0b58c9c94b dialog and keybinding tweaks, i18n issues
--Sven
1999-12-29 16:53:41 +00:00
Sven Neumann
e42ac8999a applied that shear_tool patch that appeared on the list
--Sven
1999-12-29 10:13:26 +00:00
Sven Neumann
7cd5c09f59 more i18n fixes
--Sven
1999-12-28 14:09:20 +00:00
Sven Neumann
e6619b5153 unmarked a few strings for translation
--Sven
1999-12-28 10:30:50 +00:00
Garry R. Osgood
c60db90ff7 Season's Greetings! app/clone.c app/paint_core.c app/paint_core.h Updated
1999-12-25 Garry R. Osgood <gosgood@idt.net>
Season's Greetings!
        * app/clone.c
        * app/paint_core.c
        * app/paint_core.h
        * MAINTAINERS
MAINTAINERS: Updated my entry (it wasn't there ;)
app/paint_core.[ch] supplied new PaintTool states to clone_paint_func() so that
writes of temporary markings made directly to the window are not
clobbered by buffered writes stemming from gdisplay_flush_xxx()
routines. clone_tool_paint_func() has been modified to take advantage
of these new states, retiring bug #2184 in a way that does not change
user interface semantics. There are small additions to the PaintCore
interface that do not affect clientele unaware of added semantics.
These changes are detailed at http://idt.net/~gosgood/gimp-patch/patch03.html.
1999-12-25 21:32:52 +00:00
Sven Neumann
ab44ef86a0 enums should be all UPPER_CASE
--Sven
1999-12-22 23:30:43 +00:00
Sven Neumann
f94312e891 app/menus.c app/tools.c app/tools.h moved the xinput_airbrush before the
* app/menus.c
* app/tools.c
* app/tools.h
* app/toolsF.h: moved the xinput_airbrush before the measure tool,
so it groups nicely with the paint tools. Removed the toolbox_position
from the ToolInfo structure, since it was never used and added some
separators into the Tools menu.


--Sven
1999-12-22 22:24:59 +00:00
Sven Neumann
3520455686 Changed the behaviour of the Gradient Brush to continue with the end color
when using "Once Forward/Backward" modes. Isn't that what was wanted in the
first place? It feels much more intuitive and useful to me. Please complain
if you don't like this.


--Sven
1999-12-22 21:15:58 +00:00
Shirasaki Yasuhiro
05d66c98f9 Fixed typo.
1999-12-18  Shirasaki Yasuhiro  <yasuhiro@gnome.gr.jp>

        * app/transform_tool.c: Fixed typo.

        * plug-ins/common/CEL.c
        * plug-ins/common/aa.c
        * plug-ins/common/align_layers.c
        * po-plug-ins/POTFILES.in: Added gettext support.

-- yasuhiro
1999-12-17 21:24:24 +00:00
GMT 1999 Adam D. Moss
ef445bcd2f Remove old movement code and unused variables.
Mon Dec 20 17:58:59 GMT 1999  Adam D. Moss <adam@gimp.org>

	* app/edit_selection.c: Remove old movement code and unused
	variables.
1999-12-17 20:59:37 +00:00
GMT 1999 Adam D. Moss
c4d032140a Fixed a couple of bugs with translating the selection mask (move tool,
Fri Dec 17 20:29:12 GMT 1999  Adam D. Moss <adam@gimp.org>

	* app/edit_selection.c: Fixed a couple of bugs with translating
	the selection mask (move tool, alt-drag):

	- Selection mask was being clipped whilst moved around, not just
	  at its final resting place.
        - Selection mask translation was being performed 'live' like the
          opaque moves even though there's simply nothing exciting to see.
	  Now the process is much faster.

	Will remove the edit_selection.c dead-code later if this change
	does not cause new trouble.
1999-12-17 20:59:37 +00:00
Michael Natterer
6eae7942fb app/menus.c Minor help system fixes.
1999-12-17  Michael Natterer  <mitch@gimp.org>

	* app/menus.c
	* app/paths_dialog.c: Minor help system fixes.

	* app/app_procs.c: I thought we should have a real splash (without
	decoration). Like it???

	* app/about_dialog.c
	* app/flip_tool.c
	* app/gradient.c
	* app/levels.c
	* app/measure.c
	* app/text_tool.c
	* app/tools.c
	* app/transform_tool.c: Did some code browsing: I18N fixes,
	s/gtk_window_position/gtk_window_set_position/g, indentation
	paranoia, some g/<type>/g<type>/, various stuff (didn't change any
	logic).
1999-12-17 16:37:50 +00:00
Shirasaki Yasuhiro
072323e01d Added missing app/xinput_airbrush.c.
1999-12-17  Shirasaki Yasuhiro  <yasuhiro@gnome.gr.jp>

        * po/POTFILES.in: Added missing app/xinput_airbrush.c.

        * app/perspective_tool.c: Added _() tag.

-- yasuhiro
1999-12-17 01:02:29 +00:00
Manish Singh
30cc3739ae tools/pdbgen/pdbgen.pl allow for array size params to be optional
* tools/pdbgen/pdbgen.pl
* tools/pdbgen/pdb/fileops.pdb: allow for array size params to
be optional

* app/nav_window.c
* app/tools.c: a bit of cleanup

-Yosh
1999-12-14 20:01:01 +00:00
Sven Neumann
73ff9a1757 cosmetic stuff
--Sven
1999-12-14 14:10:34 +00:00
GMT 1999 Austin Donnelly
8e134070e6 fix problem with layers with non-zero offset.
Fri Dec 10 23:55:10 GMT 1999  Austin Donnelly  <austin@gimp.org>

	* app/iscissors.c: fix problem with layers with non-zero offset.

	* app/undo.c: Garry, you missed one "0 -> UNDO_NULL" cleanup :)
1999-12-11 00:10:09 +00:00
Sven Neumann
d4250cb410 please picky compilers
--Sven
1999-12-06 22:44:40 +00:00
GMT 1999 Andy Thomas
19e856f0f6 app/bezier_select.c
Thu Dec  2 23:49:17 GMT 1999 Andy Thomas <alt@gimp.org>

	* app/bezier_select.c

	Fixed bug number #3904. - [gimp-bug] no undo for path strokes.
	Undo menu item is now enabled correctly after the path has been
	stroked.
1999-12-02 23:57:31 +00:00
Michael Natterer
c688e055e2 Default to "Cancel" in the "Really Quit?" dialog.
1999-12-02  Michael Natterer  <mitch@gimp.org>

	* app/app_procs.c: Default to "Cancel" in the "Really Quit?" dialog.

	* app/app_procs.c
	* app/brush_select.c
	* app/gimpbrushlist.c: Call brush_select_[freeze|thaw]_all() from
	brushes_init() and brushes_free(), so refreshing the brushes from
	plugins/scripts is faster.

	* app/brightness_contrast.c
	* app/color_balance.c
	* app/curves.c
	* app/file_new_dialog.c
	* app/hue_saturation.c
	* app/levels.c
	* app/posterize.c
	* app/threshold.c:
	Reorder the action are buttons: [ "OK" "Reset" "Cancel" ]

	* app/menus.c: Some more cleanups in the menu code. Reorder
	<Image>/Filters/Misc only if ot exists. Generalized
	menu_translate() in preparation for correctly supporting catalogs
	which only exist sometimes (like gimp-perl).

	* app/gradient.c
	* app/gradient_select.c: Save some lines of code by using
	gtk_clist_new_with_titles() instead of gtk_clist_new().

	* libgimp/gimpunitmenu.c: Code cleanup and made the clist titles
	of the unit selection un-clickable.
1999-12-02 13:00:18 +00:00
Sven Neumann
ad11737983 close bugs #3910 and #3911
--Sven
1999-11-30 00:58:38 +00:00
Sven Neumann
7427a53c95 Layer to Imagesize in C
--Sven
1999-11-27 14:00:26 +00:00
Michael Natterer
bbda88d670 accidentially replaced "Gradient:" with "Blend:" in my last checkin to
1999-11-26  Michael Natterer  <mitch@gimp.org>

	* app/blend.c: accidentially replaced "Gradient:" with "Blend:" in
	my last checkin to this file. Put the right string back.

	* app/menus.c: fixed the plugin translation problem (YES!!! :-)
	Mysteriously, using g_strdup() et al. instead of composing the
	string to translate in a statically allocated array fixed the
	problem.

	* plug-ins/gap/gap_main.c: fixed a menu path.
1999-11-26 10:17:19 +00:00
Sven Neumann
19ca12e661 purely cosmetic change
--Sven
1999-11-26 00:34:39 +00:00
Michael Natterer
720518b33a Removed the definitions of the tearoff menu items and build them on the
1999-11-25  Michael Natterer  <mitch@gimp.org>

	* app/menus.c: Removed the definitions of the tearoff menu items
	and build them on the fly. Added N_()-marked submenus instead so
	they get properly translated. Removed N_() from all separators.

	Hacked menu_translate(): Don't try to translate separators,
	tearoffs and the /File/MRUxx entries. Avoid multiple lookups in
	the "gimp-std-plugins" domain. Translating plug-in menu entries is
	still broken.

	Defined all filter categories for proper translation and a first
	try to order them and to add separators (please comment...).

	New Category /Filters/Web.

	(Did 'make update-po' in the po* directories and updated the
	german translations.)

	* app/about_dialog.c
	* app/brush_select.c
	* app/drawable.c
	* app/errors.c
	* app/free_select.c
	* app/gradient.c
	* app/info_dialog.c
	* app/plug_in.c
	* app/tool_options.c: minor i18n updates like removing _() from
	some error messages.

	* app/context_manager.c: a private context for the Xinput Airbrush.

	* plug-ins/common/video.c: Register under /Filters/Distorts

	* plug-ins/imagemap/imap_main.c: Register under /Filters/Web
	(Marc, what about putting "prepare for gif" and "webify" there?)

	* plug-ins/perl/po/de.po: s/Xtn/Xtns/g
1999-11-25 11:35:48 +00:00
Sven Neumann
d82cdfc84b restrict movements to 15 degrees (the circle way)
--Sven
1999-11-25 01:59:14 +00:00
Michael Natterer
b6a3dd5acf app/app_procs.c app/channels_dialog.c app/fileops.c app/gdisplay.c
1999-11-23  Michael Natterer  <mitch@gimp.org>

	* app/app_procs.c
	* app/channels_dialog.c
	* app/fileops.c
	* app/gdisplay.c
	* app/gdisplay_ops.c
	* app/layers_dialog.c
	* app/menus.[ch]
	* app/paths_dialog.c
	* app/plug_in.c: removed
	menus_set_[sensitive|state]_glue(). Removed the N_()'s from all
	menu paths which are not eventually passed to
	gtk_item_factory_create_item().

	* app/tool_options.c: minor updates.

	* app/file_new_dialog.c: reordered the action_area buttons.
1999-11-23 19:11:29 +00:00
GMT 1999 Andy Thomas
70b0232405 app/bezier_select.c
Mon Nov 22 22:43:59 GMT 1999 Andy Thomas <alt@gimp.org>

        * app/bezier_select.c

        Stroking bezier paths made up of multiple segments
        now all get put in a single undo group.
1999-11-22 23:05:31 +00:00
Sven Neumann
399e35b6c4 i18n stuff
--Sven
1999-11-22 22:38:02 +00:00
Michael Natterer
3711f5587e app/brightness_contrast.[ch] app/by_color_select.[ch]
1999-11-22  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/brightness_contrast.[ch]
	* app/by_color_select.[ch]
	* app/color_balance.[ch]
	* app/curves.[ch]
	* app/histogram_tool.[ch]
	* app/hue_saturation.[ch]
	* app/levels.[ch]
	* app/posterize.[ch]
	* app/threshold.[ch]: spinbuttons and cleaned up ui for all
	dialog-tools. Added a "Reset" button to all dialogs.

	* app/color_notebook.c: fixed a compiler warning.

	* app/gimpui.[ch]: made gimp_radio_group_new() more general.

	* app/menus.c: removed the <Toolbox>/File/Help submenu.

	* app/tools.c: restored the old behaviour of "tools_initialize()"
	(force the emission of the "tool_changed" signal)
1999-11-22 11:14:29 +00:00
Michael Natterer
e5aad8b85b s/sprintf/g_snprintf
1999-11-20  Michael Natterer  <mitch@gimp.org>

	* app/devices.c: s/sprintf/g_snprintf

	* app/color_balance.[ch]: spinbuttons instead of text entries.
1999-11-20 18:08:41 +00:00
Michael Natterer
e46eaf8687 Reorganized the core menu items (everything except <Image>/Filters).
1999-11-20  Michael Natterer  <mitch@gimp.org>

	Reorganized the core menu items (everything except
	<Image>/Filters). Everything is of course trivial to change again,
	so please comment on the new "menu feeling" ;-)

	* app/menus.[ch]:

	- Applied the suggestions collected by Olof.
	- Added "..." to all items which open a dialog.
	- Introduced some additional separators (e.g. in "Dialogs").
	- Reorder some plugins and the color correct tools after
	  initialisation.
	- A menu entry to invoke the tooltips inspector.
	- A debugging menu entry which dumps the menu paths and their help
	  pages (will of course go away when the help sys is consistent).

	There are currently two identical "Help" menus because
	<Toolbox>/Help trashes the menu bar if the toolbox is too narrow
	(gtk doesn't seem to support multi-line menubars, any idea?)

	* app/app_procs.c: call menus_reorder_plugins() after loading the
	plugins to beautify the "Xtns" menu.

	* app/commands.[ch]: reordered some functions to match the new
	menu structure (for easier source navigation) and renamed some to
	be consistent (e.g. all help functions are now called help_*).

	Show/Hide the rulers with ordinary gtk_widget_[show|hide]()
	commands. I've tested it several times and it looks exactly the
	same as the old code which used internal gtk knowledge.

	* app/gdisplay.c: applied the menu changes to
	gdisplay_set_menu_sensitivity().

	* app/gimphelp.[ch]: new public function gimp_context_help() which
	invokes the tooltips inspector. Code cleanup.

	* app/resize.c: changed the dialogs' titles to match the menu entries.

	* app/session.c: renamed the gradient selection cmd callback to be
	consistent with brushes/patterns.

	* app/tools.c: added "..." to the menu paths of the tools which
	have dialogs.

	* app/fileops.c
	* app/channels_dialog.c
	* app/layers_dialog.c
	* app/paths_dialog.c: added some "...".

	* plug-ins/common/align_layers.c
	* plug-ins/common/autostretch_hsv.c
	* plug-ins/common/c_astretch.c
	* plug-ins/common/color_enhance.c
	* plug-ins/common/compose.c
	* plug-ins/common/decompose.c
	* plug-ins/common/mail.c
	* plug-ins/common/normalize.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/dbbrowser/dbbrowser.c
	* plug-ins/fp/fp.c
	* plug-ins/print/print.c
	* plug-ins/rcm/rcm.c: changed the menu paths and added "...".
1999-11-20 12:12:41 +00:00
Sven Neumann
80a0b2dd53 convolve.c dodgeburn.c pressing Shift now disables (and resets) the tool
* convolve.c
        * dodgeburn.c
        * eraser.c: pressing Shift now disables (and resets) the tool toggle
        and switches to line mode so the Ctrl key is free for constraints.

--Sven
1999-11-20 00:30:41 +00:00
Sven Neumann
ef362f4683 Read the mail!
--Sven
1999-11-18 17:56:01 +00:00
Sven Neumann
adda5e17bb more i18n
--Sven
1999-11-17 14:39:11 +00:00
CET 1999 Olof S Kylander
f2ad0eb2a7 app/xinput_airbrush.c
Mon Nov 15 11:30:42 CET 1999 Olof S Kylander <olof@gimp.org>

        * app/xinput_airbrush.c

        A bit better std values for people w/o patch_xinput_airbrush
1999-11-15 10:26:00 +00:00
Sven Neumann
dc3d7403be plugged a memleak
* app/ink.c: plugged a memleak

        * app/xinput_airbrush.c; make it compile w/o patch_xinput_airbrush

--Sven
1999-11-14 22:50:08 +00:00
CET 1999 Olof S Kylander
df8598df2f Update of the Xinput airbrush, fixed some bugs. It's a bit closer to a
Sun Nov 14 21:37:51 CET 1999 Olof S Kylander <olof@gimp.org>

        Update of the Xinput airbrush, fixed some bugs.
        It's a bit closer to a real tool now ;-).
1999-11-14 20:49:14 +00:00
Michael Natterer
0c922cd3b0 app/airbrush.c app/apptypes.h app/brushes_cmds.c
1999-11-14  Michael Natterer  <mitch@gimp.org>

	* app/airbrush.c
	* app/apptypes.h
	* app/brushes_cmds.c
	* tools/pdbgen/pdb/brushes.pdb
	* app/bucket_fill.c
	* app/clone.c
	* app/gimpbrushpipe.c
	* app/paint_core.c
	* app/patterns.h
	* app/patterns_cmds.c
	* tools/pdbgen/pdb/patterns.pdb: removed the GimpBrushP and
	GPatternP types and use ordinary pointers instead.

	The following stuff makes the "no_data" behaviour consistent. As a
	side-effect it should make the gimp work when there are _really_ no
	brushes/patterns/gradients.

	* app/brush_select.c
	* app/pattern_select.c: set the initial brush/pattern name to "No
	Brushes/Patterns available" instead of "Active".

	* app/devices.c: set the device contexts' brush/pattern/gradient
	names if we started with no_data, so we find them on refresh.

	* app/gimpbrushlist.c: set the name of the standard_brush to
	"Standard".

	* app/gimpcontext.c: don't replace the current
	brush/pattern/gradient's name if the new one to be set is the
	standard one. Together with the change in devices.c, this ensures
	that we get what is set in devicerc. Minor fixes.

	* app/gradient.c: changed gradients_init() to work like the other
	data init functions. Only insert a default gradient in the
	gradients list when the editor is opened (this means that the
	gradients now behave like brushes/patterns when we start with
	"no_data").
	New function gradient_update() avoids tons of useless redraws of
	all clist gradient previews whenever the gradient editor wants to
	update it's large preview.

	* app/gradient_select.c: don't segfault when the user tries to
	drag from an empty gradient list.

	* app/patterns.c: set the index of the standard_pattern to -1 to
	indicate that it's not part of the pattern list.
1999-11-14 10:50:19 +00:00
Sven Neumann
d70a75c486 app/airbrush.c app/convolve.c app/dodgeburn.c app/paint_options.h
* app/airbrush.c
        * app/convolve.c
        * app/dodgeburn.c
        * app/paint_options.h
        * app/paintbrush.c
        * app/pencil.c
        * app/smudge.c
        * app/tool_options.c: cleaned up pressure sensitivity for paint
        tools. I had to rename Pressure to Rate in a few tools to avoid
        confusion with the Pressure option that applies to the brush.

        * app/gimplut.c: indentation, no changes

--Sven
1999-11-13 01:02:27 +00:00
Sven Neumann
558271ff3b when moving layers/masks freeze the undo after the first move to avoid
* app/edit_selection.c: when moving layers/masks freeze the undo
        after the first move to avoid that each and every small movements
        puts an undo on the stack. Significantly speeds up layer moves
        and especially the undo of a layer move.

        * app/gdisplay.h: correct rounding errors

        * app/gimpimage.c: correctly display floating selections in the
        composite_preview instead of ignoring them

        * app/channels_dialog.c
        * app/layers_dialog.c
        * app/lc_dialog.c: s/gtk_widget_draw/gtk_widget_queue_draw/

--Sven
1999-11-05 14:39:04 +00:00
Sven Neumann
8498428592 get rid of compiler warnings
* app/channel.c: get rid of compiler warnings

        * app/histogram_tool.c
        * app/histogram_tool.h: added a gradient below the histogram so
        it looks more like the curves and levels tool

        * app/gimpbrushpipe.c
        * libgimp/parasiteio.c
        * libgimp/parasiteio.h: plugged another mem-leaks. At least
        The GIMP now starts without leaking memory...

--Sven
1999-11-04 19:50:14 +00:00
GMT 1999 Austin Donnelly
f0fdd64fd3 tag text undo group with TEXT_UNDO rather than silly EDIT_PASTE_UNDO.
Wed Nov  3 22:36:21 GMT 1999 Austin Donnelly  <austin@gimp.org>

	* app/text_tool.c: tag text undo group with TEXT_UNDO rather than
	    silly EDIT_PASTE_UNDO.
	* app/undo.c: TEXT_UNDO name
	* undo_types.h: new type: TEXT_UNDO, plus fix numbering to make it
	    consistent (overlapping enums are bad).
1999-11-03 22:34:32 +00:00
Michael Natterer
0302ed0a10 app/brush_select.[ch] app/gradient.c app/gradient_select.[ch]
1999-11-03  Michael Natterer  <mitch@gimp.org>

	* app/brush_select.[ch]
	* app/gradient.c
	* app/gradient_select.[ch]
	* app/interface.[ch]
	* app/palette.c
	* app/pattern_select.[ch]: allow dragging a brush/pattern/... from
	the selections with mouse2 without changing the active element in
	the dialog.

	* app/channels_dialog.c
	* app/color_area.c
	* app/color_panel.c
	* app/color_select.c
	* app/colormap_dialog.i.c
	* app/devices.c
	* app/gimpcontextpreview.[ch]
	* app/gimphelp.[ch]
	* app/gimpui.[ch]
	* app/indicator_area.c
	* app/interface.[ch]
	* app/layers_dialog.c
	* app/lc_dialog.c
	* app/ops_buttons.[ch]
	* app/paths_dialog.c
	* app/preferences_dialog.c
	* app/tools.[ch]: wrapped gtk_tooltips_set_tip() with
	gimp_help_set_help_data() and moved it to gimphelp.[ch].

	This should (hopefully) be the final state of the help system. The
	New function allows a "private tip" to be set without a visible
	tooltip. This way the tooltips inspector (shift+F1) can search for
	help data in the parent containers of the clicked widget. E.g. the
	ops buttons in the layers dialog have private tips like
	"#new_layer" which gets composed with the help data of the layers
	dialog notebook page resulting in a complete help path.

	Allow mouse2 for all dnd operations. Mouse1 still works like before.
1999-11-03 09:58:46 +00:00
Michael Natterer
b3144e7ccc app_procs.c app/commands.[ch] app/interface.c app/menus.c app/session.c
1999-10-30  Michael Natterer  <mitch@gimp.org>

	* app_procs.c
	* app/commands.[ch]
	* app/interface.c
	* app/menus.c
	* app/session.c
	* app/tools.[ch]: namespace cleanups: changed the
	"tools_options_*" functions to "tool_options_*" and prefixed all
	dialog menu callbacks with "dialogs_*".
	Allow dropping a tool to the tool options dialog.

	* app/bezier_select.c: change the active tool using context
	functions.

	* app/dialog_handler.[ch]: replaced the uppercase datatype names
	by standard mixed upper/lowercase ones. Provide a function to
	register the fileload dialog instead of accessing it as global
	variable.

	* app/disp_callbacks.c: switch to the move tool using context
	functions. Fixed the drop color/pattern functions to convert the
	dropped thing to the dest. image's color space.

	* app/fileops.c: don't export the fileload dialog as global
	variable but register it with the dialog handler instead.

	* app/paths_dialog.[ch]: replaced all the uppercase struct names
	defined here by mixed upper/lowercase. Introduced a
	"set_menu_sensitivity" function like in layers/channels instead of
	calling single button on/off functions from various places.
	Added a menu entry for "Selection to Path".
1999-10-30 10:39:48 +00:00
Michael Natterer
79e27e984a More context & dnd stuff... 1999-10-28 15:05:49 +00:00
Sven Neumann
5749bc2143 remember the drawable we were working on instead of relying to
* app/transform_core.c: remember the drawable we were working on
    instead of relying to gimp_active_drawable ().
    This should fix bug #2381.

--Sven
1999-10-27 22:59:29 +00:00
Michael Natterer
a74d52fbbf Use the context almost everywhere. 1999-10-26 18:27:27 +00:00
BST 1999 Andy Thomas
85bbd68cf9 app/text_tool.c
Fri Oct 22 20:39:13 BST 1999 Andy Thomas <alt@gimp.org>

	* app/text_tool.c

	Fixed the problem where the border values was been ignored.
1999-10-22 19:45:05 +00:00
Michael Natterer
b74d256981 changed the "parent context" implementation:
1999-10-19  Michael Natterer  <mitch@gimp.org>

	* gimpcontext.[ch]: changed the "parent context" implementation:

	- Automatically connect/disconnect the "*_changed" signals when
	  changing the parent and when setting the "defined" flag of the
	  attributes.
	- Store the former *_defined booleans in a single guint32.
	- Added generic functions to set the "defined" flags of the
	  attributes and to copy attributes between contexts.

	The contexts now correctly handle disappearing images and
	displays, so we don't have to explicitly reset them any more.

	* context_manager.[ch]: adopted to the changed context
	implementation, connect to the user context's "tool_changed"
	signal to switch the per-tool contexts, don't connect to the
	"removed" signal of the image context.

	* brush_select.c
	* tool_options.c: use LayerModeEffects instead of int when calling
	gimp_context_set_paint_mode().

	* gdisplay.c: no need to reset the active display when deleting it
	because the context connects to the "destroy" signal of the shell
	now.

	* menus.c: a shortcut for the navigation window. Moved
	<Image>/Image/Colors/Desaturate before the separator.

	* tools.c: tools_select(): set the active tool of the user context
	instead of calling a special context manager function.
1999-10-19 15:52:32 +00:00
BST 1999 Andy Thomas
6e28558948 app/bezier_select.c app/edit_selection.c app/flip_tool.c app/gimage_mask.c
Mon Oct 18 21:24:47 BST 1999 Andy Thomas <alt@gimp.org>

	* app/bezier_select.c
	* app/edit_selection.c
	* app/flip_tool.c
	* app/gimage_mask.c
	* app/paths_dialog.c
	* app/paths_dialogP.h
	* app/undo.c
	* app/tools.h
	* app/tools.c

	1) Fixed some problems with the paths tool. Now the tool suboption
	"new point" is selected automatically when appropriate. Eg if you
	have the "add point" suboption selected and click  on a point
	not on the curve the "new point" option will become selected and the
	new point will be added.

	2) The "new point" option is defaulted to on when a new image is created	or a new image is selected from the image menu.

	3) Move and flip tool now effect the path if it is locked.

	4) Edit stroke now uses the currently selected tool as it should do
	when stroking.
1999-10-18 20:55:25 +00:00
BST 1999 Austin Donnelly
cf6260af60 long overdue fix for problem with overrunning buffers in a couple of
Sun Oct 17 21:28:58 BST 1999  Austin Donnelly  <austin@gimp.org>

	* app/iscissors.c: long overdue fix for problem with overrunning
	    buffers in a couple of places.  Should now work with image
	    that are not an exact multiple of the tile size, and cope with
	    moving and adding control point before the curve is closed.
	    This may well fix a number of the bugs people have reported
	    on iscissors.  As of now, I know of no bugs in iscissors - if
	    you find one, I'm interested.
1999-10-17 20:28:56 +00:00
Marc Lehmann
ec40ac728b API PATCH #2 or so 1999-10-17 00:07:55 +00:00
Sven Neumann
fce4ad6327 a whole lotta guide fixes
--Sven
1999-10-13 23:07:45 +00:00
BST 1999 Andy Thomas
08529ff5e7 app/crop.c app/sca_convert.c
Wed Oct 13 21:37:51 BST 1999 Andy Thomas <alt@gimp.org>

	* app/crop.c
	* app/sca_convert.c

	Fixes to memory problems (use of freed memory references) found
	by running with dmalloc.

	* app/paths_dialog.c

	Locking of multiple paths are now displayed correctly in the
	transform tool.
1999-10-13 20:53:30 +00:00
Sven Neumann
fc4e6346df dnd improvements
--Sven
1999-10-09 20:33:53 +00:00
Sven Neumann
38a67ce230 a patch to the path tool from Simon Budig
and some cleanup in plug-ins/common/vpropagate.c


--Sven
1999-10-08 10:22:39 +00:00
Simon Budig
c8578fc4b4 app/path_tool.h app/path_tool.c app/path_toolP.h app/path_curves.h
1999-10-3  Simon Budig  <Simon.Budig@unix-ag.org>

        * app/path_tool.h
        * app/path_tool.c
        * app/path_toolP.h
        * app/path_curves.h
        * app/path_curves.c
        * app/path_bezier.h
        * app/path_bezer.c

        Minor cleanup in the Api (adding init/cleanup functions for the
        curve-type-specific data, extending the on_handler function to
        return a handler ID, so the tool-core can tell path_curve_drag_handle
        which handle gets dragged around)

        Indentation madness - This must be some kind of infective: Too long
        together with Sven and Mitch :-)
1999-10-06 23:24:22 +00:00
EDT 1999 Austin Donnelly
a273905c75 all-singing, all-dancing iscissors. Now scan converts so you can actually
Tue Oct  5 14:02:07 EDT 1999  Austin Donnelly  <austin@gimp.org>

	* app/iscissors.c: all-singing, all-dancing iscissors.  Now
	    scan converts so you can actually select stuff.  Doesn't leak
	    tiles either.  Still have a problem with occasional segfault
	    and CRITICAL assertion failing on addition of anchor when
	    curve not closed.
	* app/scan_convert.c: add connecting list between blocks of points
	    so we actually have a closed polygon.
	* app/tool_options.c: iscissors has just the standard feather and
	    antialias options now.
1999-10-05 18:05:34 +00:00
Manish Singh
a3ef836860 libgimp/color_display.h add bpl param for convert func
* libgimp/color_display.h
* app/gdisplay.c: add bpl param for convert func

* gdisplay_color.c: guard against head and tail cases in reorders

* app/gdisplay_color_ui.c: expose_full on all actions, so there is
immediate feedback. Check for no selection and do nothing on actions

* app/path_tool.c: #warning is not portable; change to /* XXX: */

* modules/cdisplay_gamma.c: make it so it actually works properly

-Yosh
1999-10-05 02:16:59 +00:00
EDT 1999 Austin Donnelly
48c54f0f5a NEW FILES: app/scan_convert.c common code from free_select.c and
Mon Oct  4 01:46:46 EDT 1999  Austin Donnelly  <austin@gimp.org>

	NEW FILES:
	* app/scan_convert.c
	* app/scan_convert.h: common code from free_select.c and
	    bezier_select.c

	MODIFIED FILES:
	* app/disp_callbacks.c: Fix for bug #2517 - dragging colour swatch
	    to image with no layers causes segfault.  Something is
	    repainting empty images as white rather than chequerboard as
	    well, which still needs fixing.

	* app/free_select.c: move code out to scan_convert.c
	* app/free_select.h: use ScanConvertPoint not FreeSelectPoint
	* tools/pdbgen/pdb/tools.pdb: ScanConvertPoint again
	* app/tools_cmds.c: generated version of above.
1999-10-04 05:51:40 +00:00
Sven Neumann
09cab0b18b This was an easy one.
--Sven
1999-10-04 02:00:33 +00:00
Sven Neumann
cdc3f6e779 more export stuff
--Sven
1999-10-03 23:48:33 +00:00
Olof S Kylander
29d5575655 app/airbrush_blob.c * app/xinput_airbrush.c A bit better airbrush. It is
1999-10-03 Olof S Kylander <olof@frozenriver.com>
        * app/airbrush_blob.c         * app/xinput_airbrush.c
        A bit better airbrush. It is still ugly but it now
        looks like airbrush. This is a tool for Wacom
        tables it is no use to use it with a mouse.
1999-10-03 21:21:01 +00:00
Sven Neumann
2212b94fff Some updates for the Path-Tool.
Bye,
        Simon  (using Svens account)
1999-10-03 19:13:54 +00:00
Tor Lillqvist
d28bd8b689 Change the GDK_WINDOWING_* stuff to be buildable with current CVS gtk+
1999-10-03  Tor Lillqvist  <tml@iki.fi>

* app/cursorutil.h app/session.c app/text_tool.c: Change the
GDK_WINDOWING_* stuff to be buildable with current CVS gtk+ (not
recommended for X11, but necessary for Win32).

* libgimp/gimp.c: Undef RGB from <windows.h> on Win32.

* app/makefile.{cygwin,msc} libgimp/makefile.{cygwin,msc} *
plug-ins/makefile.{cygwin,msc}: Add new files. Small changes for
current gtk+.

* plug-ins/common/animationplay.c: Win32 kludges.
1999-10-03 00:43:05 +00:00
Austin Donnelly
11409e97fb comment typo fix, plus add %D* to default image-title-format string, so
Fri Oct  1 12:46:12 1999  Austin Donnelly  <austin@gimp.org>

	* gimprc.in: comment typo fix, plus add %D* to default
	    image-title-format string, so people get a '*' in the titlebar
	    if their image is dirty.
	* app/fileops.c: initialise filename before using it.
	* app/gdisplay.c: empty parameter list () is K&R - should be
	    stronger (void) in ANSI C.
	* app/gimpdrawable.c: gimp_drawable_{dirty,clean} functions
	    removed - no one uses them anyway.  Parasite undo type is
	    proper parasite undo type, not MISC_UNDO.
	* app/gimpdrawableP.h: drawable dirty bit removed.
	* app/gimpimage.c: don't change the resolution if there's no
	    difference from the old one.  Call gdisplay_shrink_wrap() to
	    re-calculate scale factors and refresh the display on
	    resolution change.  Layer undo doesn't have sub-types
	    anymore, uses main UndoType instead.
	* app/layer.h: Remove LayerUndoType
	* app/qmask.c: fix qmask undo so it actually works.
	* app/undo.h: new types for undo_push_layer{,_mask} and
	    undo_push_qmask.
	* app/undo.c: change way group boundaries are represented:
	    each Undo has a group_boundary boolean set to TRUE if this is
	    the start or the end of a group, and the type of the Undo is
	    the group's type.  Within a group, each Undo keeps its own
	    type.  This allows pop funcs and free funcs to do
	    type-specific things (eg needed by layer and channel stuff).
	    Don't maintain per-drawable dirty flags anymore.   Floating
	    sel to layer and layer rename now uses meaningful undo types.
	* app/undo_types.h: more specific undo types:
	    LAYER_{ADD,REMOVE}_UNDO, LAYER_MASK_{ADD,REMOVE}_UNDO,
	    LAYER_RENAME_UNDO, and PARASITE_{ATTACH,DETACH}_UNDO.
	* app/undo_history.c: oops - undo stack was being placed into gtk
	    list in wrong order.
	* app/edit_selection.c: push more descriptive LAYER_DISPLACE_UNDO
	    rather than MISC_UNDO.
	* app/layers_dialog.c: better tagging of undo types
1999-10-01 18:43:24 +00:00
BST 1999 Andy Thomas
ff8579eae4 app/paintbrush.c
Thu Sep 30 23:06:47 BST 1999 Andy Thomas <alt@gimp.org>

	* app/paintbrush.c

	Fixed problem with stroking with the paintbrush tool.
	Stroking paths with fade/gradients now works again.
1999-09-30 22:12:58 +00:00
Michael Natterer
002aa905db app/Makefile.am app/gimphelp.[ch] new files
1999-09-27  Michael Natterer  <mitch@gimp.org>

	* app/Makefile.am
	* app/gimphelp.[ch]
	* app/gimpui.[ch]: new files

	* app/interface.[ch]
	* app/preferences_dialog.[ch]

	The GIMP Help System part 1: Press "F1" in any dialog to pop up
	the help page for this dialog.

	Moved the widget constructors from preferences_dialog.[ch] and the
	query boxes from interface.[ch] to gimpui.[ch].

	The dialog constructors take a help_func and a help_data
	parameter and install the "F1" accelerator which emits the new
	"help" signal.

	The "help" signal callback calls help_func(help_data) which finally
	has to call gimp_help() which in turn invokes the help browser.

	Still have to find a proper way to (1) prevent "F1" being assigned
	to some menu item and (2) to catch "F1" while browsing the menu
	trees in order to pop up the help for the selected item.

	* app/menus.c: a <Toolbox>/File/Help... menu item.
	* app/commands.[ch]: a command callback for the "Help..." menu item.

	* app/gimprc.[ch]: new boolean gimprc variable "use_help".

	* app/info_dialog.[ch]: pass a help function and data to the info
	dialog constructor.

	* app/tools.[ch]: store the tools help page names in the tool info
	structure. Export a special tools_help_func() which shows the help
	page for the active tool.

	* app/[all files calling a dialog constructor]: pass the dialog's
	help page to the constructor.

	Most dialogs are now created by gimp_dialog_new() which also sets
	up the action_area and the WM delete event callback, so I removed
	the resp. code from these files.

	Fixed some minor bugs and did some other stuff but didn't change
	any logic except dialog creation.

	* plug-ins/helpbrowser/helpbrowser.c: don't try to call a running
	help browser and don't install any menu path (all done in
	app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
Sven Neumann
cd45f5d062 applied patches
--Sven
1999-09-26 04:53:59 +00:00
Sven Neumann
ae743e3f17 Cleanups...
Shame on the one who decided it would be good idea to load pixmap brushes
as pipes, it destroys the whole purpose of the GIMP_IS_BRUSH_PIPE macro!!


--Sven & Jtl
1999-09-26 03:39:59 +00:00
Sven Neumann
933a5abd54 bug-fixing....
--Sven
1999-09-25 21:45:26 +00:00
Sven Neumann
31331996fa fun with gradient_length and fade_out
--Sven & Jtl
1999-09-25 19:49:58 +00:00
Manish Singh
d02f3bce77 moved the gtk_set_locale call to after it's been inited
* app/main.c: moved the gtk_set_locale call to after it's
been inited

* app/paint_core.h: set skip for ToolFlags

* app/procedural_db.h: don't skip PDB_TEMPORARY in PDBProcType

* libgimp/Makefile.am: don't install stdplugins-intl.h, that's
only for disted plugins

* libgimp/gimpenums.h: is now autogenned

* libgimp/gimpfeatures.h.in: #define for new enums

* libgimp/gimpintl.h: #include <locale.h>

* libgimp/stdplugins-intl.h: add include guards

* plug-ins/AlienMap2/Makefile.am: add INTLLIBS

* plug-ins/gflare/Makefile.am: removed unused libgimpui

* plug-ins/script-fu/script-fu-console.c
* plug-ins/script-fu/script-fu-scripts.c
* plug-ins/script-fu/script-fu-server.c: use stdplugins-intl.h

* plug-ins/sel2path/Makefile.am: removed unused libgck.la

* tools/pdbgen/Makefile.am: removed script-fu.pl, added enumcode.pl

* tools/pdbgen/lib.pl
* tools/pdbgen/enumcode.pl: enumcode.pl now autogenned gimpenums.h
as well as the script-fu stuff

-Yosh
1999-09-25 01:59:43 +00:00
Sven Neumann
5f6d9e9ac5 reenabled the line preview for the eraser tool
--Sven
1999-09-24 23:23:23 +00:00
Sven Neumann
ba211f07f2 i18n patch from Daniel Egger
--Sven
1999-09-23 11:49:16 +00:00
Sven Neumann
8c404ed3e6 do the box thing!
--Sven
1999-09-21 09:11:42 +00:00
Sven Neumann
9ee9939102 made the creation of guides undoable
--Sven
1999-09-20 21:08:53 +00:00
Manish Singh
fa39134a36 use a temp var for xoring pointers
-Yosh
1999-09-15 18:12:14 +00:00
Sven Neumann
e56ff58b04 applied a patch from Simon.
--Sven
1999-09-15 10:54:25 +00:00
Tor Lillqvist
e422b59e59 Include config.h, guard inclusion of <unistd.h>.
1999-09-14  Tor Lillqvist  <tml@iki.fi>

* app/brush_select.c: Include config.h, guard inclusion of
<unistd.h>.

* app/gimpcontextpreview.c: Include config.h, <string.h> and
appenv.h.

* app/xinput_airbrush.c: Include config.h, <stdio.h>, appenv.h and
libgimp/gimpmath.h. Use G_PI.

* app/makefile.{cygwin,msc}: Updates.

* plug-ins/makefile.{cygwin,msc}: Add the unofficial sel_gauss
plug-in. Add new object files for FractalExplorer and
gimpressionist.

* plug-ins/common/iwarp.c (iwarp_deform): Combine two loops over
the same xi, yi area into one. Remove the then actually unused
deform_area_vectors array. Only one element of the array was used
for each x,yi loop.

* plug-ins/common/sparkle.c: Don't include <math.h>,
libgimp/gimpmath.h includes it. Use G_PI.
1999-09-14 21:20:04 +00:00
EDT 1999 Adrian Likins
2ed3a56155 Make gradient brushes work again.
Fri Sep 10 00:18:17 EDT 1999 Adrian Likins <adrian@gimp.org>

        * app/paintbrush.c:  Make gradient brushes work again.
1999-09-10 04:21:00 +00:00
Sven Neumann
831b75e301 Correct scaling of brush pipes and pixmap brushes.
--Sven
1999-09-09 19:11:38 +00:00
Sven Neumann
d21d00be23 Yet another new tool...
--Sven
1999-09-09 17:21:06 +00:00
Sven Neumann
181c66985a Sorry for breaking the freeze, but I had these almost ready for weeks now...
--Sven
1999-09-09 01:47:54 +00:00
Olof S Kylander/GIMP
44d41b19b5 Okay I have committed the ugly airbrush now 1999-09-07 01:33:44 +00:00
Olof S Kylander/GIMP
f58c6dcc55 Okay I have committed the ugly airbrush now. 1999-09-07 01:24:50 +00:00
Sven Neumann
846d480ca3 igittigittigitt
--Sven
1999-09-07 00:14:49 +00:00
Olof S Kylander/GIMP
7110c063e1 Fixed a cut&paste error it the radius check code
Fixed a cut&paste error it the radius check code
1999-09-06 01:15:44 +00:00
Olof S Kylander/GIMP
f09e4fa19d Fix of very stupid mis of ending */
Fix of very stupid mis of ending */
1999-09-04 18:37:42 +00:00
Olof S Kylander/GIMP
ce5ae4edf2 fix of ifdef in paint_core.c
fix of ifdef in paint_core.c
1999-09-04 17:56:22 +00:00
Olof S Kylander/GIMP
0f1da4281d Added support for Gtk+ xinput-wheel if we have applied the patch enabling
Added support for Gtk+ xinput-wheel if we have applied the patch enabling it
in Gtk+.
1999-09-04 14:42:43 +00:00
BST 1999 Andy Thomas
eff3e1b8ce app/curves.c app/curves.h
Fri Sep  3 22:52:26 BST 1999 Andy Thomas <alt@gimp.org>

	* app/curves.c
	* app/curves.h

	Added indicators (x,y of mouse & x for the line) to the curves
	dialog.
1999-09-03 21:58:41 +00:00
Manish Singh
52b5222052 app/gtkhwrapbox.[ch] sync from gle
* app/gtkhwrapbox.[ch]
* app/gtkwrapbox.[ch]: sync from gle

* app/inteface.c: set allow_shrink on the toolbox window, use
gtk_hwrap_box_new

* app/blend.c: use shift to constrain to 45 deg: XachCode (tm)

-Yosh
1999-09-02 18:56:39 +00:00
jaycox
2b5130f08a free the brush dialog before freeing the brushes.
* app/app_procs.c: free the brush dialog before freeing the brushes.

	* app/blend.c, app/bucket_fill.c: don't include brush_select.h

	* app/brush_select.[ch]: add the ability to delete generated brushes.

	* app/gimpbrushgenerated.c: save the brush parameters on seperate lines.

	* app/gimpbrushlist.c: make sure we don't overwrite other brush
	files when saving newly created brushes.
1999-09-02 09:20:48 +00:00
Manish Singh
9fb081a7e6 add gimpmath.h
* libgimp/Makefile.am: add gimpmath.h

* app/gtkwrapbox.[ch]
* app/gtkhwrapbox.[ch]: wrapbox widget from gle

* app/Makefile.am: added those files

* app/interface.c: use an hwrapbox for the toolbar. Still not perfect
yet, working on it.

* app/gimpdrawable.c
* app/about_dialog.c
* app/airbrush.c
* app/blend.c: some minor code cleanup

-Yosh
1999-09-02 01:41:18 +00:00
Tor Lillqvist
388199215e Make also the non-gui paintbrush (called when stroking a path) handle
1999-09-02  Tor Lillqvist  <tml@iki.fi>

* app/paintbrush.c (paintbrush_non_gui_default,
paintbrush_non_gui): Make also the non-gui paintbrush (called when
stroking a path) handle changing brushes, i.e. pixmap brush pipes.
1999-09-02 00:17:25 +00:00
BST 1999 Adam D. Moss
f4f0932dfd app/gradient.c app/color_transfer.c app/free_select.c app/lut_funcs.c
Wed Sep  1 22:28:09 BST 1999 Adam D. Moss <adam@gimp.org>

	* app/gradient.c
	* app/color_transfer.c
	* app/free_select.c
	* app/lut_funcs.c
	* app/blob.c: s/#include <math.h>/#include "libgimp/gimpmath.h"/
1999-09-01 21:31:55 +00:00
Tor Lillqvist
6ef23d984f app/appenv.h New file. Includes <math.h>. Move G_PI, RINT(), ROUND() etc
1999-09-01  Tor Lillqvist  <tml@iki.fi>

* app/appenv.h
* libgimp/gimpmath.h: New file. Includes <math.h>. Move G_PI,
RINT(), ROUND() etc from app/appenv.h here, so plug-ins can
use them, too. Remove some commented-out old stuff in appenv.h.

* libgimp/gimp.h: Include gimpmath.h.

* libgimp/gimp.c (gimp_main): Win32: Don't install signal
handlers, we can't do anything useful in the handler ourselves
anyway (it would be nice to print out a backtrace, but that seems
pretty hard to do, even if not impossible). Let Windows inform the
user about the crash. If the plug-in was compiled with MSVC, and
the user also has it, she is offered a chance to start the
debugger automatically anyway.

* app/*several*.c: Include gimpmath.h for G_PI etc. Don't include
<math.h>, as gimpmath.h includes it.

* plug-ins/*/*many*.c: Include config.h. Don't include <math.h>.
Remove all the duplicated definitions of G_PI and rint(). Use
RINT() instead of rint().

* app/app_procs.[ch]: app_exit() takes a gboolean.

* app/batch.c
* app/commands.c
* app/interface.c: Call app_exit() with FALSE or TRUE.

* app/main.c (on_error): Call gimp_fatal_error. (main): Don't
install any signal handler on Win32 here, either.

* app/errors.c (gimp_fatal_error, gimp_terminate): Win32: Format
the message and call MessageBox with it.  g_on_error_query doesn't
do anything useful on Win32, and printf'ing a message to stdout or
stderr doesn't do anything, either, in a windowing application.
1999-09-01 20:30:56 +00:00
Sven Neumann
28449546ae finally found that bug that annoyed me to death at the camp
--Sven
1999-09-01 20:16:18 +00:00
Sven Neumann
1cf2e5c12b tools/pdbgen/pdb/fileops.pdb applied the patch from Wolfgang Hofer that
* tools/pdbgen/pdb/fileops.pdb
        * app/fileops_cmds.c: applied the patch from Wolfgang Hofer that
        should fix the problems saving jpeg with GAP.

        * app/paint_core.[ch]: preview length of brush-stroke in statusbar
        when drawing a line using <Shift>. Do we need the angle here too??


--Sven
1999-09-01 18:46:25 +00:00
EDT 1999 Adrian Likins
5e64804c4b app/gimpbrushpip.[ch] app/airbrush.c app/pencil.c fix pencil tool for use
Wed Sep  1 00:56:37 EDT 1999 Adrian Likins <adrian@gimp.org>

        * app/gimpbrushpip.[ch]
        * app/airbrush.c
        * app/pencil.c
        * app/paintbrush.c: fix pencil tool for use with
           pixmaps again
1999-09-01 06:02:08 +00:00
EDT 1999 Adrian Likins
99f35577ea add a "Use Pressure" check button to the options so that pressure
Tue Aug 31 01:13:13 EDT 1999 Adrian Likins <alikins@redhat.com>

        * app/pencil.c: add a "Use Pressure" check button to the options
        so that pressure sensitivy can be disabled. Suggested by
        Tuomas Kuosmanen  <tigert@gimp.org>.
1999-08-31 06:13:30 +00:00
Tor Lillqvist
26b70edddf Add a new method, gboolean want_null_motion(), that tells if the brush
1999-08-30  Tor Lillqvist  <tml@iki.fi>

* app/gimpbrush.h (GimpBrushClass): Add a new method, gboolean
want_null_motion(), that tells if the brush wants to be painted
when we don't know the direction yet. This is needed (so far) by
brush pipes that select the brush based on direction.

* app/gimpbrush.c: Implement above method returning always TRUE.

* app/gimpbrushpipe.c: Here, implement it returning FALSE or TRUE
on whether the brush pipe has any angular (direction) dependent
dimension or not.

* app/paint_core.c (paint_core_button_press): Call the method
if current point == last point.
1999-08-30 21:24:13 +00:00
Manish Singh
b3fdade3a4 added a header to the file format
-Yosh
1999-08-27 22:02:18 +00:00
Manish Singh
4a9ae94655 user_install added gimpressionist, levels, and curves dirs
* user_install
* user_install.bat: added gimpressionist, levels, and curves dirs

* app/color_panel.c
* app/color_select.c
* app/colormaps.[ch]
* app/palette.c
* app/selection.c: remove vestigal colormap code; use get_color
directly now

* libgimp/color_display.h
* app/gdisplay_color.c: bugfixes, added state load/save hooks,
redid the interface to work on blocks, removed dummy default
handler, work on gamma correction stuff

* app/gimpbrushpipe.c: #include <stdlib.h>

* app/gximage.c: minor cleanups

* app/levels.c: default to ~/.gimp-1.1/levels for load/save; minor
gui prettification

* app/main.c
* app/menus.c: plug-in menu translation patch from SHIRASAKI Yasuhiro
<yasuhiro@awa.tohoku.ac.jp>

* libgimp/stdplugins-intl.h: add INIT_I18N_UI() for calling
gtk_set_locale()

* plug-ins/Lighting/lightin_main.c: use INIT_I18N_UI()

-Yosh
1999-08-27 21:06:00 +00:00
Manish Singh
7c4471b764 use AM_CPPFLAGS instead of CPPFLAGS
* libgimp/Makefile.am: use AM_CPPFLAGS instead of CPPFLAGS

* app/levels.c: added some basic load/save functionality to the levels
tool. Still needs some polishing.

-Yosh
1999-08-27 00:19:25 +00:00
Tor Lillqvist
387002c04b Add a flags field and corresponding type ToolFlags to PaintCore. The only
1999-08-27  Tor Lillqvist  <tml@iki.fi>

* app/paint_core.h: Add a flags field and corresponding type
ToolFlags to PaintCore. The only flag bit defined so far is
TOOL_CAN_HANDLE_CHANGING_BRUSH, which those tools who don't mind
if the brush changes while painting (as in the case of pixmap pipe
brushes).

* app/paint_core.c: Test above flag before calling the brush's
select_brush method.

* app/airbrush.c
* app/paintbrush.c
* app/pencil.c: Set above flag.

* app/makefile.{cygwin,msc}: Add latest additions.
1999-08-26 21:33:58 +00:00
Tor Lillqvist
868bdfff44 Overhaul of pixmap brushes and pipes: No separate pixmap pipe
brush tool any longer. The paintbrush, airbrush and pencil
tools, which already knew how to handle the single-pixmap
brushes now also handle the pipes as well.

* app/pixmapbrush.{h,c}
* app/gimpbrushpixmap.{h,c}: Removed these files.

* app/Makefile.am
* app/makefile.{cygwin,msc}: Remove from here, too.

* app/gimpbrushpipe.{h,c}: Total overhaul.

* app/paint_core.h
* app/apptypes.h: Some more types moved to apptypes.h

* app/context_manager.c
* app/tool_options.c
* app/tools.c
* app/toolsF.h: Remove PIXMAPBRUSH tool.

* app/gimpbrush.h: New method: select_brush. Used to change the
brush in paint_core, for pipe brushes.

* app/gimpbrush.c: Add gimp_brush_select_brush, which is dummy for
the normal brushes (returns the same brush).

* app/paint_core.c: Call the brush's select_brush method to get a
potential new brush before calling the paint_func.

* app/gimpbrushlist.c: Various changes related to the pixmap and
pipe overhaul.

* app/airbrush.c
* app/pencil.c: Reorder code a bit in the tool motion function to
avoid executing unnecessary code in the case of a pixmap brush.

Other changes in the same commit:

* app/install.c: Make quote_spaces extern.

* app/appenv.h: Declare it.

* libgimp/gimpui.def: Add missing entry points.

* libgimp/makefile.{cygwin,msc}: Add missing objects to gimpui.
1999-08-26 00:54:30 +00:00
Michael Natterer
766e1483fa ooops 1999-08-24 02:55:59 +00:00
Michael Natterer
ed7da92952 new function color_panel_set_color().
1999-08-24  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/color_panel.[ch]: new function color_panel_set_color().

	* app/color_picker.c: added a color panel to the color picker info
	dialog and a toggle button to the color picker's tool options
	which allows color updates to be effective in the info dialog
	only.

	* app/info_dialog.[ch]: changed the packing parameters of the info
	table. Small fixes.

	* app/palette.c: the name created for dropped colors contained " "
	instead of "0".
1999-08-24 02:52:40 +00:00
Sven Neumann
bb59f41a93 fixed display of distance in the info window
--Sven
1999-08-23 17:58:01 +00:00
Michael Natterer
ef4cb06bb7 export bucket_fill_region().
1999-08-23  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/bucket_fill.[ch]: export bucket_fill_region().

	* app/channels_dialog.c: enabled dropping a color to a channel.

	* app/color_area.c
	* app/color_panel.c
	* app/gimpdnd.[ch]: the whole color dnd is now done in a generic
	function in gimpdnd.c (dnd of other types is still hacked in at
	various places but will go to generic functions and callbacks as
	well).

	* app/disp_callbacks.[ch]
	* app/interface.c: drop a color to the display to bucket fill the
	selected region.
1999-08-23 14:19:26 +00:00
EDT 1999 Adrian Likins
5c61305f24 app/gimpbrushhose.c removed. app/gimpbrushpipe.c New files to replace the
Mon Aug 23 00:56:59 EDT 1999 Adrian Likins <alikins@redhat.com>

        * app/gimpbrushhose.c
        * app/gimpbrushhose.h:
                removed.
        * app/gimpbrushpipe.c
        * app/gimpbrushpipe.h:
                New files to replace the above
        * app/gimpbrushlist.c
        * app/paintbrush.c
        * app/pixmapbrush.c
        * app/Makefile.am:
                s/hose/pipe. Seems someone else uses that name,
        so change it to pipe.

        * app/gimpbrush.c
        * app/gimpbrush.h
        * app/gimpbrushpixmap.c
        * app/patterns.c
        * app/patterns.h
        * app/pixmapbrush.c:
                Added functions to do the actual loading of
        brush/pattern data. Use them where approriate instead
        of cut&pasting the same code all over the place.

        * app/pixmapbrush.c: Fix the bug where masks and brush
        data werent aligned. I didnt quite notice that
        paint_core_get_paint_area returns an area with a 1 pixel
        border larger than the brush. Ooops.

        * TODO: just update a few things while I'm at it
        (pixmap/pipe stuff in particular)
1999-08-23 06:06:12 +00:00
Tomas Ogren
51f7bf2386 app/bucket_fill.c app/clone.c app/convolve.c app/flip_tool.c app/measure.c
1999-08-22  Tomas Ogren  <stric@ing.umu.se>

* app/bucket_fill.c
* app/clone.c
* app/convolve.c
* app/flip_tool.c
* app/measure.c
* app/pixmapbrush.c: i18n fixes
1999-08-22 05:56:27 +00:00
Tomas Ogren
cdad1e0164 Remember kids, "Options" is spelled "Options", not "Ootions"
1999-08-22  Tomas Ogren  <stric@ing.umu.se>

* app/tool_options.c: Remember kids, "Options" is spelled "Options",
not "Ootions"
1999-08-22 01:40:36 +00:00
Sven Neumann
c53c8f4122 I promise to never say 'perfect' again...
--Sven
1999-08-21 13:16:20 +00:00
Sven Neumann
b79e8e290e the measure tool is now perfect, IMO
--Sven
1999-08-21 11:30:10 +00:00
jaycox
12246d3a0e removed cubic_interpolation variable. use the interpolation_type variable
* app/gimprc.[ch]: removed cubic_interpolation variable.
	* app/transform_core.c: use the interpolation_type variable
	instead of the old cubic_interpolation variable.
1999-08-21 08:25:18 +00:00
Michael Natterer
311c83b0a4 app/Makefile.am new file containing the dnd data definitions.
1999-08-19  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/Makefile.am
	* app/gimpdnd.h: new file containing the dnd data definitions.

	* app/disp_callbacks.[ch]
	* app/interface.c: drop layers on the toolbox to create a new
	image and on the display to copy it to the image's layer stack.

	* app/layers_dialog.c: drop layer on the "New" button to create an
	empty layer with the dropped layer's properties, to "Duplicate" to
	duplicate it and on the trashcan to delete it.
	Thanks to Andy for the ultra-cool dnd preview pixmap patch.

	* app/layer.[ch]
	* app/undo.c: renamed layer_mask() to layer_get_mask(). Prototyped
	some function headers.

	* app/disp_callbacks.c: Wheelmouse stuff: Shift+wheel scales the
	display.

	* app/airbrush.c
	* app/eraser.c
	* app/paint_options.h
	* app/paintbrush.c
	* app/pencil.c
	* app/tool_options.c: moved the "Incremental" toggle to the
	PaintOptions structure because it is used more often now.
1999-08-19 19:53:30 +00:00
Sven Neumann
e7c1e75606 support for adding guides at the handles
--Sven
1999-08-19 16:26:47 +00:00
Adrian Likins
311953b12c add GradientPaintMode enum move above enum use above enum
Wed Aug 18 22:49:31 1999 Adrian Likins <alikins@redhat.com>

        * app/apptypes.h: add GradientPaintMode enum
        * app/paint_core.h: move above enum
        * app/paintbrush.c: use above enum

        * app/drawable_cmds.c: include "layers.h" so it
        will link again
1999-08-19 03:51:33 +00:00
Tor Lillqvist
f6858e21d1 Actually use the enum types GimpImageType, GimpImageBaseType,
* app/*.[ch]: Actually use the enum types GimpImageType,
	GimpImageBaseType, LayerModeEffects, PaintApplicationMode,
	BrushApplicationMode, GimpFillType and ConvertPaletteType, instead
	of just int or gint. Hopefully I catched most of the places
	where these should be used.

	Add an enum ConvolutionType, suffix the too general constants
	NORMAL, ABSOLUTE and NEGATIVE with _CONVOL. Use NORMAL_MODE
	instead of NORMAL in some places (this was what was intended). Fix
	some minor gccisms.

	* app/apptypes.h: New file. This file contains the above
	enumeration types, and some opaque struct typedefs. It was
	necessary to collect these in one header that doesn't include
	other headers, because when we started using the above mentioned
	types in the headers, all hell broke loose because of the
	spaghetti-like cross-inclusion mess between headers.

	(An example: Header A includes header B, which includes header C
	which includes A. B uses a type defined in A. This is not defined,
	because A hasn't defined it yet at the point where it includes B,
	and A included from B of course is skipped as we already are
	reading A.)
1999-08-18 23:41:39 +00:00
Sven Neumann
088a9d7131 almost done with the measure tool ...
--Sven
1999-08-18 18:48:35 +00:00
Adrian Likins
33a045c12f oops, missed a couple of file 1999-08-17 01:05:59 +00:00
Tor Lillqvist
97346fb110 Use RINT instead of rint.
* app/transform_core.c: Use RINT instead of rint.

	* plug-ins/common/curve_bend.c
	* plug-ins/sel2path/spline.c: Workarounds for gccisms, thanks to
	Hans Breuer.

	* app/makefile.msc
	* plug-ins/makefile.msc: Misc fixes.
1999-08-16 19:33:35 +00:00
jaycox
2c206a4840 put the gimp_matrix_is_simple optimization back in.
* app/transform_core.c: put the gimp_matrix_is_simple
	optimization back in.
1999-08-16 10:59:14 +00:00
jaycox
60475da041 data access optomizations from David Hodson <hodsond@acm.org>
* app/transform_core.c: data access optomizations from
	David Hodson <hodsond@acm.org>
1999-08-16 08:29:13 +00:00
Tor Lillqvist
b5d790e67e Add G_SQRT2.
* app/appenv.h: Add G_SQRT2.

	* app/iscissors.c: Use it.

	* app/makefile.{cygwin,msc}: Add new files.

	* */makefile.{cygwin,msc}: Use libintl extracted from glibc from a
	separate directory, not from gettext, because of licensing issues
	(we want to use the LGPL version in GTk+, so use it here, too).
1999-08-16 04:59:48 +00:00
Manish Singh
1fd1919f4f added a G_PI_2
* app/appenv.h: added a G_PI_2

* app/brush_header.h
* app/pattern_header.h: prefixed each FILE_VERSION with
G{BRUSH,PATTERN} to avoid namespace collision

* app/patterns.c: reflect above change

* app/iscissors.[ch]: merged in Austin's iscissors rewrite.. still
unfinished, but it's not like the old one did anything useful
anyway ;)

-Yosh
1999-08-16 03:43:48 +00:00
Sven Neumann
acdd8c0966 A little bit of special-casing here and there to avoid division by zero etc.
Other systems may eventually behave differently when it comes to atan(PI/2),
so please test this on other platforms...


--Sven
1999-08-15 21:10:29 +00:00
Sven Neumann
88cdb2f80d Sorry, shouldn't have checked this in so early. Works reasonably now.
--Sven
1999-08-15 20:12:44 +00:00
Sven Neumann
caaf18a24f It's gettin better...
--Sven
1999-08-15 18:44:15 +00:00
Sven Neumann
27c2621399 Added new measure tool.
--Sven
1999-08-15 15:59:06 +00:00
Sven Neumann
ed81308375 movements restricted to 45 degrees (Ctrl+Alt) feel more natural now
--Sven
1999-08-14 12:34:08 +00:00
Manish Singh
374e55bced add pixmaps/dropper.xpm to EXTRA_DIST
* Makefile.am: add pixmaps/dropper.xpm to EXTRA_DIST

* app/appenv.h: minor formatting changes

* app/channel.c: #include "gdisplay.h"

* app/color_transfer.c
* app/dodgeburn.c
* app/gdisplay.c
* app/iscissors.c
* app/paint_core.c: remove extra SQR and ROUND definitions

* app/flip_tool.c: hackaround the flip tool options constant problem

* app/flip_tool.[ch]: use InternalOrientationType for flip_tool_flip
prototype

* app/interface.c: use GTK_LABEL case in gtk_label_set_justify

* plug-ins/common/mkgen.pl
* plug-ins/common/plugin-defs.pl: add @extra EXTRA_DIST processing

-Yosh
1999-08-13 22:33:49 +00:00
Adrian Likins
29709cb9ee app/airbrush.c app/paintbrush.c app/pencil.c app/pixmapbrush.c
Fri Aug 13 16:39:25 1999 Adrian Likins <alikins@redhat.com>

        * app/airbrush.c
        * app/paintbrush.c
        * app/pencil.c
        * app/pixmapbrush.c
        * app/pixmapbrush.h

        Added support for pixmap brushes to airbrush, pencil,
        and paintbrush. Merging this into paintbrush makes
        the pixmaptool itself kind of useless at the moment,
        but that will change ;->

        Still a few rough edges here, but its mostly there.
        I still need to make the "incremental" button for
        the tools to accurately reflect that pixmap always
        uses this mode.

        * app/eraser.c
        * app/eraser.h
        * app/tools_cmds.c
        * tools/pdbgen/pdb/tools.pdb

        Applied patch from  Shuji Narazaki <narazaki@gimp.org>
        to implement the anti-eraser. Neat.
1999-08-13 20:50:30 +00:00
Adrian Likins
204d4123b2 app/pixmapbrush.c app/pixmapbrush.h app/gimpbrushpixmap.c New files,
Mon Aug  9 01:20:24 1999 Adrian Likins <alikins@redhat.com>

        * app/pixmapbrush.c
        * app/pixmapbrush.h
        * app/gimpbrushpixmap.c
        * app/gimpbrushpixmap.h: New files, implement the GimpBrushPixmap
          object, and the pixmap brush tool.

        * app/context_manager.c
        * app/tool_options.c
        * app/tools.c
        * app/toolsF.h: add the pixmap brush tool in

        * app/gimpbrushlist.c: allow for loading of pixmap brushes and
        displaying them in the brush dialog. Currently it only shows the
        grey scale mask.

        *app/Makefile.am: add the pixmap tool stuff to the build process

        These Changes implement a pixmap brush tool. Sort of a "image stamp".
        Some examples can be seen at http://adrian.gimp.org/pixmap-brush/.

        Some examples of pixmap brushes can be found there too (.gpb
        extension), but these are easy enough to make (for now, make
        a pattern and a brush the same size and `cat foo.gbr foo.pat >
        foo.gpb` ;->

        Theres still a few rough edges that need some tweaking, but
        the framework is there. Figured I'd sneak it in before the
        freeze.
1999-08-09 06:30:31 +00:00
Seth Burgess
b519150fa9 ChangeLog app/channel.c app/channel.h app/channel_ops.c
app/gimpimage.c app/gimpimageP.h app/interface.c
 	app/paint_core.c app/qmask.c app/qmask.h:

	Added qmask settings dialogs through double clicking.
1999-08-07 20:55:26 +00:00
Tor Lillqvist
933b866166 Define ROUND(), RINT(), SQR(), G_PI and G_PI_4. The latter two will
* app/appenv.h: Define ROUND(), RINT(), SQR(), G_PI and
	G_PI_4. The latter two will presumably eventually be in
	GLib. RINT() calls rint() if we have it, otherwise adds 0.5 and
	calls floor().

	* app/*.c: Remove the multiple identical definitions of M_PI. Use
	G_PI instead of M_PI. Remove ROUND() and rint() definitions. Use
	RINT() instead of rint().
1999-08-04 23:22:29 +00:00
jaycox
823817cc52 app/paint_core.c: Improvements to the transform_core_do and cubic routines
app/paint_core.c: Improvements to the transform_core_do and cubic
	 routines by David Hodson <hodsond@acm.org>
	"This fixes a number of annoying inaccuracies in transform_core.
	The identity transform now leaves all pixels unchanged; previously
	it shifted the image by 1/2 pixel left and up. All edges of an
	image are now correctly antialiased after a transform. The cubic
	interpolation function has been changed to a slightly smoother one.
	The code has been tidied and rearranged for some minor improvements
	in efficiency, but the basic logic and tile handling have not changed."
1999-08-03 09:44:41 +00:00
Sven Neumann
5d929fb51b Fixed a bug in the line-preview.
--Sven
1999-08-01 14:26:59 +00:00
jaycox
165c69ffba replace the cubic functions with a better/faster version supplied by David
* app/paint_funcs.c, app/transform_core.c:  replace the cubic
	functions with a better/faster version supplied by
	David Hodson <hodsond@acm.org>

	* app/brush_select.c: double clicking on a brush preview now opens up
	the brush editor.  Update the text displayed when the active brush
	changes size.

	* app/paint_funcs.c: slight modification to overlay_pixels.
1999-07-29 10:40:42 +00:00
Manish Singh
7cb07a90bf add sample_colorize and curve_bend defs
* plug-ins/common/plugin-defs.pl: add sample_colorize and
curve_bend defs

* libgimp/color_selector.h: minor consistency cleanup

* libgimp/gimpchainbutton.[ch]: use new style gtk object helper macros

* libgimp/gimpfileselection.c
* libgimp/gimpmatrix.h: minor cleanup

* libgimp/gimpintl.h: resync with gnome-i18n.h


* libgimp/color_display.h
* app/gimp.sym
* app/gdisplay_color.[ch]
* app/app_procs.c
* app/gdisplay.h
* app/image_render.c: color display transformation code. Still
unfinished, so it's not activated yet.

* app/buildmenu.h: remove unused defines (PULLDOWN, POPUP, OPTION)

* app/colormaps.[ch]
* app/image_render.c: remove vestigal dithering stuff

* app/convolve.h
* app/gimpdrawable.h
* app/gimpimage.h
* app/lut_funcs.h
* app/paint_funcs.h
* app/plug_in.h: enum nick changes from Marc

* app/channel_ops.c
* app/crop.c
* app/gdisplay.c
* app/gimpimage.[ch]
* app/move.c: s/([A-Z]+)_GUIDE/ORIENTATION_$1/

* app/flip_tool.[ch]
* app/shear_tool.[ch]: use ORIENTATION_* constants instead of our own

* app/disp_callbacks.c: remove HORIZONTAL and VERTICAL #defines

* app/general.h: enumified TOKEN_* symbols

* app/lc_dialog.c
* app/paint_funcs.c: remove unused variables

* tools/pdbgen/lib.pl: autogen gimpenums.h (unfinished)

* tools/pdbgen/stddefs.pdb: new std_orientation_enum, remove
layer_mode shortcut since we've skipped it in app/

* tools/pdbgen/pdb/brush_select.pdb
* tools/pdbgen/pdb/brushes.pdb
* tools/pdbgen/pdb/drawable.pdb
* tools/pdbgen/pdb/gimage.pdb
* tools/pdbgen/pdb/guides.pdb
* tools/pdbgen/pdb/layer.pdb
* tools/pdbgen/pdb/tools.pdb: reflect above enum changes, whitespace
cleanups

* tools/pdbgen/enums.pl
* app/brush_select_cmds.c
* app/brushes_cmds.c
* app/color_cmds.c
* app/drawable_cmds.c
* app/gimage_cmds.c
* app/layer_cmds.c
* app/procedural_db_cmds.c
* app/tools_cmds.c: reflect pdb and enum nick changes above

-Yosh
1999-07-28 23:00:08 +00:00
jaycox
bc0451b4b4 more cursor support. new cursor fix that rounding error the right way this
* app/clone.c: more cursor support.
	* app/cursorutil.[ch], cursors/{bad,badmsk}: new cursor
	* app/paint_core.c: fix that rounding error the right way this time.
	* app/pixel_processor.c, app/pixel_region.c:  Lock the tiles while
	they are being processed.  Only create new threads if the region
	being processed is large enough to warrant it.
1999-07-27 08:47:31 +00:00
Tomas Ogren
5cd833bede Fixed a typo
1999-07-27  Tomas Ogren  <stric@ing.umu.se>

* app/transform_tool.c: Fixed a typo
1999-07-27 01:09:04 +00:00
Tomas Ogren
a89287a132 app/actionarea.c app/dodgeburn.c app/fuzzy_select.c app/gimpparasite.c
1999-07-27  Tomas Ogren  <stric@ing.umu.se>

* app/actionarea.c
* app/dodgeburn.c
* app/fuzzy_select.c
* app/gimpparasite.c
* app/gimpunit.c
* app/procedural_db_cmds.c
* app/resize.c: Misc i18n fixes
1999-07-27 00:14:14 +00:00
MEST 1999 Sven Neumann
33167e4c37 Restrict to horizontal/vertical blend when modifiers are pressed.
Mon Jul 26 20:11:01 MEST 1999  Sven Neumann <sven@gimp.org>

        * app/blend.c: Restrict to horizontal/vertical blend when modifiers
        are pressed.

--Sven
1999-07-26 18:13:10 +00:00
jaycox
94446f7c5f fixed long standing roundoff error in paint_core_subsample_mask. A couple
* paint_core.c: fixed long standing roundoff error in
	paint_core_subsample_mask.  A couple of minor code cleanups.
1999-07-26 07:24:47 +00:00
Michael Natterer
9b9f3d1066 set the "preserve" flag to FALSE. This way the tool doesn't have to detect
1999-07-24  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/color_picker.[ch]: set the "preserve" flag to FALSE. This
	way the tool doesn't have to detect drawable changes by itself.
	Misc stuff like below.

	* app/gradient.c: heavily changed the beast:

	- Reviewed the whole ui code and indented it.
	- Standard ui for all sub-dialogs.
	- Handle the wm delete event of the sub-dialogs.
	- "+" and "-" pixmaps instead of "zoom in" and "zoom out".
	- Made the gradient preview resizable again.
	- i18n fixes.
	- Removed some code duplication in the sub-dialogs' cancel/delete
	  callbacks.
	- Grouped functions together and commented the groups and their
	  prototypes.
	- Didn't change any core functionality (just the ui).
	- Please don't kill me, but I couldn't resist to indent most
	  functions ;-)

	* app/info_dialog.c: no need to call gettext() on a string which
	was passed to a function (it's the job of the caller).

	* app/ink.c: grab the pointer in the blob preview.

	* app/palette.c: standardized the ui of the dialog and all it's
	sub-dialogs, function header indentation, namespace cleanup.
1999-07-24 15:37:03 +00:00
BST 1999 Andy Thomas
954151d601 ./app/clone.c ./app/airbrush.c ./app/bezier_select.c ./app/paintbrush.c
Fri Jul 23 00:01:05 BST 1999 Andy Thomas <alt@gimp.org>

	* ./app/clone.c
	* ./app/airbrush.c
	* ./app/bezier_select.c
	* ./app/paintbrush.c
	* ./app/eraser.c
	* ./app/convolve.c
	* ./app/smudge.c
	* ./app/dodgeburn.c
	* ./app/pencil.c
	* ./app/paint_core.c

	Better stroking of paths.
	First point in stroke path is now correctly painted (try stroking
	with a brush spacing of > 100.0 in gimp 1.0.x).
	Fixed problem in paint_core_interpolate() where points were
	missed in some cases.
	(BTW for those who do not know the brush spacing means as follows:-
	A spacing of 100.0 means brush strokes are placed next to each other
	exactly with no gaps or overlaps. A spacing of 200.0 means only
	alternate spaces are filled with the brush paint. A setting of 50.0
	means the brush paints positions overlap by 50% of the brush width.
	So 100.0 corresponds to exactly the brush width! It took me
	ages to figure this simple thing out!)
1999-07-22 23:11:46 +00:00
Michael Natterer
88648f4049 same cleanups as in my previous checkin.
1999-07-22  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/brightness_contrast.c: same cleanups as in my previous
	checkin.

	* app/gradient.c: made the gradient editor look like the other
	dialogs. It's now possible to set the background color with
	<Ctrl>+click. Indentation madness in all functions I modified.
1999-07-22 20:42:59 +00:00
Michael Natterer
a4c1e8a557 new ui for the "Layer Offset" dialog.
1999-07-22  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/channel_ops.[ch]: new ui for the "Layer Offset" dialog.

	* app/channels_dialog.c
	* app/layers_dialog.c: major code cleanup: Folded some callbacks
	into common ones, "widget" instead of "w", indentation, ...

	* app/commands.c
	* app/interface.[ch]
	* app/global_edit.c: the query boxes must be shown by the caller
	now. There's no need to split up the string for the message box
	manually as the Gtk 1.2 label widget handles newlines corectly.
	Added the "edge_lock" toggle to the "Shrink Selection" dialog.
	Nicer spacings for the query and message boxes.

	* app/ink.c: tried to grab the pointer in the blob preview but
	failed. Left the code there as a reminder (commented out).

	* app/menus.c: reordered <Image>/Select.

	I was bored and grep-ed the sources for ancient or deprecated stuff:

	* app/about_dialog.[ch]
	* app/actionarea.[ch]
	* app/app_procs.c
	* app/brush_edit.c
	* app/brush_select.c
	* app/color_select.c
	* app/convert.c
	* app/devices.c
	* app/gdisplay.c
	* app/gdisplay_ops.c
	* app/histogram_tool.[ch]
	* app/info_window.c
	* app/install.c
	* app/ops_buttons.c
	* app/palette.c
	* app/palette_select.c
	* app/paths_dialog.c
	* app/pattern_select.c
	* app/resize.c
	* app/scale_toolc.c
	* app/text_tool.c:
	s/container_border_width/container_set_border_width/g,
	s/sprintf/g_snprintf/g, replaced some constant string lengths with
	strlen(x).

	* app/bezier_select.c
	* app/blend.c
	* app/boundary.c
	* app/errors.[ch]
	* app/free_select.c
	* app/gimpbrushlist.c
	* app/gimprc.c
	* app/iscissors.c
	* app/main.c
	* app/patterns.[ch]
	* app/text_tool.c: namespace fanaticism: prefixed all gimp error
	functions with "gimp_" and formated the messages more uniformly.

	* app/gradient.c
	* app/gradient_select.c: same stuff as above for the ui
	code. There are still some sub-dialogs which need cleanup.

	Did some cleanup in most of these files: prototypes, removed tons
	of #include's, i18n fixes, s/w/widget/ as above, indentation, ...
1999-07-22 16:21:10 +00:00
Michael Natterer
310091fd3d Changed the default step-width of the "size"-slider to 2 instead of 5.
1999-07-20  Michael Natterer  <mitschel@cs.tu-berlin.de>

        * app/ink.c (ink_options_new): Changed the default step-width of
        the "size"-slider to 2 instead of 5.
1999-07-20 16:12:56 +00:00
BST 1999 Andy Thomas
6c28319bc3 app/indicator_area.c app/paths_dialog.c app/tools_cmds.c app/airbrush.c
Mon Jul 19 23:40:56 BST 1999 Andy Thomas <alt@gimp.org>

	* app/indicator_area.c
	* app/paths_dialog.c
	* app/tools_cmds.c
	* app/airbrush.c
	* app/airbrush.h
	* app/bezier_select.c
	* app/paintbrush.c
	* app/paintbrush.h
	* app/clone.c
	* app/clone.h
	* app/eraser.c
	* app/eraser.h
	* app/convolve.c
	* app/convolve.h
	* app/smudge.c
	* app/smudge.h
	* app/dodgeburn.c
	* app/dodgeburn.h
	* app/internal_procs.c
	* plug-ins/sel2path/sel2path.c
	* tools/pdbgen/pdb/tools.pdb
	* tools/pdbgen/enums.pl

	1) Fixed the brushpreview popup problem where it remained onscreen
           if the mouse button was released in another GTK window that accepted
	   mouse events.

	2) Selection to path now works on all types of images (it should have
	   anyway).

	3) Fixed PDB so you can once again use the PDB interfaces to the clone
	   and airbrush tools.

	4) PDB Function to add a path to an image now adds it correctly.

	5) airbrush/paintbrush/clone/eraser/convolve New PDB functions that
           use the options dialogs settings (or sane defaults if option dialog
           not present)

	6) Added PDB functions for Smudge & DodgeBurn tools.

	7) Path stroke command (from the LCP dialog) can now use any of the
	   painting tools (airbrush/paintbrush/clone/eraser/convolve/smudge/
           dodgeburn except ink). Just have the tool selected when you
	   press the stroke button.
1999-07-19 22:42:49 +00:00
Sven Neumann
061dc89df7 Watch out! Sven starts to dig into the mysteries of painting and inking!
--Sven
1999-07-14 09:44:58 +00:00
MEST 1999 Sven Neumann
b47b9e0860 app/clone.c app/dodgeburn.c app/pencil.c applied a patch from Olof S
Fri Jul  9 18:39:03 MEST 1999  Sven Neumann <sven@gimp.org>

        * app/clone.c
        * app/dodgeburn.c
        * app/pencil.c
        * app/smudge.c: applied a patch from Olof S Kylander
        <olof@frozenriver.com> that enables pressure sensitivity for all
        the tools that were missing it


--Sven
1999-07-09 16:41:58 +00:00
MEST 1999 Sven Neumann
0a6d8a2f4b added a few functions to test for matrix properties
Fri Jul  9 16:47:04 MEST 1999  Sven Neumann <sven@gimp.org>

        * libgimp/gimpmatrix.[ch]: added a few functions to test for
        matrix properties

        * app/transform_core.c: if we are doing a simple transformation
        (e.g. rotating by 90 degrees), turn off interpolation

        * app/rotate_tool.c: persuade the slider that a rotate angle of
        180 degrees is perfectly ok


--Sven
1999-07-09 14:51:01 +00:00
Michael Natterer
434915b03d mysteriously, using the new tool constructor fixed the crop tool redraw
1999-07-09  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/crop.c: mysteriously, using the new tool constructor fixed
	the crop tool redraw problem.

	* app/gdisplay.c: clode cleanup

	* app/info_dialog.c: never emit signals when updating the info
	fields. Fixes some more transform tool grid redraw bugs.
1999-07-09 12:24:36 +00:00
MEST 1999 Sven Neumann
27d47091bb give user feedback on the threshold use an optionmenu for the gradient
Tue Jul  6 19:58:48 MEST 1999 Sven Neumann <sven@gimp.org>

        * app/fuzzy_select.c: give user feedback on the threshold
        * app/paintbrush.c: use an optionmenu for the gradient type
        instead of using 4 radiobuttons
        * app/blend.c: indentation paranoia

        Hopefully I have merged in Michaels changes correctly ...

--Sven
1999-07-06 18:13:59 +00:00
Michael Natterer
1058f41dab app/airbrush.c app/blend.c app/bucket_fill.c app/clone.c app/convolve.c
1999-07-06  Michael Natterer  <mitschel@cs.tu-berlin.de>

        * app/airbrush.c
        * app/blend.c
        * app/bucket_fill.c
        * app/clone.c
        * app/convolve.c
        * app/dodgeburn.c
        * app/eraser.c
        * app/ink.c
        * app/paintbrush.c
        * app/pencil.c
        * app/smudge.c: get opacity/paint mode from the current context
        (currently always the user context).

        * app/gimage_mask.c: the "stroke" command uses the paintbrush's
        settings if the current context is the user context and we are in
        per-tool paint options mode.

        * app/context_manager.[ch]
        * app/paint_options.h
        * app/preferences_dialog.c
        * app/tool_options.c
        * app/tools.c: moved the global/per-tool paint options switching
        to the context manager. The tool options themselves only contain
        the widgets for them now. This should fix the segfaults happening
        in per-tool mode.
	Removed the disclaimer from the prefs. dlg. as it seems to work
	now. The impl. in the context manager however is still a hack.

        * app/brush_select.c
        * app/brushes_cmds.c
        * tools/pdbgen/pdb/brushes.pdb: same as above.

        * app/lc_dialog.c: minimal code reduction. No functionality changed.
1999-07-06 15:18:25 +00:00
BST 1999 Austin Donnelly
ad54165a88 change from greyscale bars to colour ones similar to curves.c. Is this any
Mon Jul  5 20:39:42 BST 1999  Austin Donnelly  <austin@gimp.org>

	* app/levels.c: change from greyscale bars to colour ones similar
	    to curves.c.  Is this any use to people?  If not, we can
	    always revert it.
1999-07-05 19:49:55 +00:00
Michael Natterer
8b50905ad2 changed the tool toggle key to <Ctrl>. typo.
1999-07-02  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/dodgeburn.c: changed the tool toggle key to <Ctrl>.
	* app/tools.c: typo.
1999-07-02 18:08:58 +00:00
Michael Natterer
a60b2c2f02 the Tool structure is now allocated by a common constructor which sets
1999-07-02  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/[all tools]: the Tool structure is now allocated by a common
	constructor which sets default values and provides default tool
	action functions. To get rid of much code duplication there should
	be a object hierarchy of tools.

	* app/context_manager.c
	* app/tools.[ch]: create and destroy private contexts for the
	paint tools on startup and exit. They are not used yet.

	* app/interface.c
	* app/menus.c
	* app/tools.h: num_tools is now exported in tools.h

	* app/commands.c
	* app/gdisplay.c
	* app/menus.c: made "Toggle Selection" a toggleable menu item.
1999-07-02 17:40:10 +00:00
People doing a 16 bpc version of gimp
5b5c24e9dd Import of Smudge and dodge and burn tools. Details in Change log.
calvin@rhythm.com
1999-07-01 16:52:50 +00:00
Sven Neumann
0320cb507e Crop now does AutoShrink -- the algorithm starts with the interactively
1999-06-30  Sven Neumann  <sven@gimp.org>

	* app/crop.c (crop_automatic_callback): Crop now does
	AutoShrink -- the algorithm starts with the interactively
	selected crop area and tries to shrink that instead of
	always starting from the corners.

	* plug-ins/helpbrowser/helpbrowser.c: cosmetic changes

--Sven (using Mitschels account)
1999-06-30 16:19:52 +00:00
Michael Natterer
c456ba93ba app/[all tool related files] app/commands.c app/disp_callbacks.c
1999-06-26  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/[all tool related files]
	* app/commands.c
	* app/disp_callbacks.c
	* app/gdisplay.c
	* app/gimage.c
	* app/interface.c: hopefully fixed the bugs that appeared with my
	last fix. And some more changes...

	- Slightly changed the conditions which cause the tools to be
	  re-initialized on button_press events and the global
	  initialisation functions.
	- The dialog tools now explicitly set tool->gdisp_ptr so they can
	  be properly hidden on display deletion.
	- Create the crop info dialog only once and avoid ugly redraw bugs
	  by blocking the sizeentries' signal when initializing them.
	- Standardized the tools_new_<tool>() functions. They are
	  scheduled to be moved to a common constructor in tools.c
	- Various stuff...
1999-06-26 11:16:47 +00:00
Michael Natterer
d5d99e5c34 app/brightness_contrast.c app/by_color_select.c app/curves.c
1999-06-23  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/brightness_contrast.c
	* app/by_color_select.c
	* app/curves.c
	* app/disp_callbacks.c
	* app/histogram_tool.c
	* app/hue_saturation.c
	* app/levels.c
	* app/posterize.c
	* app/threshold.c:

	Factored out the cleaning up code to the tool dialog's "cancel"
	callbacks because they are called from every function which is
	aborting the tool. This should fix the remaining segfaults.

	I probably killed a feature of "Levels". The tool wanted to
	preserve it's drawable all the time, so it was possible to select
	colors from other displays. If this was the intended behaviour,
	please flame me and I will try to set the "preserve" flag
	correctly.

	* plug-ins/common/Makefile.am: "struc" was in the Makefile but not
	in the directory.
1999-06-23 15:24:46 +00:00
Michael Natterer
f1b5e1ae47 namespace cleanups.
1999-06-21  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/context_manager.c: namespace cleanups.

	* app/commands.[ch]
	* app/menus.c: moved the "Toggle Selection" menu entry to "View",
	sprinkled some separators and made the layers/channels/paths popup
	menus consistent with Tigert's last ops buttons change.

	* app/fileops.c
	* app/plug_in.c: check for gdisplay_active() returning NULL in
	some more places.

	* app/[all tool related files]:

	- Turned the ToolAction and ToolState #define's into typedef'ed
	  enums, so the compiler can do some more sanity checking.
	- Removed one more unused global variable "active_tool_layer".
	- Removed some #include's from tools.c.
	- Standardized the individual tools' structure names.
	- Moved showing/hiding the tool options to separate functions.
	- Stuff...

	* app/commands.c
	* app/disp_callbacks.c
	* app/gdisplay.c
	* app/tools.c: fixed the segfaults which happened when the image
	of one of the tools which have dialogs (levels/posterize/...) was
	deleted. My approach was to do stricter sanity checking and to set
	some gdisplay pointers correctly where appropriate, so I can't
	tell exactly where the bug was.
	The curves tool now(??) updates on every _second_ display change
	only, which is really obscure.
	Finding/changing the display to operate on should definitely be
	done by connecting to the user context's "display_changed"
	signal.

	* app/gimpset.c: emit the "remove" signal _after_ removing the
	pointer from the set. If this was not a bug but a feature, please
	let me know, we'll need two signals then.
1999-06-21 22:12:07 +00:00
Michael Natterer
aef2a0331a added some functions. Still does nothing.
1999-06-19  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/gimpcontext.[ch]: added some functions. Still does nothing.

	* app/bezier_select.c
	* app/devices.c
	* app/tools.[ch]: removed global variable active_tool_type
	because it was always equal to active_tool->type.
1999-06-19 20:20:59 +00:00
Seth Burgess
01155dd8c7 Don't use FLIP (enum of 11) in place of FLIP_INFO
(fixed flip tool bug)
1999-06-19 03:41:02 +00:00
Sven Neumann
fb2d95a20a Dropped the COMMON_MODIFIERS_MASK define, since it isn't used anymore.
--Sven
1999-06-17 21:57:34 +00:00
Sven Neumann
227021fce1 Implemented horizontal and vertical lines for the paint_tools using CTRL
and MOD1. Changed the Scale tool to use the same modifiers.

Default the Crop tool to the old-fashioned behaviour (crop and dont_enlarge).


--Sven
1999-06-17 20:34:50 +00:00
Tor Lillqvist
776cd54ca9 Mention using GNU gettext.
* README.win32: Mention using GNU gettext.

	* config.h.win32: Enable NLS stuff. Remove the X11 & Unix vs. Win32
	feature test macros, we use those from glibconfig.h and gdkconfig.h.

	* app/makefile.msc: Use gettext. New object files.

	* app/batch.c: No need to include <io.h> on Win32.

	* app/errorconsole.c
	* app/plug_in.c
	* app/tile_swap.c: Include <glib.h> early to get Win32 feature
	test macros from <glibconfig.h>.

	* app/gimpset.c: Remove unnecessary (?) warning.

	* app/main.c
	* libgimp/stdplugins-intl.h: If no LOCALEDIR defined
	(as on Win32), use the "locale" subdir in gimp_data_directory().

	* app/palette.c: Open palette file in text mode.

	* app/session.c
	* app/text_tool.c: Use GDK's GDK_WINDOWING feature test macro
	if available, not WINDOWS_DISPLAY.

	* libgimp/gimpfeatures.h.win32: Correct GIMP_VERSION.

	* libgimp/makefile.msc: Use gettext.

	* plug-ins/makefile.msc: Use gettext. Add some missing
 	plug-ins. Advice how to build "unofficial" plug-ins.

	* plug-ins/FractalExplorer/FractalExplorer.c
	* plug-ins/faxg3/faxg3.c
	* plug-ins/gbr/gbr.c
	* plug-ins/gz/gz.c: Include <glib.h> early.

	* plug-ins/tga/tga.c: Include config.h, use HAVE_UNISTD_H.
1999-06-14 22:18:02 +00:00
Sven Neumann
93452ea4d6 Only install the tool cursor if we are inside a selected region.
--Sven
1999-06-07 23:15:18 +00:00
Sven Neumann
cff5ff7187 Overworked the line preview. Sorry for the inconvenience, but it has always
worked here due to a bug in icewm. Should work much better now, also it still
isn't perfect (yet).

Had to change the standard toggle key for all toggleable tools to
<Ctrl> since <Shift> collides with line drawing in the Convolver tool.


--Sven
1999-06-07 22:38:20 +00:00
Tomas Ogren
6a6bc56c84 app/bucket_fill.c app/color_picker.c app/commands.c app/convolve.c
1999-06-07  Tomas Ogren  <stric@ing.umu.se>

* app/bucket_fill.c app/color_picker.c app/commands.c app/convolve.c
* app/crop.c app/flip_tool.c app/gimpunit.c app/global_edit.c
* app/gradient.c app/histogram_tool.c app/magnify.c app/module_db.c
* app/palette.c app/paths_dialog.c app/text_tool.c app/transform_tool.c
  Misc i18n fixes, partly ported from Egger-gimp
1999-06-07 02:21:31 +00:00
Tomas Ogren
79be4895ec Misc l10n fixes
1999-06-06  Tomas Ogren  <stric@ing.umu.se>

* app/{color_notebook.c,color_select.c,lc_dialog.c,temp_buf.c,tool_options.c,tools.c}:
  Misc l10n fixes
1999-06-06 19:44:36 +00:00
Michael Natterer
ac98e8fa81 app/Makefile.am app/lc_dialog.[ch] app/lc_dialogP.h new files
1999-06-06  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/Makefile.am
	* app/lc_dialog.[ch]
	* app/lc_dialogP.h
	* app/paths_dialogP.h: new files

	* app/channels_dialog.[ch]
	* app/layers_dialog.[ch]
	* app/layers_dialogP.h
	* app/paths_dialog.[ch]
	* app/menus.[ch]
	* app/file_new_dialog.c: modified

	- Moved the toplevel L&C dialog code to lc_dialog.[ch]. Only
	  these files need knowledge about how to create/update/...
	  the sub-dialogs, so the corresp. functions are defined in
	  lc_dialogP.h.
	- The popup menus are now created by menus.c. The command
	  callbacks are defined in [layers|channels|paths]_dialog.h.
	- Private functions to be used by "friend files" are defined in
	  [layers|paths]_dialogP.h.
	- Changed the order of the ops_buttons in the paths dialog to
	  match the order in the layers and channels dialogs.
	- The paint mode menu and preview stuff still needs to go out of
	  layers_dialog.[ch].
	- I'm not sure about the keybindings in the layer dialog's "Stack"
	  submenu because the list widget has it's own idea of PageUp/Down.
	- Hopefully fixed the update problem with new images by calling
	  lc_dialog_flush() after creating a new image.

	* app/app_procs.c
	* app/bezier_select.c
	* app/commands.c
	* app/floating_sel.c
	* app/gdisplay.c
	* app/gimage.c
	* app/gimage_mask.c
	* app/paint_core.c
	* app/preferences_dialog.c
	* app/transform_core.c
	* app/undo.c: changed #include's according to the new L&C file
	structure.
1999-06-06 17:26:51 +00:00
BST 1999 Andy Thomas
343de341e3 app/bezier_select.c app/paths_dialog.c
Sun Jun  6 14:19:08 BST 1999 Andy Thomas <alt@gimp.org>

	* app/bezier_select.c
	* app/paths_dialog.c

	Applied bezier/paths patches supplied by David LE CORFEC.
	These fix a couple of segv. problems.
1999-06-06 13:24:26 +00:00
Manish Singh
dfd9d1cc70 i18n patch from gimp-monniaux-050699-1
-Yosh
1999-06-05 23:41:45 +00:00
Manish Singh
db54371de7 version number bump to 1.1.6
* configure.in: version number bump to 1.1.6

* added unsharp plug-in

* app/indicator_area.c
* app/main.c
* app/menus.c
* app/paint_core.c: minor cleanups

* plug-ins/wmf/wmf.c: s/memmove/g_memmove/

* tools/pdbgen/lib.pl: formatting changes, still unfinished

-Yosh
1999-06-05 02:11:16 +00:00
Sven Neumann
e5bce5789e Improved the line draw preview a bit. Still needs some work.
Prototyped all functions.


--Sven
1999-06-03 15:02:48 +00:00
Michael Natterer
763ae68641 app/info_dialog.c app/rotate_tool.c fixed some very strange grid redraw
1999-05-31  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/info_dialog.c
	* app/rotate_tool.c
	* app/scale_tool.c: fixed some very strange grid redraw bugs which
	were caused by unblocked sizeentry signals. It's generally a bad
	idea to connect to a sizeentry's signal before initialization.
	Removed the workaround for the gdk assert failures about
	"gc != NULL" because the signals were the real reason.

	* app/transform_core.c: originally wanted to fix the bug here but
	ended up with just some function headers made ansii compliant.
1999-05-31 21:46:43 +00:00
Michael Natterer
4a13995205 app/commands.c app/crop.c app/file_new_dialog.c app/info_dialog.[ch]
1999-05-31  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/commands.c
	* app/crop.c
	* app/file_new_dialog.c
	* app/info_dialog.[ch]
	* app/interface.c
	* app/layers_dialog.c
	* app/resize.[ch]
	* app/rotate_tool.c
	* app/scale_tool.c
	* app/shear_tool.c: finished the float->double migration for
	resolution values. Standardized the order of function calls which
	initialize sizeentries. Fixed some off-by-one errors by using
	correct double->int casting. Use the g* counterparts of int and
	double in some places. Various code cleanups.

	* app/preferences_dialog.c: same changes as above plus a cleaner
	implementation of the mem_size_unit stuff. The whole dialog should
	behave like before.
1999-05-31 14:11:10 +00:00
Manish Singh
f2622e5420 configure.in removed tips files, AC_SUBST GIMP_PLUGINS and GIMP_MODULES so
* configure.in
* Makefile.am: removed tips files, AC_SUBST GIMP_PLUGINS and
GIMP_MODULES so you can easily skip those parts of the build

* acinclude.m4
* config.sub
* config.guess
* ltconfig
* ltmain.sh: libtool 1.3.2

* app/fileops.c: shuffle #includes to avoid warning about MIN and
MAX

[ The following is a big i18n patch from David Monniaux
  <david.monniaux@ens.fr> ]

* tips/gimp_conseils.fr.txt
* tips/gimp_tips.txt
* tips/Makefile.am
* configure.in: moved tips to separate dir

* po-plugins: new dir for plug-in translation files

* configure.in: add po-plugins dir and POTFILES processing

* app/boundary.c
* app/brightness_contrast.c
* app/by_color_select.c
* app/color_balance.c
* app/convert.c
* app/curves.c
* app/free_select.c
* app/gdisplay.c
* app/gimpimage.c
* app/gimpunit.c
* app/gradient.c
* app/gradient_select.c
* app/install.c
* app/session.c: various i18n tweaks

* app/tips_dialog.c: localize tips filename

* libgimp/gimpunit.c
* libgimp/gimpunitmenu.c: #include "config.h"

* plug-ins/CEL
* plug-ins/CML_explorer
* plug-ins/Lighting
* plug-ins/apply_lens
* plug-ins/autostretch_hsv
* plug-ins/blur
* plug-ins/bmp
* plug-ins/borderaverage
* plug-ins/bumpmap
* plug-ins/bz2
* plug-ins/checkerboard
* plug-ins/colorify
* plug-ins/compose
* plug-ins/convmatrix
* plug-ins/cubism
* plug-ins/depthmerge
* plug-ins/destripe
* plug-ins/gif
* plug-ins/gifload
* plug-ins/jpeg
* plug-ins/mail
* plug-ins/oilify
* plug-ins/png
* plug-ins/print
* plug-ins/ps
* plug-ins/xbm
* plug-ins/xpm
* plug-ins/xwd: plug-in i18n stuff

-Yosh
1999-05-29 16:35:47 +00:00
Tor Lillqvist
4e886ad428 Check for mmap.
* configure.in: Check for mmap.

	* app/makefile.msc: Depend on gimpi.lib.

	* app/app_procs.c (app_init): Fix gccism: Allocate filenames (an
 	array with non-constant size) dynamically.

	* app/{datafiles,fileops,general,install,module_db,temp_buf}.c:
 	Include glib.h before standard headers, because of certain obscure
 	details related to compiling with gcc on Win32.

	(If you really want to know: glib.h defines he names of POSIXish
	(but non-ANSI) functions as prefixed with underscore, because
 	that's how they are named in the msvcrt runtime C library we want
 	to use. However, defining stat as _stat causes some problems if
 	done after including the mingw32 <sys/stat.h>. So, it's easiest to
 	include <glib.h> early.)

	* app/main.c: Use _stdcall and __argc, __argv with MSC, but
 	__attribute__((stdcall)) and _argc, _argv with gcc. Don't print
 	the "Passed serialization test" message on Win32. (It would open
 	up an otherwise unnecessary console window.)

	* app/paint_funcs.c (gaussian_blur_region): Don't use variable sum
 	until initialized.

	* app/{bezier_select,paths_dialog}.c: Include config.h and define
 	rint() if necessary.

	* app/plug_in.c: Use _spawnv, not spawnv, on Win32 and OS/2.
1999-05-28 17:47:17 +00:00
BST 1999 Andy Thomas
4fb6b4981d app/transform_core.c
Thu May 27 22:00:58 BST 1999 Andy Thomas <alt@gimp.org>

	* app/transform_core.c

	Bezier curve display during transformation works
	with corrective type of transform.
1999-05-27 21:09:02 +00:00
jaycox
4faeeaeb9f new mouse cursor for intersection operations.
* cursors/{mouse1_u,mouse1_umsk}: new mouse cursor for intersection
	operations.

	* app/cursorutil.[ch], app/rect_select.c: use the new cursor.

	* app/gimpimage.c:  Applied layer removal bug fix from
	David Le Corfec, <lecorfec@etudiant.univ-mlv.fr>

	* plug-ins/gdyntext/{font_selection.c, gdyntext.c, gdyntext_ui.c}:
	replaced snprintf with g_snprintf.

	* plug-ins/jpeg/jpeg.c: updated to work with the double precision
	resolutions.
1999-05-27 09:10:10 +00:00
BST 1999 Andy Thomas
8fb9f79459 app/bezier_select.c app/bezier_selectP.h app/paths_dialog.c
Wed May 26 21:14:15 BST 1999 Andy Thomas <alt@gimp.org>

	* app/bezier_select.c
	* app/bezier_selectP.h
	* app/paths_dialog.c
	* app/rotate_tool.c
	* app/scale_tool.c
	* app/transform_core.c
	* app/transform_core.h
	* app/transform_tool.c
	* app/transform_tool.h

	Add option to show currently selected path to be displayed
	during the transform tool operations. (Note if > 1 path locked
	only the last selected path will be shown).

	Reduced flashing of control points during update drawing of paths.

	Fixed problem in transform tool rotate/scale when changing
	layer (used to get many gdk assert failures about "gc != NULL")
1999-05-26 20:36:33 +00:00
Michael Natterer
dcfb450b25 app/[all files with resolution info] libgimp/gimp.h libgimp/gimpimage.c
1999-05-22  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/[all files with resolution info]
	* libgimp/gimp.h
	* libgimp/gimpimage.c
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimpunit.[ch]
	* plug-ins/newsprint/newsprint.c
	* plug-ins/pgn/png.c
	* plug-ins/tiff/tiff.c: double instead of float for all resolution
	and unit-factor variables.

	* app/commands.c
	* app/crop.c
	* app/interface.c
	* app/layers_dialog.c
	* app/move_tool.c
	* app/resize.c
	* app/rotate_tool.c
	* app/scale_tool.c: pass the image's unit *and* gdisp->dot_for_dot
	to all functions which create sizeentries. Never create a
	sizeentry with UNIT_PIXEL but with the image's unit and set it's
	unit to UNIT_PIXEL after creation if dot_for_dot is on.
	This way the image's unit can always be picked from the menu
	without selecting "More...".

	* app/interface.c: made the query_*_box() functions use the
	ActionArea.

	* plug-ins/gimpunitmenu.c: GTK_WIN_POS_MOUSE for the unit
	selection dialog.
1999-05-22 17:56:35 +00:00
Austin Donnelly
8218179aa6 Thu May 20 16:38:05 BST 1999 Austin Donnelly <austin@gimp.org
* app/curves.c: colour in the previously greyscale bars to the
	    left and below the curve itself.  Might want to take alpha and
	    value into account, but currently we don't.  Incidentally
	    fixes a few redraw problems I found along the way.  Done in
	    about an hour and a half, to show Wavey Dave what's possible :)
1999-05-20 15:43:56 +00:00
Michael Natterer
e494bbd557 store resolution values as doubles, not floats.
1999-05-18  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/app_procs.c (and many of the files below): store resolution
	values as doubles, not floats.

	* app/brush_select.c
	* app/pattern_select.c: hide the "refresh" button in client
	dialogs. Don't know if this is desired but it fixes a SEGV.

	* app/file_new_dialog.c: New ui using code/ideas from Austin,
	Marco and Nick. The "size" frame is still a bit bloated but I
	didn't want to reduce it's functionality right now. It's closer to
	the result of the last discussion but not perfect yet...
	Added a dialog to confirm image sizes larger than the new
	max_new_image_size value.
	The new "reset" button uses the values from gimprc.
	Removed some #include's, added the copyright header.

	* app/gimprc.[ch]: new rc variable max_new_image_size.

	* app/preferences_dialog.c: added the "max image size"
	option. Generalized the mem size unit code.

	* app/resize.c: an additional box lets the offset widget always
	shrink correctly.

	* app/text_tool.c: fixed a minor memory leak.

	* libgimp/Makefile.am: add all widgets to libgimpui.*

	* libgimp/gimpfileselection.c: cosmetic changes.

	* libgimp/gimplimits.h: a maximum image size which should satisfy
	everybody ;)

	* libgimp/gimpsizeentry.c: allow the creation of sizeentries
	without fields. This (finally) enables arbitrary layout of the
	spinbuttons.

	* plug-ins/script-fu/script-fu-scripts.c: use the fileselection
	widget for script parameter SF_FILENAME.
1999-05-18 17:33:39 +00:00
scott
62c1e2123e Fixed a potential linked list race condition (i.e. accessing freed memory)
* app/crop.c (crop_image): Fixed a potential linked list race
condition (i.e. accessing freed memory) when cropping deletes a
layer.  May fix a bug reported by Sven.

-sg
1999-05-15 21:07:01 +00:00
Sven Neumann
9c4e6f4aca Special case the clone tool.
--Sven
1999-05-15 12:13:43 +00:00
Sven Neumann
aa9621e082 Quick fix...
--Sven
1999-05-15 01:17:59 +00:00
Sven Neumann
114718ab36 Much better now....
--Sven
1999-05-15 00:36:42 +00:00
Sven Neumann
5f464b9f5d Show what line you are drawing when using <Shift> on paint-tools.
Needs some work for the clone-tool, since it seems to behave different then
the rest...


--Sven
1999-05-15 00:02:47 +00:00
jaycox
5dd060bd56 use the new color picking feature of paint_core.
* app/pencil.c: use the new color picking feature of paint_core.

* ChangeLog: added the entry that goes with my previous commit *DOH*
1999-05-14 00:37:58 +00:00
BST 1999 Andy Thomas
df68aba3a7 Changed:- app/bezier_select.c app/bezier_selectP.h app/cursorutil.c
Thu May 13 22:41:26 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-
	* app/bezier_select.c
	* app/bezier_selectP.h
	* app/cursorutil.c
	* app/cursorutil.h
	* app/curves.c
	* app/paths_dialog.c

	New:-
	* cursor/mouse1_ap
	* cursor/mouse1_apmsk
	* cursor/mouse1_cp
	* cursor/mouse1_cpmsk
	* cursor/mouse1_mm
	* cursor/mouse1_mmmsk
	* cursor/mouse1_sel
	* cursor/mouse1_selm
	* cursor/mouse1_selmmsk
	* cursor/mouse1_selmsk
	* cursor/mouse1_selp
	* cursor/mouse1_selpmsk

	Paths changes:-
	Implemented multi-part paths.
	(Import the path (RMB in paths dialog brings menu up)
	http://www.picnic.demon.co.uk/tmp/gimp.path
	into a 600x256 (WxH) for an example).

	Can copy/paste paths.
	Fully custom cursors when using the Bezier tool. A number of bug
	fixes re boundary problems also fixed.

	Note that heavy use is made of the modifier keys in the bezier tool.
	MB1 inside a closed curve converts it to a selection. The modifiers
	change how the selection interacts with any current selection (in
	much the same way as the selection tool does).

	MB1 + ALT on control point will move a curve, if shift modifier active
	then single curve is moved.


	Curves:-

	In curves dialog you can now press MB1 + shift will add point to
	curves dialog corresponding to the current position in
	the currently selected channel. MB1 + CNTRL will add the point
	to all channels. (Thanks to Carey Bunks for the initial idea).
1999-05-13 22:53:40 +00:00
jaycox
628e07eb47 set the fg or bg color if ctrl or alt is held. use the new dropper cursor.
* app/paint_core.[ch]: set the fg or bg color if ctrl or alt is
 	held.  use the new dropper cursor.

	* app/cursorutil.[ch], app/gdisplay.[ch], app/rect_select.c: Use
 	GimpCursorType enum values > GDK_CURSOR_LAST instead of seperate
 	functions to choose between cursor types.

	* app/color_picker.c: use the new dropper cursor.

	* app/paintbrush.c, app/airbrush.c, app/paintbrush.c: use the new
 	color picking feature of paint_core.

	* cursors/dropper, cursors/droppermsk: new cursor for the color
 	picker tool. (this cursor is REALLY ugly, someone should fix it)
1999-05-13 11:12:32 +00:00
Michael Natterer
83a34c3cb7 made the font selection dialog static again, so the selected font is
1999-05-09  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/text_tool.c: made the font selection dialog static again, so
	the selected font is remembered across text tool invocations.
1999-05-09 17:39:07 +00:00
Michael Natterer
5711df6a9d libgimp/Makefile.am new file. Currently contains constants for image size
1999-05-09  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* libgimp/Makefile.am
	* libgimp/gimplimits.h: new file. Currently contains constants for
	image size and resolution.

	* app/file_new_dialog.c
	* app/resize.c: use the new constants.

	* app/layers_dialog.c: use a sizeentry in the "New Layer" query
	box. Folded the "Layer Fill Type" callbacks into one function.

	* app/text_tool.c
	* app/text_tool_cmds.c
	* tools/pdbgen/pdb/text_tool.pdb: did the calculations for
	resolutions < 1.0 right this time.

	* app/gimage_cmds.c
	* tool/pdbgen/pdb/gimage.pdb: fixed a typo.
1999-05-09 16:38:05 +00:00
Michael Natterer
c0b24ce90b app/channel.[ch] app/commands.c app/gimage_mask.[ch]
1999-05-07  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/channel.[ch]
	* app/commands.c
	* app/gimage_mask.[ch]
	* app/gimage_mask_cmds.c
	* tools/pdbgen/pdb/gimage_mask.pdb
	* app/interface.c: propagated the indepentent x/y values for
	shrink/grow/border to the interface but not yet to the PDB.

	* app/*_select.c
	* app/paint_funcs.[ch]: implemented indep. x/y feather. It seems
	that cut-and-paste was sufficient, but I didn't really understand
	the code. Jay, could you have a look at this please?

	If the feather/shrink/... amount is specified in pixels,
	everything behaves like before.
	I'm not sure how the built-in feather option of the selection
	tools should behave, so it still defaults to 'pixel' mode.
	Moved the static feather/shrink/... values from gimage_mask.c to
	commands.c because they belong to the interface.

	* app/text_tool_cmds.c
	* tools/pdbgen/pdb/text_tool.pdb: prepared for resolution
	support, but didn't enable it yet.

	* app/unit_cmds.c
	* tool/pdbgen/pdb/unit.pdb: fixed a help text.
1999-05-06 23:10:29 +00:00
jaycox
18835a7657 new bitmap files containing the new mouse cursors.
* pixmaps/mouse1*: new bitmap files containing the new mouse cursors.

	* app/parasitelist.c: use g_str_equal instead of parasite_compare_func.

	* app/paint_core.c: interpret perfectmouse right way round.

	* app/rect_select{P,}.[ch]: set custom cursors when the operation type
 	changes.  Centralize the calculation of op based on the modifier
 	keys being held.

	* app/fuzzy_select.c, app/free_select.c: allow the rect_select
 	functions calculate the operation type.

	* app/ellipse_select.c: use the SelectionOps typedefs.

	* app/edit_selection.c: convert MaskToLayerTranslate into
 	FloatingSelTranslate if there is already a floating selection in
 	init_edit_selection.

	* app/disp_callbacks.c: fixed the calculation of state.

	* app/gdisplay.[ch], app/cursorutil.[ch]: new functions to allow
 	the loading of customized cursors.

	* app/paint_funcs.[ch], app/channel.c: border_region now accepts
 	seperate xradius and yradius arguments.
1999-05-05 09:10:35 +00:00
Manish Singh
28c906aa4b s@gdkprivate@gdk/gdkprivate@
-Yosh
1999-05-04 22:18:13 +00:00
Tor Lillqvist
1dea4958bb Win32 portability changes:
* config.h.win32, README.win32: Small changes.

	* tools/pdbgen/pdb/*.pdb: Include <string.h>.

	* app/*_cmds.c: Autogenerated files reflect above changes.

	* libgimp/makefile.msc app/makefile.msc: Various updates,
 	including new object files. Gtk+ directory now should be called
 	gtk+ (not gtk-plus). Use win32-specific gdk subdir. Glib directory
 	now should be called just glib.

	* libgimp/gimp.def: Updates.

	* libgimp/gimpfeatures.h.win32: Made current with
 	gimpfeatures.h.in.

	* libgimp/gimpfileselection.c: Define S_ISDIR and S_ISREG if
 	necessary.

	* tools/pdbgen/pdb/fileops.pdb: Must have a
 	statement (even an empty one) after a label.

	* app/fileops_cmds.c: Autogenerated file reflects above changes.

	* app/crop.c: Include <string.h>.

	* app/{app_procs,batch,fileops,datafiles,errorconsole,general,
 	plug_in,temp_buf,tile_swap}.c: Test NATIVE_WIN32, not
 	_MSC_VER. (NATIVE_WIN32 means we are using the Microsoft C
 	runtime, even if we might be compiling with gcc.)

	* app/fileops.c: Don't include <process.h> here.

	* app/fileops.h: Do include <process.h> here.

	* app/gimpparasite.c: Include config.h, guard inclusion of
 	<unistd.h>. (Is the inclusion of unistd.h in source files all over
 	the place really necessary?)

	* app/ink.c: MSC doesn't handle conversion from unsigned __int64
 	to double, so cast to signed.

	* app/lut_funcs.c: Include config.h, and define rint() if necessary.

	* app/pixel_processor.c: Include config.h without "..", like in
 	all the other places. Include <string.h>

	* app/text_tool.c: Guard the "POINTS" identifier that clashes with
 	<windows.h>, sigh.
1999-05-04 21:32:17 +00:00
Michael Natterer
e7c8de57ae call gdisplays_resize_cursor_label(gimage) after changing the image's
1999-05-02  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/commands.c: call gdisplays_resize_cursor_label(gimage)
	after changing the image's unit.

	* app/gdisplay.c: update the cursor label after resizing it's
	frame, so the old (wrong) value gets overwritten.

	* app/resize.c: it makes more sense to take the image's unit from
	the "print size" frame rather than from "pixel dimensions".
	Set reasonable boundaries to avoid over/underflows with crazy
	resolutions. Code and gui cleanup.
	The constants for min/max image size/resolution should probably go
	to a central place.

	* app/text_tool.c: set the resolution in the X font spec only if
	the size is specified in points (reported by Austin).

	* libgimp/gimpsizeentry.c: fixed a bad bug in the boundary and
	resolution setting code (was not noticable before the new
	resize/scale ui).

	* plug-ins/gdyntext/*: version 1.4.3

	* plug-ins/png/png.c: gcc suggested parentheses.
1999-05-04 17:20:05 +00:00
BST 1999 Austin Donnelly
e789291fa5 app/brush_select.c app/brush_select.h app/pattern_select.c delay the popup
Sat May  1 22:18:55 BST 1999  Austin Donnelly  <austin@gimp.org>

	* app/brush_select.c
	* app/brush_select.h
	* app/pattern_select.c
	* app/pattern_select.h: delay the popup of pattern and brush
 	    preview window by 150 millisecs.  Allows flicker-free
 	    selection of brushes/patterns, and still have fast pattern
 	    preview like we used to.  Ideally, should really factor out
 	    the common code in these two files into one generic picker
 	    widget.

	* app/free_select.c: cosmetic whitespace change.

	* app/draw_core.c: use GDK_CAP_NOT_LAST, not GDK_CAP_BUTT,
 	    otherwise sequential line segments in XOR mode have
 	    single-pixel gaps between them.  Worse, if the segments are
 	    only one pixel long, you don't get _any_ lines.  XFree86 seems
 	    to ignore GDK_CAP_BUTT, which is why this bug hasn't been seen
 	    before.  NCD X servers comply with the spec a little more
 	    pedantically, so need GDK_CAP_NOT_LAST.  OS/2 and Win32 people
 	    should check that (eg) the lasso tool still provides proper
 	    visual feedback.
1999-05-01 21:37:34 +00:00
Manish Singh
8b11c6c1fc listed tools first in SUBDIRS, so xgettext can grab the autogenned files
* Makefile.am: listed tools first in SUBDIRS, so xgettext can grab
the autogenned files

* acconfig.h: removed unused HAVE_XSHM_H

* tools/pdbgen/app.pl: added proc invoke method, nicer header
formatting

* tools/pdbgen/pdb/layer.pdb: use layer_mask type for return value
for layer_create_mask

* tools/pdbgen/pdb/misc.pdb: added quit proc

* tools/pdbgen/pdb/tools.pdb: added ink proc, but not added to @procs
since it's incomplete

* tools/pdbgen/pdb/fileops.pdb: new file

* app/Makefile.am: added fileops_cmds.c

* app/app_procs.c
* app/fileops.c
* app/ink.c: removed PDB procs (the one in ink.c was incomplete)

* app/fileops.h: exported load_procs, save_procs, and file_proc_find()

* app/plug_in.h: exported enum, #include <sys/types.h>

* app/brushes_cmds.c
* app/fileops_cmds.c
* app/layer_cmds.c
* app/misc_cmds.c
* app/parasite_cmds.c
* app/patterns_cmds.c
* app/procedural_db_cmds.c
* app/text_tool_cmds.c
* app/internal_procs.c: pdbgen updates

* app/paint_funcs.c: the glibc 2.1 docs say using SVID threadsafe
random functions are preferable to rand_r, so use them instead of
a mutex

-Yosh
1999-04-30 21:11:27 +00:00
Michael Natterer
f2681a95d1 fixed a cut-and-paste bug: vertical flip iterates over rows, not columns.
1999-04-30  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/flip_tool.c: fixed a cut-and-paste bug: vertical flip
	iterates over rows, not columns.
1999-04-29 22:54:09 +00:00
Sven Neumann
2ec50a9d93 Some code cleanup, changes to the crop-modifier_key_func and 128n fixes.
--Sven
1999-04-28 18:58:01 +00:00
Sven Neumann
d342563d60 Moved from toggle_key_func to modifier_key_func.
--Sven
1999-04-27 21:06:00 +00:00
Sven Neumann
8b46a4f9f5 Toggable tools!
I hope I haven't broken too much ;-)


--Sven
1999-04-27 02:09:03 +00:00
Michael Natterer
84e028ae76 added resolution support if the tool is used from the interface. Can't do
1999-04-25  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/text_tool.c: added resolution support if the tool is used
	from the interface. Can't do this for the PDB because the text has
	to be rendered in the size "text_get_extents" (which currently has
	no access to resolution information) returns.
1999-04-25 15:53:30 +00:00
BST 1999 Adam D. Moss
e247b49e5f Finished the opaque-move stuff... hopefully. Float and selection-mask
Sat Apr 24 21:50:58 BST 1999 Adam D. Moss <adam@gimp.org>

	* app/edit_selection.c: Finished the opaque-move stuff...
	hopefully.  Float and selection-mask movement behaviour
	repaired, etc.
1999-04-24 20:58:55 +00:00
Michael Natterer
f2546516fe added a "BG Color Fill" radio button. Toggling FG/BG with <shift> works in
1999-04-24  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/bucket_fill.c: added a "BG Color Fill" radio button.
	Toggling FG/BG with <shift> works in both color fill modes now.

	* app/brush_select.c: session management sets the size of the
	dialog again (depending on the current paint options mode because
	bad things happen if the brush preview's size is reduced beyond
	it's minimum).
1999-04-23 23:28:49 +00:00
jaycox
d996031ab0 removed some nonfunctional code.
* app/edit_selection.c: removed some nonfunctional code.

	* app/paint_core.c: remove the alt toggles perfectmouse behaviour.

	* app/paintbrush.c: when ctl (or alt) is held set the fg (or bg) color.

	* app/gimpparasite.[ch]: made char *name parameters const.

	* app/parasitelist.c: removed unused static variable.

	* app/gimpdrawable.c, app/gimpimage.c, app/undo.[ch]: added
 	support for undoing parasite changes.

	* libgimp/gimp.h, libgimp/gimpimage.c: added
 	gimp_undo_push_group_start and gimp_undo_push_group_end

	* libgimp/parasite.[ch]: added undoable flag.

	* plug-ins/gdyntext/font_selection.c: fixed c++ style comment.

	* plug-ins/gdyntext/gdyntext.c: use the new undoable parasites.

	* plug-ins/rcm/rcm_misc.c: arctg can't be inline because it is
 	used in other .c files

	* plug-ins/waterselect/waterselect.c,
	* plug-ins/rotators/rotators.c, app/tips_dialog.c, app/plug_in.c:
 	fixed some warnings
1999-04-23 06:07:09 +00:00
Sven Neumann
174e1a0fab Small buglet fixed in the autocrop algorithm.
--Sven
1999-04-22 23:34:58 +00:00
Michael Natterer
ca2cbd3257 First version of per-tool paint options. No PDB interface yet. The tool
1999-04-22  Michael Natterer  <mitschel@cs.tu-berlin.de>

	First version of per-tool paint options. No PDB interface yet.
	The tool options dialog got rather big when in per-tool mode, so
	it will probably have to become a notebook.

	It's not yet 100% consistent. If switched off, everything should
	behave exactly like before.

	* app/Makefile.am
	* app/paint_options.h: new file

	* app/tool_options.c: PaintOptions gui. Maintain a list of all
	paint tools' ToolOptions to enable switching between global and
	per-tool paint options.

	* app/brush_select.[ch]: changed packing boxes, tables, ...
	The paint options in the brush selection can be hidden now.
	Moved create_paint_mode_menu() to paint_options.h and
	tool_options.c and renamed it to paint_mode_menu_new().

	* app/gimage_mask.c
	* app/gimpbrush.[ch]
	* app/gimpbrushlist.[ch]
	* app/paint_core.c: moved gimp_brush_[set|get]_spacing() from
	gimpbrushlist.[ch] to gimpbrush.[ch].
	Moved gimp_brush_[get|set]_[opacity|paint_mode]() to
	paint_options.h and tool_options.c and renamed them to
	paint_options_*_*().  They are "global paint options" now.

	* app/airbrush.c
	* app/blend.c
	* app/bucket_fill.c
	* app/clone.c
	* app/convolve.c
	* app/eraser.c
	* app/ink.c
	* app/paintbrush.c
	* app/pencil.c: all paint tools' options are derived from
	"PaintOptions" now. Opacity and paint mode are obtained through
	macros which take into account the current paint options mode.

	* app/buildmenu.h: #include <gtk/gtk.h>

	* app/color_picker.c
	* app/text_tool.c: changed spacings.

	* app/gimprc.[ch]: new gimprc option "global-paint-options"

	* app/preferences_dialog.c: Added a "Tool Options" page. Code
	cleanup. Some work on the convenience constructors test site.

	* app/tools.c: fixed "unused variable" warning.
1999-04-22 14:34:00 +00:00
Manish Singh
993089b8cb moved a bunch of PDB stuff here
* app/color_cmds.c: moved a bunch of PDB stuff here

* app/color_balance.[ch]: removed PDB proc, exported TransferMode
enum, ColorBalanceDialog, color_balance_create_lookup_tables, and
color_balance

* app/curves.[ch]: removed PDB procs, exported SMOOTH and GFREE
#defines, CurvesDialog, curves_lut_func and curves_calculate_curve

* app/desaturate.[ch]: removed PDB proc, exported desaturate

* app/equalize.[ch]: removed PDB proc, exported equalize

* app/histogram_tool.[ch]: removed PDB proc, exported HISTOGRAM_WIDTH
and HISTOGRAM_HEIGHT #defines, HistogramToolDialog,
histogram_tool_histogram_range

* app/hue_saturation.[ch]: removed PDB proc, exported HueRange enum,
HueSaturationDialog, hue_saturation_calculate_transfers,
hue_saturation

* app/invert.[ch]: remove PDB proc, export invert

* app/threshold.[ch]: remove PDB proc, export ThresholdDialog and
threshold_2

* internal_procs.c: changes for pdbgen

* app/gimprc.c: removed leftover declaration

* app/image_map.h: add #include "gimpdrawableF.h"

* app/lut_funcs.h: add ALPHA_LUT to ChannelLutType

-Yosh
1999-04-21 05:39:57 +00:00
Sven Neumann
1490712141 The autocrop algorithm is about 4 times faster now.
--Sven
1999-04-20 23:23:40 +00:00
BST 1999 Austin Donnelly
5026bd5015 add the new args to gimp-paintbrush PDB calls.
Tue Apr 20 23:38:26 BST 1999  Austin Donnelly  <austin@gimp.org>

	* app/bezier_select.c: add the new args to gimp-paintbrush PDB
	    calls.

	* app/blend.c
	* app/bucket_fill.c
	* app/invert.c: check return from procedural_db_run_proc() rather
	    than dereferencing NULL.

	* app/paintbrush.c: plumb the non-gui fade_out option into the
	    functions that actually do the work, rather than using
	    an uninitialised value.

	* app/procedural_db.c: better error messages on PDB typecheck fail
	    in procedural_db_run_proc.  Also now valid to
	    procedural_db_destroy_args() on a NULL pointer.
	* app/procedural_db.h: pdb_type_name() function added, plus
	    comment urging people to keep the enum and strings in step.

	* tools/pdbgen/README: added paragraph on how to run pdbgen.pl

	* tools/pdbgen/pdb/tools.pdb: fade_out parameter is valid to be 0
	* app/tools_cmds.c: new version of generated file
1999-04-20 23:03:31 +00:00
Sven Neumann
ff2c915a40 More cosmetic stuff. Getting used to the new tool_options ... ;-)
--Sven
1999-04-20 19:23:38 +00:00
Manish Singh
ccac10a4b0 new file, containes the PDB stuff for most of the tools
* app/tools_cmds.c: new file, containes the PDB stuff for most
of the tools

* app/gimprc_cmds.c: new file, PDB interface stuff for gimprc
access

* app/Makefile.am: added tools_cmds.c and gimprc_cmds.c

* app/airbrush.[ch]
* app/blend.[ch]
* app/bucket_fill.[ch]
* app/by_color_select.[ch]
* app/clone.[ch]
* app/color_picker.[ch]
* app/convolve.[ch]
* app/crop.[ch]
* app/ellipse_select.[ch]
* app/eraser.[ch]
* app/flip_tool.[ch]
* app/free_select.[ch]
* app/fuzzy_select.[ch]
* app/gimprc.[ch]
* app/paintbrush.[ch]
* app/pencil.[ch]
* app/perspective_tool.[ch]
* app/rect_select.c app/rect_select.h
* app/rotate_tool.[ch]
* app/scale_tool.[ch]
* app/shear_tool.[ch]: bye bye PDB stuff (exported necessary enums
functions, vars, etc.)

* app/internal_procs.c: use register_foo functions

* app/blend.[ch]: GradientType enum case changed

* app/bucket_fill.[ch]: s/FillMode/BucketFillMode/, made the enum
more consistent

* app/clone.[ch]: capitalized the CloneType enum

* app/color_picker.[ch]: changed get_color to pick_color so we don't
conflict with colormaps.c get_color

* app/convolve.[ch]: capitalized the ConvolveType enum

* app/paint_core.h: made a GradientPaintMode enum

* app/transform_core.h: BoundingBox enum

* app/scale_tool.c: use the generic bounding box enum for X1, Y1, etc.

* app/shear_tool.[ch]: turned HORZ and VERT into a ShearType enum

-Yosh
1999-04-18 21:22:41 +00:00
Michael Natterer
9e1879d964 fixed a sensitive setting bug I introduced with the last change.
1999-04-18  Michael Natterer  <mitschel@cs.tu-berlin.de>

        * app/paintbrush.c: fixed a sensitive setting bug I introduced
        with the last change.

        * app/text_tool.c: added a toggle button which enables calling
        gDynText.

        * app/tool_options.c: the toggle callback does some more sensitive
        settings.
1999-04-18 18:55:49 +00:00
Michael Natterer
2d54cc6406 app/bucket_fill.c app/clone.c app/convolve.c app/flip_tool.c app/ink.c
1999-04-18  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/bucket_fill.c
	* app/clone.c
	* app/convolve.c
	* app/flip_tool.c
	* app/ink.c
	* app/paintbrush.c
	* app/transform_tool.c: remember all radio buttons in the
	ToolOptions structures. This enables arbitrary default values and
	gui feedback for the "toggle key" feature.
1999-04-17 23:18:43 +00:00
BST 1999 Andy Thomas
8f187e241a Changed:-
Thu Apr 15 23:04:17 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/color_picker.c

	Must account for layer offsets.
1999-04-15 22:24:27 +00:00
BST 1999 Andy Thomas
3477483c06 Changed:-
Thu Apr 15 21:20:45 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/color_picker.c

	Added UI feedback to the tool when using the sample average
	option.
	Fixed the scale of the sample area to be integral (is this right?).
1999-04-15 20:52:36 +00:00
Sven Neumann
712b38cdd2 Small error fixed, renamed the tool.
--Sven
1999-04-15 10:20:27 +00:00
Sven Neumann
83bfd05c71 Ooops, put the crop.c into the wrong directory. Here it comes...
--Sven
1999-04-14 23:39:12 +00:00
BST 1999 Andy Thomas
d5fad959c1 Changed:-
Tue Apr 13 22:17:23 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/bezier_select.c
	* app/bezier_select.h
	* app/pathsP.h
	* app/paths_dialog.c
	* app/transform_core.c
	* app/transform_core.h
	* app/undo.c

	New:-

	* pixmap/locked.xpm

	New image. (Your welcome to improve upon it...)

	Paths can now be locked down for transformations. Click next to the
	paths preview and a icon will appear. This path will "locked" during
	transformations (via the transforms tool). Undo for these path
	transformations is also available.

	Fixed bug when creating a path for the first time when no paths dialog
	visible.
1999-04-13 21:50:28 +00:00
Manish Singh
4151b821c7 code cleanup
* app/boundary.c: code cleanup

* app/levels.c: applied gimp-lecorfec-990314-0, added spin buttons
to the levels dialog

* plug-ins/script-fu/scripts/font-map.scm: changes for updated
gimp_text interface
1999-04-13 04:59:07 +00:00
Sven Neumann
001b192215 Some more funky crop stuff.
--Sven
1999-04-12 21:53:41 +00:00
Michael Natterer
c79944a449 Checked in wrong version before. 1999-04-12 18:09:55 +00:00
Michael Natterer
8dbd5f9b65 app/airbrush.c app/bezier_select.c app/blend.c app/brightness_contrast.c
1999-04-12  Michael Natterer  <mitschel@cs.tu-berlin.de>

        * app/airbrush.c
        * app/bezier_select.c
        * app/blend.c
        * app/brightness_contrast.c
        * app/bucket_fill.c
        * app/by_color_select.c
        * app/clone.c
        * app/color_balance.c
        * app/color_picker.c
        * app/convolve.c
        * app/crop.c
        * app/curves.c
        * app/ellipse_select.c
        * app/eraser.c
        * app/flip_tool.c
        * app/free_select.c
        * app/fuzzy_select.c
        * app/histogram_tool.c
        * app/hue_saturation.c
        * app/ink.c
        * app/iscissors.c
        * app/levels.c
        * app/magnify.c
        * app/move.c
        * app/paintbrush.c
        * app/pencil.c
        * app/posterize.c
        * app/rect_select.[ch]
        * app/text_tool.c
        * app/threshold.c
        * app/transform_tool.c

        * app/tools.[ch]
        * app/toolsF.h: again: all tools :(

        * app/Makefile.am
        * app/tool_options.[ch]
        * app/selection_options.h
        * app/tool_options_ui.h: new files.

        Ok, this time it's general enough for future extensions:

        - The tool options structures are organized like the gtk object
          system to allow derived tool options.
        - Renamed all create and reset functions to *_options_new() and
          *_options_reset() to reflect this.
        - Changed tools_register() again. Now it takes just a pointer to a
          ToolOptions structure.
        - Moved almost the entire tool options gui code to tool_options.c.
        - Visually separated the common selection options from the
          tool-specific ones. I'd like to do the same with opacity/paint
          mode in all paint tool options but I think this needs some more
          discussion.

        * app/histogram_tool.c: changed packing boxes, label alignments.

        * app/paintbrush.c: some more sensitive settings. The gradient
        feature can now be toggled with a button. Hopefully didn't break
        anything.
1999-04-12 17:55:06 +00:00
Manish Singh
c881d7bf02 added a sample average feature (requested by Xach) that picks a color from
* app/color_picker.c: added a sample average feature (requested
by Xach) that picks a color from the average of all the pixels
from the source point within a given radius

-Yosh
1999-04-11 06:35:28 +00:00
BST 1999 Adam D. Moss
784ecce7bf Velocity-sensitivity added to ink tool.
Sat Apr 10 15:48:46 BST 1999 Adam D. Moss <adam@gimp.org>

        * app/ink.c: Velocity-sensitivity added to ink tool.
1999-04-10 14:55:17 +00:00
Manish Singh
d6116b8d2c new file (from pdbgen)
* text_tool_cmds.c: new file (from pdbgen)

* Makefile.am: add new file, use AM_CPPFLAGS instead of CPPFLAGS

* internal_procs.c: register pdbgened text_tool procs

* text_tool.c: remove PDB stuff, export text_render and
text_get_extents and SizeType and SUPERSAMPLE symbols

* text_tool.c: remove PDB stuff

* blend.[ch]
* bucket_fill.[ch]
* clone.[ch]
* convolve.[ch]: export some enums

* channel.h
* paint_core.h: #define->enum

* channel.c
* gimpparasite.c
* parasitelist.c
* pixel_processor.c: warning cleanup

* convert_cmds.c
* paths_cmds.c: slight pdbgen changes

-Yosh
1999-04-10 04:54:34 +00:00
jaycox
dde3603123 build color_cmds, lut_funcs, and pixel_processor feedback in the splash
* app/Makefile.am: build color_cmds, lut_funcs, and pixel_processor
	* app/app_procs.c: feedback in the splash screen when loading
 	parasites.
	* app/boundary.c: Optimized find_empty_segs.

	* app/brightness_contrast.[ch]
	* app/levels.[ch]
	* app/posterize.[ch]:
 	moved pdb and lut calculation code.  These files now contain only
	GUI functions.

	* app/channel.c: Optimized channel_bounds (fewer compares, better
 	use of registers).  Use color_region instead of channel_*_segment
 	in channel_combine_rect.  Optimized channel_combine_ellipse by
 	skipping pixels inside of the ellipse.  Use
 	pixel_region_process_parallel in channel_combine_mask.  Use a
 	GimpLut in channel_invert, and channel_sharpen.

	* app/invert.c
	* app/equalize.c: moved the lut functions to lut_funcs.c

	* app/gimpdrawable.c, app/gimpdrawableP.h
	* app/gimpimage.c, app/gimpimageP.h: removed unused gimpmatrix
	variables/includes.

	* app/gimplut.[ch]: added new function gimp_lut_process_inline
 	that operates on a single PixelRegion.

	* app/gimpparasite.[ch]: new functions to save/load parasiterc

	* app/parasitelist.[ch]: new functions to save/load ParasiteLists
 	in/from files.

	* libgimp/parasite.[ch]: new functions to load/save parasites.

	* app/internal_procs.c: get some procs from new location in
	color_cmds.h.

	* app/pixel_region.[ch]: moved pixel_regions_process_parallel
 	related functions to a new file.

	* app/color_cmds.[ch]: new files for PDB
 	definitions/implementations of color correction functions.

	* app/lut_funcs.[ch]: new files to hold lut creation functions.

	* app/pixel_processor.[ch]: new files that contain the
 	pixel_regions_process_parallel routines.  Added some new
 	capabilities that are currently unused.
1999-04-09 06:00:11 +00:00
Michael Natterer
f1b0a8835c app/airbrush.c app/bezier_select.c app/blend.c app/brightness_contrast.c
1999-04-08  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/airbrush.c
	* app/bezier_select.c
	* app/blend.c
	* app/brightness_contrast.c
	* app/bucket_fill.c
	* app/by_color_select.c
	* app/clone.c
	* app/color_balance.c
	* app/color_picker.c
	* app/convolve.c
	* app/crop.[ch]
	* app/curves.c
	* app/ellipse_select.c
	* app/eraser.c
	* app/flip_tool.c
	* app/free_select.c
	* app/fuzzy_select.c
	* app/histogram_tool.c
	* app/hue_saturation.c
	* app/ink.c
	* app/iscissors.c
	* app/levels.c
	* app/magnify.c
	* app/move.c
	* app/paintbrush.c
	* app/pencil.c
	* app/posterize.c
	* app/rect_select.[ch]
	* app/text_tool.[ch]
	* app/threshold.c
	* app/transform_tool.c

	* app/tools.[ch]
	* app/toolsF.h: in other words: all tools

	Implemented the "reset tool options" feature.
	- All tools register with a title string and a reset function now.
	- The tool options' variables have two related <var>_d (default)
	  and <var>_w (widget) variables to restore the default values.

	"Standardized" the tool options UI:
	- Put the stuff info a frame to give a hint that the dialog's
	  contents will change.
	- table layout, sensitive setting, spacings, borders, ...

	As I had them all in my emacs simultaneously, I couldn't resist to
	standardize the tools' *.c files declaration parts ;) Ansi stuff.
1999-04-08 22:25:54 +00:00
Sven Neumann
4dca1d5640 Total crop-tool massacre.
--Sven
1999-04-08 05:20:37 +00:00
BST 1999 Andy Thomas
9a4edab746 Changed:-
Wed Apr  7 23:53:22 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/curves.c

	Just noticed a bug that has been around for ages. The preview
	update does not work in the curves dialog when free curve
	mode is selected. Fixed it.
1999-04-07 22:58:44 +00:00
BST 1999 Andy Thomas
4bdf25daf2 Changed:-
Wed Apr  7 22:44:02 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/curves.c
	* app/image_map.c
	* app/image_map.h

	Curves dialog now has "interactive feedback". Press and drag the
	mouse button in the image window and a marker will appear in the
	curves dialog showing the channel value at that point.
1999-04-07 22:02:26 +00:00
Sven Neumann
393b1fd545 When using fixed_size selections create the
selection into the direction the user moved the mouse.


--Sven
1999-04-06 22:53:10 +00:00
Michael Natterer
d499a819fd oops, didn't commit this one.
1999-04-06  Michael Natterer  <mitschel@cs.tu-berlin.de>

        * app/rect_select.h: oops, didn't commit this one.
1999-04-06 12:51:57 +00:00
Michael Natterer
16e7aadaf3 app/gimpunit.c libgimp/gimpunit.[ch] libgimp/gimpunitmenu.c enabled
1999-04-06  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/gimpunit.c
	* libgimp/gimpunit.[ch]
	* libgimp/gimpunitmenu.c
	* libgimp/gimpsizeentry.[ch]: enabled "percent" pseudo-unit.
	New function gimp_size_entry_set_size() to set the values which
	will be treated as 0% and 100%.

	* app/crop.c
	* app/rotate_tool.c
	* app/scale_tool.c: enable "percent".

	* app/rect_select.c fixed size selections can be made in units and
	percent now, table layout, label adjustment.
1999-04-06 12:13:54 +00:00
BST 1999 Andy Thomas
67dbf49bf2 Changed:-
Mon Apr  5 22:24:30 BST 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/bezier_select.c
	* app/bezier_selectP.h
	* app/paths_cmds.c
	* app/pathsP.h
	* app/paths_dialog.c
	* app/xcf.c
	* tools/pdbgen/pdb/paths.pdb

	New PDB functions.
	  gimp_path_get_point_at_dist (gets the x,y of a point a given distance
	                          along the curve & the normal at the point).
	  gimp_path_get_tattoo
	  gimp_get_path_by_tattoo


       	Paths now have tattoos (similar to the layer and image tattoos).

	* app/move.c
	* app/scroll.c

	Try to fix the problem where mouse events from the rulers get
	mixed up with those from the canvas causing guides & image dragging
	to "jump" around when the mouse enters the ruler areas.
1999-04-05 23:33:50 +00:00
Sven Neumann
7f74800d26 Stupid Raph!
--Sven
1999-04-05 22:01:07 +00:00
Michael Natterer
24ffa60f1b #include <gtk/gtk.h>.
1999-04-05  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/action_area.h: #include <gtk/gtk.h>.

	* app/devices.c: made the "Input Devices" dialog follow the action
	area conventions. Grab pointer in the pattern/brush preview popups.

	* app/errorconsole.c: use the actionarea functions.

	* app/gimpunit.c: had the wrong copyright header.

	* app/info_dialog.c: correctly set the spinbuttons' digits.

	* app/perspectice_tool.c: removed #include <stdio.h> again but
	didn't forget to s/sprintf/g_snprintf/ this time.

	* app/preferences_dialog.c: unified order of varible definitions,
	removed some unused variables.

	* app/crop.c
	* app/file_new_dialog.c
	* app/info_dialog.[ch]
	* app/interface.c
	* app/preferences_dialog.c
	* app/rotate_tool.c
	* app/scale_tool.c
	* libgimp/gimpsizeentry.[ch]
	* libgimp/gimpunitmenu.[ch]: prepared for "percent" in size
	entries.
1999-04-05 12:48:48 +00:00
Manish Singh
395cdc5b53 #include <gtk/gtk.h>
* tools.h: #include <gtk/gtk.h>

* toolsF.h: #include <gdk/gdk.h>

* perspective_tool.c: #include <stdio.h>

* gimphistogram.c: #ifdefed a var for threads

* gimpimage.h: added chop hint to GimpImageType enum

* paint_funcs.h: made layer mode #defines an enum

* palette.c
* gimpunit.c: removed PDB stuff

* gimpunit_cmds.h: removed

* convert_cmds.c
* paths_cmds.c: pdbgen updates

* palette_cmds.c
* unit_cmds.c: new files

* app/internal_procs.c: use the pdbgen register_foo functions

* app/Makefile.am: changes for the above

-Yosh
1999-04-04 07:12:22 +00:00
Asbjørn Pettersen
323fa245f0 don't use c++ comments 1999-04-03 18:46:11 +00:00
Michael Natterer
01c74039ec forgot this file. Should compile again now, sorry :(
1999-04-03  Michael Natterer  <mitschel@cs.tu-berlin.de>

        * app/shear_tool.c: forgot this file. Should compile again now,
        sorry :(
1999-04-02 22:27:05 +00:00
Michael Natterer
f70fc7d307 made function headers ansi compliant.
1999-04-02  Michael Natterer  <mitschel@cs.tu-berlin.de>

	* app/gimage_mask.[ch]: made function headers ansi compliant.

	* app/file_new_dialog.c
	* app/preferences_dialog.c: minor GUI and signal handling
	changes. Added a WM hint pixmap to the prefs dialog but commented
	it out because it looked ugly. If someone has a nice pixmap,
	please try it and tell me ;)

	* app/color_picker.c
	* app/crop.c
	* app/info_window.c
	* app/perspective_tool.c
	* app/rotate_tool.c
	* app/scale_tool.c
	* app/info_dialog.[ch]: the info_dialog allows scales, spinbuttons
	and sizeentries now. Made some dialogs use these widgets and
	added unit support. Sprinkled some g_snprintf's, removed
	#include's, ansi issues, ...

	* app/session.c: don't call a NULL callback.

	* libgimp/gimpsizeentry.[ch]: new function
	gimp_size_entry_add_field() which allows a more flexible GUI
	layout. More intelligent signal handling.
1999-04-02 19:46:59 +00:00
Adrian Likins
a129fc0d20 ooops, forgot to commit this. Just changed the order of some enums in
ooops, forgot to commit this. Just changed the order of some enums
in paint_core.c

-adrian
1999-03-28 08:34:47 +00:00
Manish Singh
5131a0111b #include <glib.h>
* app/procedural_db.h: #include <glib.h>

* app/channel_ops.[ch]: exported OFFSET_BACKGROUND and
OFFSET_TRANSPARENT as an enum

* app/convert.[ch]: exported MACNUMCOLORS, theCustomPalette,
convert_image, removed PDB procs

* app/text_tool.[ch]: exported PIXELS and POINTS as an enum

* app/convert_cmds.c
* app/edit_cmds.c
* app/floating_sel_cmds.c
* app/gdisplay_cmds.c
* app/paths_cmds.c
* app/undo_cmds.c: pdbgen autogenerated files now

* app/internal_procs.c: use the pdbgen register_foo functions

* app/edit_cmds.h
* app/floating_sel_cmds.h
* app/gdisplay_cmds.h
* app/paths_cmds.h
* app/undo_cmds.h: removed

* app/Makefile.am: reflect above changes

* Makefile.am: paths.xbm->path.xbm, fix typo in EXTRA_DIST

-Yosh
1999-03-28 06:55:29 +00:00
EST 1999 Adrian Likins
21b5cd4467 added the ability to select the gradient repeat mode from the gui. Made
Sun Mar 28 00:28:57 EST 1999 Adrian Likins <adrian@gimp.org>

        * app/paintbrush.c: added the ability to select the
        gradient repeat mode from the gui. Made the gradient
        length slider hopefully a bit more useful (ie, a
        more useful range)

-adrian
1999-03-28 05:27:34 +00:00
EST 1999 Adrian Likins
1436b4ef77 oops, forgot to make fade work again after the gradient stuff. Fixed.
Sun Mar 21 23:11:31 EST 1999  Adrian Likins <adrian@gimp.org>

        * app/paintbrush.c: oops, forgot to make fade work
        again after the gradient stuff. Fixed.

-adrian
1999-03-22 04:10:58 +00:00
Adam D. Moss
8b9d185c23 small fix 1999-03-21 16:58:44 +00:00
GMT 1999 Adam D. Moss
cc8d71c037 Happy-fun opaque layer moves.
Sun Mar 21 15:29:38 GMT 1999  Adam D. Moss  <adam@gimp.org>

	* app/disp_callbacks.c app/edit_selection.c app/move.c:
	Happy-fun opaque layer moves.

	* app/edit_selection.c: I doubt that using button3 to abort
	a layer move has worked for a long time.  I rewrote some
	stuff and moved the 'abort' button to button2.  Hold it down
	when you release button1, to abort the current move.  It
	doesn't actually abort, it just automatically does an undo.
1999-03-21 15:38:11 +00:00
Manish Singh
05c69f12b7 acinclude.m4 config.guess config.sub ltconfig upgrade to libtool 1.2f
* acinclude.m4
* config.guess
* config.sub
* ltconfig
* ltmain.sh: upgrade to libtool 1.2f

* autogen.sh: libtool is not required to autogen gtk+

* acconfig.h: remove WITH_SYMBOL_UNDERSCORE (not explictly needed)

* app/actionarea.h: made the label in ActionAreaItem const

* app/convert.[ch]: made FOO_PALETTE #defines into an enum

* libgimp/parasite.c
* app/brightness_contrast.c
* app/color_picker.c
* app/colormap_dialog.i.c
* app/curves.c
* app/equalize.c
* app/gimplut.c
* app/histogram_tool.c
* app/invert.c
* app/levels.c
* app/paint_funcs.c
* app/pixel_regions.c
* app/posterize.c
* app/rect_select.c
* app/threshold.c
* app/xcf.c: remove unused vars, other minor code cleanups

* app/procedural_db.h: #include <glib.h>

* Makefile.am: add README.perl to EXTRA_DIST

-Yosh
1999-03-20 04:41:59 +00:00
jaycox
ccfe47ad89 removed a c++ style comment
* app/ops_buttons.h: removed a c++ style comment

	* app/paint_funcs.c: applied Craig Wiegert's patch to fix
 	the rounding errors in the scaling code.

	* app/paint_funcs.c: Use a mutex lock in disolve pixels instead of
 	rand_r on linux systems since linux's rand_r appears to be broken.

	* app/bezier_select.c: applied Shuji Narazaki's patch that corrects
 	for layer offsets in bezier_stroke.
1999-03-19 03:19:18 +00:00
EST 1999 Adrian Likins
7e28ed4ce3 app/paintbrush.c app/paint_core.c moved all the code for figuring out the
Thu Mar 18 19:35:48 EST 1999  Adrian Likins <adrian@gimp.org>

        * app/paintbrush.c
        * app/paint_core.c
        * app/paint_core.h: moved all the code for figuring out the
        paint_core->distance to color stuff to paint_core.[ch]. Updated
        paintbrush.c to use the new function. Also now can either loop
        thorugh the gradient (sawtooth, start->end, start->end or
        triangle start->end,end->start). Also mode for going
        thought the gradient once, forwards or backwards. None of these
        options are available from the gui or the PDB yet though.

-adrian
1999-03-19 00:42:27 +00:00
EST 1999 Adrian Likins
15da4abaf2 paintbrush_motion, added the ability to paint with the colors from a
Tue Mar 16 23:39:26 EST 1999 Adrian Likins <adrian@gimp.org>

        * app/paintbrush.c: paintbrush_motion, added the ability
        to paint with the colors from a gradient. In
        create_paint_options, added a scale for the length
        of the gradient to paint. Also added a PDB call.

        *  app/paintbrush.h, internal_procs.c: exported
         gimp_paintbrush_extended_gradient to the PDB


-adrian
1999-03-17 05:40:16 +00:00
Michael Natterer
3faf83af86 Moved all pixmaps and bitmaps from app/ and libgimp/ to pixmaps/
1999-03-12  Michael Natterer  <mitschel@cs.tu-berlin.de>

        Moved all pixmaps and bitmaps from app/ and libgimp/ to pixmaps/

	* app/tools/*
	* libgimp/chain.xpm: removed these files

	* pixmaps/*.[xpm|xbm]: new directory containing all pixmaps

	* app/Makefile.am
	* libgimp/Makefile.am
	* Makefile.am: changed list of EXTRA_DIST files accordingly

	* app/channels_dialog.c
	* app/layers_dialog.c
	* app/paths_dialog.c
	* app/palette.c
	* libgimp/gimpchainbutton.c: adjusted some #include's
1999-03-12 22:43:12 +00:00
GMT 1999 Andy Thomas
7383354574 Changed:-
Fri Mar 12 21:30:57 GMT 1999 Andy Thomas <alt@gimp.org>

	Changed:-

	* app/bezier_select.c
	* app/paths_dialog.c

	Some code cleanups and bug fixes. Fixed problem with "copy" path
	producing very long names.

	Added functionality to import/export paths to files. (It was
	there before!)

	Also added some new bezier_stroke code that Shuji Narazaki posted
	to the gimp-devel list.

	* plug-ins/plugindetails/plugindetails.c

	Removed unwanted <regex.h>.
	Thanks to Tan Koan-Sin <freedom@csie.nctu.edu.tw> for pointing
	this out.
1999-03-12 22:04:30 +00:00
Manish Singh
a93f0a112b comment out Raph's saturation changes, didn't work in all cases
* app/hue_saturation.c: comment out Raph's saturation changes, didn't
work in all cases

-Yosh
1999-03-09 00:31:01 +00:00
Tor Lillqvist
951c92a602 Second batch of Win32 merge. 1999-03-07 12:56:03 +00:00
GMT 1999 Andy Thomas
2252863eb6 This is a bit of a biggy. Added paths to layers & channels dialog. This is
Fri Mar  5 21:45:39 GMT 1999 Andy Thomas <alt@picnic.demon.co.uk>

	This is a bit of a biggy. Added paths to layers & channels
	dialog. This is not complete yet (it still has some rough edges ;-)

	New:-

	* paths_dialog.c
	* paths_dialog.h
	* pathsP.h

	These are the core parts of the paths dialog & interaction.

	* tools/penadd.xpm
	* tools/pendel.xpm
	* tools/pennorm.xpm
	* tools/penedit.xpm
	* tools/penstroke.xpm

	New images found in the dialog. Maybe someone with a better
	artistic flair could replace these?

	Changed:-

	* Makefile.am

	Added new files for build

	* layers_dialog.c

	Added new tab for paths.

	* bezier_select.h
	* bezier_selectP.h
	* bezier_select.c

	Rearrangement & fixes. Not finished yet.

	* iscissors.c

	Header file changes. (Need to include more headers).

	* gdisplay.c
	* gdisplay.h

	Hmmm... Added a function that did a mapping from gimage to gdisp.
	This is a little bit of a "hack", but it was needed.. really.

	* ops_buttons.h
	* ops_buttons.c

	Enhanced to create more types of button ops. Used in the paths dialog.

	* channels_dialog.c

	Header file changes?

	* xcf.c

	Paths stored in new PROP. Yosh.. I did as you and Adam suggested.

	* gimpimage.c
	* gimpimage.h
	* gimpimageP.h

	Added paths items to the image structures.
1999-03-05 23:50:24 +00:00
Sven Neumann
77f4d4abec More unit/resolution stuff (most if it from Michael).
--Sven
1999-03-03 17:48:29 +00:00
jaycox
6ae2a9bc9f added gimphistogram*, histogramwidget*, removed histogram.[ch]
* app/Makefile.am: added gimphistogram*, histogramwidget*,
	removed histogram.[ch]

	* app/histogram.[ch]: removed.  replaced with histogramwidget.[ch].

	* app/{gimphistogramP.h, gimphistogram.h, gimphistogram.c}: new
 	functions that calculate histograms in parallel and perform
 	calculations on them.

	* app/histogramwidget.[ch]: Same as old histogram.[ch], only it is
 	now a real widget, and it uses GimpHistograms instead of arrays of
 	values.

	* app/curves.c: #include gimphistogram.h instead of histogram.h.

	* app/equalize.c: use GimpHistogram and GimpLut.

	* app/gimpbrush.c, app/gimpimage.c, app/gimpset.c: use
	GTK_RUN_FIRST in calls to gimp_signal_new.

	* app/histogram_tool.c, app/levels.c, app/threshold.c: modified to
 	use the new HistogramWidget.

	* app/paint_funcs.c: removed some unused variables.

	* app/preferences_dialog.c: only display the num-processor field
 	if we are configured --with-mp

	* plug-ins/gee/gee.c: removed a couple of c++ style comments.
1999-03-01 05:11:19 +00:00
Raph Levien
76164bb802 Made increasing saturation in hue-saturation more subtle. 1999-02-25 19:38:55 +00:00
CST 1999 Shawn T. Amundson
df051bd37f Add default to Cancel button, remove unset GTK_RECEIVES_DEFAULT from
Sat Feb 20 16:12:33 CST 1999 Shawn T. Amundson <amundson@gimp.org>

        * app/tips_dialog.c: Add default to Cancel button, remove
          unset GTK_RECEIVES_DEFAULT from prev/next buttons (they
          are like toolbar buttons), changed abreviated prev to
          previous, prev/next button are now same size, cancel button
          is in a button box.  Added vboxes where necessary to prevent
          prev/next and check button from filling vertically.

        * app/app_procs.c: when splashscreen dialog is larger than the
          logo, (due to huge font), center logo.

        * app/file_new_dialog.c: patch from Marco Lamb <lm@geocities.com>
          disallows resizing, changes vertical expanding of widgets to
          not occur

        * app/palette.c: patch from Marco Lamb <lm@geocities.com>.  Makes
          +/- buttons for zoom pixmaps (eventually, these can be replaced
          with a magnifying glass with a little +/- I think), so that they
          no longer expand as they did before.  I modified his patch so it
          did not create a misused toolbar.  I did some other stuff here too,
          moved Close button to the left, made it the window's default,
          and unset GTK_RECEIVES_DEFAULT off of the non-bottom buttons.

        * app/actionarea.c: another patch from Marco Lamb <lm@geocities.com>.
          This one changes buttons to be put in a button box which is right
          justified.  If we decide later that spread is better, we can
          change this easy enough.

        * app/tools/zoom_in.xpm, app/tools/zoom_out.xpm: + and - graphics.

        * libgimp/gimpunit.h
          libgimp/gimpunit.c: New files from Michael Natterer
          <mitschel@cs.tu-berlin.de>, gimp_unit_* routines.

        * app/gimage.h
          app/gimpimage.h
          app/gimpimage.c
          app/gimpimageP.h
          app/xcf.c: Patches from Michael Natterer <mitschel@cs.tu-berlin.de>,
          which keep a unit assocated with an image.
1999-02-21 02:08:15 +00:00
Tor Lillqvist
a27cedc001 First batch of changes to merge the Win32 version. This will be
done in pieces, don't expect to be able to compile on Win32 from
these sources yet.  Ans of course, the official version of GTk+
doesn't include the Win32 stuff yet.
1999-02-20 23:20:54 +00:00
Tor Lillqvist
51b6081bd1 Color balance lookup tables were wrong size (255, should be 256)! (Actually
we should use the new gimplut stuff here. Later.)
1999-02-17 23:41:57 +00:00
jaycox
a26f8d3f5c new source files that implement pixel Look Up Table functions.
* app/gimplut.[ch]: new source files that implement pixel Look Up
 	Table functions.

	* app/Makefile.am: build gimplut.[ch]


	* app/brightness_contrast.c
	* app/curves.c
	* app/invert.c
	* app/levels.c
	* app/posterize.c: Use the new lut functions.  Use
 	pixel_region_process_parallel in the PDB versions of these routines.

	* libgimp/parasite.h
	* libgimp/parasite.c: new functions parasite_name and
 	parasite_compare.

	* app/gimpdrawable.c:
	* app/gimpdrawable.h: new function
 	gimp_drawable_get_color_at(...) returns the RGBA[color index]
 	value at a specified position in the drawable.  Don't set the dirty
 	bit on the image if a new parasite is the same as the old.

	* app/gimpimage.c
	* app/gimpimage.h new function
 	gimp_image_get_color_at(...) returns the RGBA[color index]
 	value at a specified position in the drawable.  Don't set the dirty
 	bit on the image if a new parasite is the same as the old.

	* app/by_color_select.c
	* app/color_picker.c: use the new gimp_*_get_color_at
 	functions instead of messing with the tiles.

	* app/layer.c: fixed a minor warning.

	* app/commands.c:
	don't scale the image if the new size == the old size

	* app/channel.c: optimized channel_bounds by only checking the
 	pixels in a tile if it is not already entirely within the
 	currently computed bounds.
1999-02-16 08:53:54 +00:00
Tor Lillqvist
c32685e909 Oops. Actually use the rgb_to_l function from previous commit. This should
speed up the color balance operation a bit.
1999-02-15 05:27:35 +00:00
Tor Lillqvist
32fb2d1f72 Fix for the colour balance filter on systems with signed chars.
Added function rgb_to_l for use when we just need the luminosity.
1999-02-14 23:12:11 +00:00
CST 1999 Shawn T. Amundson
43ebe17b0e applied patch from Shuji Narazaki <narazaki@gimp.org> which adds bezier
Mon Feb  8 12:12:18 CST 1999 Shawn T. Amundson <amundson@gimp.org>

        * app/bezier_select.c: applied patch from Shuji Narazaki
          <narazaki@gimp.org> which adds bezier stroke.
1999-02-08 18:16:28 +00:00
GMT 1999 Adam D. Moss
e63d677b3b app/dialog_handler.c Various bugfixes and speedups w.r.t. thumbnail
Sun Feb  7 22:06:04 GMT 1999 Adam D. Moss <adam@gimp.org>

	* app/dialog_handler.c
	* app/fileops.c: Various bugfixes and speedups w.r.t.
	thumbnail loading.  Now has a 'generate thumbnail' button.

	* app/brightness_contrast.c
	* app/color_balance.c
	* app/curves.c
	* app/hue_saturation.c: Changed some gint to gint32.  It
	doesn't matter right now, but it might if the optimized
	CLAMP0255 gets fixed.
1999-02-07 22:13:10 +00:00
GMT 1999 Adam D. Moss
32675c4408 More robust and kickin' thumbnail support.
Sun Feb  7 15:04:23 GMT 1999 Adam D. Moss <adam@gimp.org>

        * app/fileops.c: More robust and kickin' thumbnail support.

        * app/edit_selection.c app/layer.c app/layer.h: Working
        on lazy opaque layer moves.  Disabled for now.

        * app/gdisplay.c
        * app/gimage.h
        * app/gimpimage.c
        * app/gimpimage.h
        * app/image_render.c
        * app/tile_manager.c: Errr, I don't remember.  No, seriously.
        Nothing of consequence.
1999-02-07 15:16:45 +00:00
Manish Singh
dea84972e3 fix setting of $localedir, and use $CONFIG_SHELL to run config.status
* configure.in: fix setting of $localedir, and use $CONFIG_SHELL
to run config.status (variation upon gimp-joke-990122-1)

* plug-ins/fp/fp_gtk.c: make label code consistent so we
don't get confused (gimp-ruth-990131-0)

* app/app_procs.c: toast stale swap files on startup

* app/general.[ch]: removed prune_filename

* app/by_color_select.c
* app/colormap_dialog.i.c
* app/fileops.c
* app/gdisplay.c
* app/gdisplay_ops.c
* app/gimpbrush.c
* app/gradient.c
* app/info_window.c
* app/menus.c
* app/palette.c
* app/patterns.c: s/prune_filename/g_basename/

-Yosh
1999-02-07 10:45:56 +00:00
jaycox
61417b911a merged the registered clone option from the hollywood branch. Made the
* app/clone.c: merged the registered clone option from the
 	hollywood branch.  Made the source for unaligned clones reset
 	after each stroke.  Make sure we don't crash if the source
 	drawable gets destroyed.
1999-02-05 09:55:44 +00:00
Peter Teichman
4f553ed2d3 added pressure support for the Convolve tool
* app/convolve.c: added pressure support for the Convolve tool
1999-02-04 23:28:09 +00:00
Owen Taylor
02b111b8ce Let the user choose between elliptical, square, and diamond shaped brushes
1999-02-02  Owen Taylor  <otaylor@gtk.org>

	* app/blob.[ch] app/ink.c: Let the user choose between
	elliptical, square, and diamond shaped brushes for
	the ink tool.
1999-02-03 04:29:08 +00:00
jaycox
fe34aed3a4 optimized by using a lookup table
* app/color_balance.c: optimized by using a lookup table

	* app/paint_funcs.c: parallelized apply_mask_to_region,
	combine_mask_and_region, and initial_region.  Use rand_r
	if we are multithreaded.
1999-02-01 08:22:18 +00:00
Owen Taylor
27f68dfe6d Merged in changes from gsumi. This revision replaces the unstable
Sun Jan 31 18:02:46 1999  Owen Taylor  <otaylor@gtk.org>

	* app/blob.c: Merged in changes from gsumi. This
	revision replaces the unstable conic-tracing code
	with old-fashioned floating point trig calls to
	compute the ellipses.
1999-02-01 01:27:33 +00:00
Manish Singh
bd9e497b75 s/(NONE|LEFT|RIGHT)/EDGE_$1/g to clear up namespace
* app/blob.c: s/(NONE|LEFT|RIGHT)/EDGE_$1/g to clear up namespace

* app/menus.c: create dummy var to i18n File/MRU item
(gimp-joke-9901122-1.patch)

* app/tips_dialog.c: #include <config.h> (gimp-joke-9901122-1.patch)

-Yosh
1999-01-27 06:30:37 +00:00
Manish Singh
a40810992d correct pdb invoker typo
-Yosh
1999-01-21 23:17:19 +00:00
GMT 1999 Adam D. Moss
64a6d4571d app/blend.c app/bucket_fill.c app/convert.c app/crop.c app/cursorutil.c
Sun Jan 17 16:56:25 GMT 1999 Adam D. Moss <adam@gimp.org>

        * app/blend.c app/bucket_fill.c app/convert.c app/crop.c
        app/cursorutil.c app/cursorutil.h app/dialog_handler.c
        app/dialog_handler.h app/fuzzy_select.c app/gdisplay.c
        app/gimage_cmds.c app/gimpimage.c app/scroll.c
        app/transform_core.c app/xcf.c

	Hourglasses also apply to all registered dialogs.  Hourglasses
	added in a couple more important places.  New hack lets
	hourglasses be added and automagically removed again when
	gimp/gtk re-enters the idle loop.
1999-01-17 17:03:54 +00:00
Federico Mena Quintero
10bc5237a7 Updated gtk_toggle_button_set_state() to gtk_toggle_button_set_active() in
1999-01-15  Federico Mena Quintero  <federico@nuclecu.unam.mx>

	* Updated gtk_toggle_button_set_state() to
	gtk_toggle_button_set_active() in all the files.
1999-01-15 17:35:04 +00:00
GMT 1999 Austin Donnelly
d8be79f036 Bit of a large checkin this - it's basically three things: 1 - GimpModules
Sun Jan 11 00:24:21 GMT 1999  Austin Donnelly  <austin@greenend.org.uk>

	Bit of a large checkin this - it's basically three things:
	  1 - GimpModules using gmodules to dynamically load and
	       initialise modules at gimp start of day.
	  2 - Color selectors now register themselves with a color
	       notebook.
	  3 - progress bars have been cleaned up a bit, so now have
	       progress indictations on all transform tool and gradient
	       fill operations.  Not done bucket fill, but that seems to
	       be the next candidate.

	New directories:
	* modules/: new directory for dynamically loadable modules.

	New files:
	* modules/.cvsignore
	* modules/Makefile.am
	* modules/colorsel_gtk.c: GTK color selector wrapped up as a
	    color selector the gimp can use.

	* app/gimpprogress.[ch]: progress bars within gimp core, either as
	    popups, or in the status bar.  This is mainly code moved out
	    of plug-in.c

	* app/color_notebook.[ch]: color selector notebook, implementing
	    very similar interface to color_select.h so it can be used as
	    a drop-in replacement for it.

	* libgimp/color_selector.h: API color selectors need to implement
	    to become a page in the color_notebook.

	* libgimp/gimpmodule.h: API gimp modules need to implement to be
	    initialised by gimp at start of day.

	Modified files:
	* Makefile.am: add modules/ to SUBDIRS
	* libgimp/Makefile.am: install gimpmodule.h and color_selector.h
	* app/gimprc.[ch]: recognise module-path variable.
	* gimprc.in: set module-path variable to something sensible
	    (currently "${gimp_dir}/modules:${gimp_plugin_dir}/modules").
	* app/Makefile.am: build color notebook and gimpprogress
	* app/app_procs.c: register internal GIMP color selector with
	    color notebook.
	* app/asupsample.c: call progress function less frequently for
	    better performance.
	* app/asupsample.h: progress_func_t typedef moved to gimpprogress.h
	* app/blend.c: make callbacks to a progress function
	* app/color_area.c: use a color notebook rather than a color selector
	* app/color_panel.c: ditto
	* app/color_select.c: export color selector interface for notebook
	* app/color_select.h: color_select_init() prototype
	* app/flip_tool.c: flip the image every time, rather than every
	    second click.
	* app/interface.c: move progress bar stuff out to
	    gimpprogress.c.  Make the code actually work while we're at it.
	* app/interface.h: move prototypes for progress functions out to
	    gimpprogress.h
	* app/plug_in.c: load and initialise modules (if possible). Move
	    progress bar handling code out to gimpprogress.c
	* app/plug_in.h: keep only a gimp_progress * for each plugin, not
	    a whole bunch of GtkWidgets.
	* app/scale_tool.c
	* app/rotate_tool.c
	* app/shear_tool.c
	* app/perspective_tool.c: progress bar during operation.
	    De-sensitise the dialog to discourage the user from running
	    two transforms in parallel.
	* app/transform_core.c: recalculate grid coords when bounding box
	    changes.  Only initialise the action area of the dialog once,
	    to avoid multiple "ok" / "reset" buttons appearing.  Undraw
	    transform tool with correct matrix to get rid of handle
	    remains on screen.  Call a progress function as we apply the
	    transform matrix.  A few new i18n markups.  Invalidate
	    floating selection marching ants after applying matrix.
	* app/transform_core.h: transform_core_do() takes an optional
	    progress callback argument (and data).
	* plug-ins/oilify/oilify.c: send progress bar updates after every
	    pixel region, not only if they processed a multiple of 5
	    pixels (which was quite unlikely, and therefore gave a jerky
	    progress indication).
1999-01-11 00:57:33 +00:00
GMT 1999 Adam D. Moss
bf0dbb2018 Most lengthy UI-blocking operations now put up an hourglass so the user
Sun Jan 10 23:31:45 GMT 1999 Adam D. Moss <adam@gimp.org>

	* app/blend.c app/bucket_fill.c app/convert.c app/crop.c
	app/cursorutil.c app/cursorutil.h app/fuzzy_select.c
	app/gdisplay.c app/gdisplay.h app/gimage_cmds.c
	app/gimpimage.c app/transform_core.c app/xcf.c:

	Most lengthy UI-blocking operations now put up an
	hourglass so the user can see that GIMP is working.
	Let me know if there are other vital cases.
1999-01-10 23:36:29 +00:00
GMT 1999 Andy Thomas
01d2a20548 New app/dialog_handler.c app/dialog_handler.h
Sun Jan 10 22:41:51 GMT 1999 Andy Thomas <alt@picnic.demon.co.uk>

	New
	* app/dialog_handler.c
	* app/dialog_handler.h

	Changed
	* app/disp_callbacks.c
	* app/gradient_select.c
	* app/tools.c
	* app/interface.c
	* app/patterns.c
	* app/gimpbrushlist.c
	* app/palette.c
	* app/layers_dialog.c
	* app/devices.c
	* app/errorconsole.c

	Can now hide/show all main dialogs using the TAB key in any window.
	However....
	there is a bug in gtk that causes the Gimp the crash if you show
	and then hide a lot of dialogs (eg if you have all dialogs visible
	and press the TAB key repeatedly). I have email-ed an example to
	the gtk bug list.
	Also I can't seem to be able to catch the SHIFT-TAB combination
	(suggestions welcome ;-) so the first press of the tab hide all
	dialogs the second press reshows only the toolbox and the third
	press reshows all. Comments please if you find this behaviour
	non-intuitive.
1999-01-10 23:20:33 +00:00
GMT 1999 Austin Donnelly
31fba3b3dc app/brush_select.c app/channels_dialog.c app/disp_callbacks.c
Sun Jan 10 21:42:11 GMT 1999  Austin Donnelly  <austin@greenend.org.uk>

	* app/brush_select.c
	* app/channels_dialog.c
	* app/disp_callbacks.c
	* app/histogram_tool.c
	* app/info_dialog.c
	* app/layer_select.c
	* app/pattern_select.c
	* plug-ins/gfig/gfig.c
	* plug-ins/newsprint/newsprint.c: More changes of the form
 	       s/gtk_label_set/gtk_label_set_text/
1999-01-10 21:54:02 +00:00
GMT 1999 Andy Thomas
d2e598739c app/blend.c plug-ins/script-fu/script-fu.c
Mon Jan  4 23:21:56 GMT 1999 Andy Thomas <alt@picnic.demon.co.uk>

	* app/blend.c
	* plug-ins/script-fu/script-fu.c

	A patch from Federico to add a spiral gradient type. The patch
	has been slightly modified to allow both clockwise and anticlockwise
	spirals and the numbers used to represent these types of gradients
	have been made to follow on from currently allocated numbers (I hope
	this will not break any scripts).
1999-01-04 23:56:37 +00:00
Manish Singh
12085bcb60 remove bogus constification
* app/blend.c: remove bogus constification

* po/sv.po: updates from Tomas Ogren <stric@ing.umu.se>

-Yosh
1999-01-02 03:30:04 +00:00
Manish Singh
49cbf0630d i18n markings from Daniel Egger (mostly removal of tags around PDB stuff),
* i18n markings from Daniel Egger (mostly removal of tags around
PDB stuff), some constification

* I went on a sprintf pogrom. Use g_snprintf or g_strdup_printf
where applicable, to prevent overflows, especially with filenames
and translated strings. suid gimp is now more secure. ;)

-Yosh
1998-12-25 18:22:01 +00:00
Sven Neumann
a2e05bf488 Finally it seems like Xach got it right.
--Sven
1998-12-20 22:40:03 +00:00
CST 1998 Shawn T. Amundson
092fb5a60e app/by_color_select.c: plug-ins/script-fu/script-fu-scripts.c:
Sat Dec 19 15:46:27 CST 1998 Shawn T. Amundson <amundson@gtk.org>

        * app/brush_edit.c:
          app/by_color_select.c:
          plug-ins/script-fu/script-fu-scripts.c:
          plug-ins/compose/compose.c:
          plug-ins/fp/fp.c:
          plug-ins/fp/fp_gdk.c:
          plug-ins/fp/fp_gtk.c:
          plug-ins/maze/maze_face.c: s/gtk_label_set/gtk_label_set_text/g
1998-12-20 00:13:50 +00:00
Sven Neumann
dc436e826e Applied the second patch from Xach with a slight modification to get
centered fixed-size selections right.


--Sven
1998-12-19 23:59:04 +00:00
Sven Neumann
3231691d2f Applied the patch Xach sent to the list.
--Sven
1998-12-19 18:22:14 +00:00
Manish Singh
af37146ad9 warning pogrom
-Yosh
1998-12-17 11:40:19 +00:00
jaycox
fe3fa4e2e5 libgimp/gserialize.c Changed the enum values to allow for simpler future
* libgimp/gserialize.c
	* libgimp/gserialize.h: Changed the enum values to allow for
 	simpler future expansion.

	* libgimp/parasite.c
	* libgimp/parasite.h: s/persistant/persistent/.
 	new accessor functions for parasites.  #defines for new flags.

	* app/paintbrush.c: added timeing code for brush strokes.
  	It is #ifed out, and is only valid for shift clicks.

	* app/parasite_cmds.h: fixed a warning

	* app/parasitelist.h
	* app/parasitelist.c: added _for_each and _length functions

	* app/gimpdrawable.c:  set the dirty flag when adding or removing a
 	persistent parasite

	* app/gimpimage.c: set the dirty flag when adding or removing a
 	persistent parasite.  Fixed bug and removed debug statements in
 	merge_down.

	* app/xcf.c: save and load resolution, parasites, and tattoos.

	* app/main.c: updated the deserialize test.

	* plug-ins/tiff/tiff.c
	* plug-ins/gif/gif.c: use PARASITE_PERSISTENT define instead of 1

	* plug-ins/bmp/bmp.c
	* plug-ins/bmp/bmp.h: declare some struct variable as extern.

	* app/paint_funcs.c: Lots of optimizations aimed at speeding up
 	painting.  Should see a 2-4X speed up on most painting
 	(depending on paint modes, brush size etc.)

	* app/drawable.c: check for NULL drawable in drawable_ID.
  	this stops us from being crashed by ill-behaved plug-ins
1998-12-16 11:23:30 +00:00
Manish Singh
d2ea549d27 stuff from patches/i18n by Daniel Egger
* app/*: stuff from patches/i18n by Daniel Egger

* app/channels_dialog.c: fixes minor buglets in the channels dialog

-Yosh
1998-12-16 00:37:09 +00:00
GMT 1998 Austin Donnelly
ccfeb2549d app/commands.[ch] app/edit_selection.c app/gdisplay.[ch]
Sat Dec  5 21:31:57 GMT 1998  Austin Donnelly  <austin@greenend.org.uk>

	* app/commands.[ch]
	* app/edit_selection.c
	* app/gdisplay.[ch]
	* app/gdisplay_ops.[ch]
	* app/image_render.c
	* app/info_window.c
	* app/magnify.c
	* app/menus.c
	* app/scale.c: image rendering now happens with float scale
	factors, independent in X and Y axes.  Turning on dot-for-dot in view
	menu does what gimp always used to do (ie one image pixel becomes
	one monitor pixel).  Dot-for-dot is on by default so people
	shouldn't notice any difference unless they load an image that's
	not at 72 dpi and also turn off dot-for-dot.

	* app/app_procs.c
	* app/gimprc.[ch]
	* app/preferences_dialog.c: new gimprc options
	(monitor-xresolution <float>) and corresponding
 	(monitor-yresolution <float>).  Uglyness in preferences dialog to
	add a "Monitor" page to the notebook, allowing user to set their
	monitor's resolution or take it from the X server instead.  This
	badly needs cleaned up :(

	* plug-ins/newsprint/newsprint.c: oops - this hasn't been working
	for grayscale images since my last checkin.  Now fixed.
1998-12-05 21:48:37 +00:00
EST 1998 Nick Fetchak
a616697415 Added option to crop the active layer only
Fri Dec  4 01:43:59 EST 1998 Nick Fetchak <nuke@bayside.net>

        * app/crop.[ch]: Added option to crop the active layer only
1998-12-04 06:46:52 +00:00
CST 1998 Shawn T. Amundson
b556943f2c app/channel_ops.c app/color_balance.c app/color_select.c app/commands.c
Thu Dec  3 16:51:42 CST 1998 Shawn T. Amundson <amundson@gtk.org>

        * app/channel_ops.c
        * app/color_balance.c
        * app/color_select.c
        * app/commands.c
        * app/convert.c
        * app/curves.c
        * app/docindex.c
        * app/errorconsole.c
        * app/file_new_dialog.c
        * app/fileops.c
        * app/gdisplay_ops.c
        * app/histogram_tool.c
        * app/info_dialog.c
        * app/layer_select.c
        * app/levels.c
        * app/pattern_select.c
        * app/plug_in.c
        * app/posterize.c
        * app/resize.c
        * app/threshold.c
        * app/tips_dialog.c: use gtk_container_set_border_width and
          gtk_window_set_position instead of deprecated versions
1998-12-03 23:01:44 +00:00
CST 1998 Larry Ewing
ee23120c06 fixed the dialog destroy handling in the bezier extends dialog.
Tue Dec  1 22:12:08 CST 1998 Larry Ewing  <lewing@gimp.org>

	* app/bezier_select.c: fixed the dialog destroy handling in the
	bezier extends dialog.
1998-12-02 04:15:48 +00:00
Owen Taylor
25ba123167 Use MAX when combining multiple blobs, instead of previous technique. This
Fri Nov 27 17:34:57 1998  Owen Taylor  <otaylor@redhat.com>

	* app/ink.c: Use MAX when combining multiple blobs,
	instead of previous technique.	This gives _much_
	better results.
1998-11-27 22:42:15 +00:00
Raph Levien
df3a07a932 Added a tilt angle slider. 1998-11-26 07:44:17 +00:00
Raph Levien
fa8a3bc922 Added tilt sensitivity in ink tool. 1998-11-25 19:21:54 +00:00
Manish Singh
cb80e23d3b applied gimp-stric-981116-1, lots o files changes in app. i18n patch.
* applied gimp-stric-981116-1, lots o files changes in app. i18n patch.

* plug-ins/gfig/gfig.c: applied gimp-tml-981121-0, use proper PDB params

-Yosh
1998-11-23 14:47:09 +00:00
Manish Singh
25f3cc8d31 require GTK+ 1.1.5
* configure.in: require GTK+ 1.1.5

* app/bezier_select.c
* app/channels_dialog.c
* app/global_edit.c
* app/layers_dialog.c
* plug-ins/film/film.c
* plug-ins/gfig/gfig.c
* plug-ins/xd/xd.c
* plug-ins/libgck/gck/gcklistbox.c: fixes for new scrolled window viewport
behavior

* libgimp/gimpwire.c
* app/xcf.c: use g_htonl and friends

* app/main.c: ditch some unused variables

* app/Makefile.am: removed unused pixmap references

-Yosh
1998-11-23 09:25:10 +00:00
Sven Neumann
86d0a76695 New GTK feature greys out buttons automatically. Finally got rid of my dirty
workaround.


--Sven
1998-11-18 15:48:11 +00:00
Marc Lehmann
971bc712b1 allow the use of DIVIDE_MODE.
* app/blend.c: allow the use of DIVIDE_MODE.
1998-11-15 12:58:37 +00:00
GMT 1998 Austin Donnelly
3fa6583ed7 deal with zero-size selections correctly (ie, select the whole image but
Sat Nov 14 20:02:31 GMT 1998  Austin Donnelly  <austin@greenend.org.uk>

	* app/rect_select.c: deal with zero-size selections correctly (ie,
	select the whole image but don't show marching ants).

	* app/app_procs.c: sort out colourmap before creating splash
	window, so if we need to install a private cmap then everything
	will use it.

	* plug-ins/newsprint/newsprint.c: delete spurious debugging printf.
1998-11-14 20:06:30 +00:00
Marc Lehmann
42e2c63ce5 API-mega-break-it-all patch part one: removed the unnecessary PDB_IMAGE
* airbrush.c, blend.c, brightness_contrast.c, bucket_fill.c
        by_color_select.c, channel_ops.c, clone.c, color_balance.c
        color_picker.c, convolve.c, curves.c, desaturate.c, edit_cmds.c
        equalize.c, eraser.c, flip_tool.c, fuzzy_select.c,
        gimage_mask_cmds.c histogram_tool.c, hue_saturation.c, invert.c,
        levels.c, pencil.c paintbrush.c, perspective_tool.c, posterize.c,
        rotate_tool.c scale_tool.c, shear_tool.c, text_tool.c, threshold.c:

        API-mega-break-it-all patch part one: removed the unnecessary
        PDB_IMAGE argument from many functions.

Affected functions:
gimp_airbrush gimp_blend gimp_brightness_contrast gimp_bucket_fill
gimp_by_color_select gimp_channel_ops_offset gimp_clone gimp_color_balance
gimp_color_picker gimp_convolve gimp_curves_explicit gimp_curves_spline
gimp_desaturate gimp_edit_clear gimp_edit_copy gimp_edit_cut gimp_edit_fill
gimp_edit_paste gimp_edit_stroke gimp_equalize gimp_eraser
gimp_eraser_extended gimp_flip gimp_fuzzy_select gimp_histogram
gimp_hue_saturation gimp_invert gimp_levels gimp_paintbrush
gimp_paintbrush_extended gimp_pencil gimp_perspective gimp_posterize
gimp_rotate gimp_scale gimp_selection_float gimp_selection_layer_alpha
gimp_selection_load gimp_shear gimp_threshold
1998-11-13 20:40:00 +00:00
Sven Neumann
e3c27c9751 Minimal speedup by avoiding to do a inverse->inverse matrix calculation.
Use transform_core_do() for scaling too. This gives a consistent behaviour
regarding the corrective transform and seems to be faster too...


--Sven
1998-11-10 22:50:34 +00:00
Manish Singh
0963a109c3 applied gimp-joke-981006-0, portability patch
-Yosh
1998-10-25 05:55:36 +00:00
BST 1998 Austin Donnelly
acb526c80b don't bail if we don't have a source drawable if we're actually using a
Sun Oct 18 21:20:25 BST 1998  Austin Donnelly  <austin@greenend.org.uk>

	* app/clone.c: don't bail if we don't have a source drawable if
	we're actually using a pattern as source.
1998-10-18 20:37:43 +00:00
EDT 1998 Adrian Likins
25721826d0 Lots of ii8n stuff here and some additions to the de.po. Applied
Wed Oct 14 17:46:15 EDT 1998 Adrian Likins <adrian@gimp.org>

        * app/*, po/de.po, de/POTFILES.in, libgimp/gimpintl.h:
        Lots of ii8n stuff here and some additions to the de.po.
        Applied gimp-egger-981005-1 ,gimp-egger-981006-1,
        gimp-egger-981007-1, gimp-egger-981008-1,
        gimp-egger-981009-1.patch, gimp-egger-981010-1.patch

        * plug-in/guillotine/guillotine.c: added the coordinates
        of the split images from the original image to the title.
        ie foo.jpg (0,0) for the image in the topleft.

        * plug-in/script-fu/scripts/neon-logo.scm,
        perspective-shadow.scm, predator.scm,rendermap.scm,
        ripply-anim.scm, select_to_image.scm,swirltile.scm,
        xach-effect.scm: updated scripts to use new script-fu stuff

wooo boy! a big un!

	in testing this, it looks like some of the po files are busted.
but the code stuff seems okay.

-adrian
1998-10-14 23:23:52 +00:00
jaycox
c5a8b43846 Modified Files: ChangeLog app/Makefile.am app/channel.c app/channel.h
Modified Files:
 	ChangeLog app/Makefile.am app/channel.c app/channel.h
 	app/channel_cmds.c app/channel_cmds.h app/drawable_cmds.c
 	app/gimage_cmds.c app/gimpdrawable.c app/gimpdrawable.h
 	app/gimpdrawableP.h app/gimpimage.c app/gimpimage.h
 	app/gimpimageP.h app/internal_procs.c app/layer.c app/layer.h
 	app/layer_cmds.c app/layer_cmds.h app/parasite_cmds.c
 	app/perspective_tool.c app/plug_in.c app/procedural_db.c
 	app/rotate_tool.c app/scale_tool.c app/shear_tool.c
 	app/transform_core.c app/transform_core.h docs/parasites.txt
 	libgimp/Makefile.am libgimp/gimp.c libgimp/gimp.h
 	libgimp/gimpdrawable.c libgimp/gimpimage.c
 	libgimp/gimpprotocol.c libgimp/gimpprotocol.h
 	plug-ins/gif/gif.c plug-ins/script-fu/script-fu.c
 	plug-ins/tiff/tiff.c
 Added Files:
 	libgimp/gimpmatrix.c libgimp/gimpmatrix.h libgimp/parasite.c
 	libgimp/parasite.h libgimp/parasiteF.h libgimp/parasiteP.h
 Removed Files:
 	app/parasite.c app/parasite.h app/parasiteF.h app/parasiteP.h
 	libgimp/gimpparasite.c libgimp/gimpparasite.h

Tue Oct 13 19:24:03 1998  Jay Cox  (jaycox@earthlink.net)

        * app/parasite.c
        * app/parasite.h
        * app/parasiteF.h
        * app/parasiteP.h : use a single name field instead of seperate
        creator/type fields.  moved to libgimp/parasite*

        * libgimp/Makefile.am
        * libgimp/gimp.c
        * libgimp/gimp.h
        * libgimp/gimpdrawable.c
        * libgimp/gimpimage.c
        * libgimp/gimpprotocol.c
        * libgimp/gimpprotocol.h
        * app/Makefile.am
        * app/channel.c
        * app/channel.h
        * app/channel_cmds.c
        * app/channel_cmds.h
        * app/drawable_cmds.c
        * app/gimage_cmds.c
        * app/gimpdrawable.c
        * app/gimpdrawable.h
        * app/gimpdrawableP.h
        * app/gimpimage.c
        * app/gimpimage.h
        * app/gimpimageP.h
        * app/internal_procs.c
        * app/layer.c
        * app/layer.h
        * app/layer_cmds.c
        * app/layer_cmds.h
        * app/parasite_cmds.c
        * app/plug_in.c
        * app/procedural_db.c: Add tattoos to layers and drawables.
        Use new style parasites.

        * libgimp/gimpmatrix.c
        * libgimp/gimpmatrix.h: new files for matrix math.

        * app/perspective_tool.c
        * app/rotate_tool.c
        * app/scale_tool.c
        * app/shear_tool.c
        * app/transform_core.c
        * app/transform_core.h: use GimpMatrix instead of the old matrix
        code from transform_core.

        * ligimp/gimpparasite*: removed.  now useing the same source
        for plug-ins and the core.

        * plug-ins/script-fu/script-fu.c
        * plug-ins/tiff/tiff.c
        * plug-ins/gif/gif.c: updated to use new style parasites.
1998-10-14 02:54:02 +00:00
Manish Singh
b23f1a1d2f applied gimp-austin-981007-0, use gtkfontsel for the text tool
* app/text_tool.[ch]: applied gimp-austin-981007-0, use gtkfontsel for the
text tool

* app/about_dialog.c: some nice people ;)

-Yosh
1998-10-07 08:59:11 +00:00
BST 1998 Adam D. Moss
0499488635 The paint and ink tools are synchronous.
Sun Oct  4 21:07:07 BST 1998 Adam D. Moss <adam@gimp.org>

	* app/ink.c app/paint_core.c: The paint and ink tools
	are synchronous.
1998-10-04 20:16:17 +00:00
Manish Singh
34d938f582 correct test for restoring old foundry in callback (from Trent Piepho)
* app/text_tool.c: correct test for restoring old foundry in
callback (from Trent Piepho)

* plug-ins/gauss_iir/gauss_iir.c
* plug-ins/gauss_rle/gauss_rle.c: better test for bad values,
put fix in gauss_rle too

-Yosh
1998-09-21 09:08:54 +00:00
BST 1998 Andy Thomas
dbb801e2d6 app/blend.c app/brush_select.c app/brush_select.h app/bucket_fill.c
Sat Sep 19 01:19:18 BST 1998 Andy Thomas <alt@picnic.demon.co.uk>

	* app/blend.c app/brush_select.c app/brush_select.h app/bucket_fill.c
	app/gimpbrushlist.c app/internal_procs.c app/plug_in.c libgimp/gimp.c
	libgimp/gimp.h libgimp/gimpmenu.c libgimp/gimptile.c
	plug-ins/gfig/gfig.c

	Infrastructure to allow gimp dialogs to be controlled from plugins.
	Brush dialog can now be invoked multiple times. Dialogs invoked
	via plugins do not control the active brush (dialog only used for
	selections).
	New gimp_interactive_selection_brush() function to popup dialog
	Example of usage in the gfig plugin.
	Other dialogs should be able to use this method of invocation.
1998-09-19 00:40:27 +00:00
BST 1998 Adam D. Moss
31088f3c96 The facility to specify the background colour of a transparent/animated
Tue Sep 15 21:27:10 BST 1998  Adam D. Moss <adam@gimp.org>

	* plug-ins/gif.c:
	The facility to specify the background colour of
	a transparent/animated GIF for non-transparent
	viewers now works very much more consistantly.
	The only situations in which it will fail to work
	as expected now are those where file size can be reduced
	(abeit not by much, as the plugin is sometimes more pessimistic
	than it need be) by re-using an existing unused colour
	index rather than using another bit per pixel in the
	encoded file.  That will never be an issue with an image
	which was freshly converted from RGB to INDEXED with the
	Quantize option, as that option removes any unused colours
	from the image.

	Let me know if you find the consistancy/size tradeoff more
	annoying than helpful and I can adjust it.  IMHO it is too
	arcane a feature to present to any user as a runtime option.

	* app/ink.c: #include <string.h> for a memset
1998-09-15 20:34:30 +00:00
Manish Singh
72848df01f make xdelta not built by default, so poor users aren't confused
* configure.in: make xdelta not built by default, so poor users aren't confused

* libgimp/gimp.c
* app/blob.c
* app/errors.c
* plug-ins/script-fu/script-fu-server.c: fixes for glib changes with
s/g_debug/g_on_error_debug/ and s/g_vsprintf/g_strdup_vprintf/

-Yosh
1998-08-24 16:26:09 +00:00
People doing a 16 bpc version of gimp
8868daee7f ok, i modified *way* more files than CVS is telling me....
ok, i modified *way* more files than CVS is telling me....

- add canvas_init machinery (tile_manager_validate equivalent)
- fix bugs in compositing code
- layers/channels dialog, previews
- all color handling should be fairly precision independent now
- replaced gimage_type and gimage_base_type with Tags
- remove concept of flat vs. layered gimages

ray lehtiniemi <rayl@netrover.com>
1998-08-20 00:35:40 +00:00
CDT 1998 Larry Ewing
8a6503a734 Make sure we check that ink_set_paint_area found a valid canvas_buf.
Sun Aug 16 18:48:17 CDT 1998  Larry Ewing  <lewing@gimp.org>

	* app/ink.c (ink_paste): Make sure we check that
	ink_set_paint_area found a valid canvas_buf.
1998-08-16 23:54:51 +00:00
scott
fe6720432b Header file tweaks. Now changing tile.h doesn't force about_dialog to
recompile! :)
1998-08-16 00:34:20 +00:00
CDT 1998 Larry Ewing
ae49b4f259 added a debug warning to a case that previously caused a segfault. This
Sat Aug 15 16:53:45 CDT 1998  Larry Ewing  <lewing@gimp.org>

	* app/airbrush.c: added a debug warning to a case that previously
	caused a segfault.  This appears to be an xinput related problem
	where more than one button press can occur before a button release,
	so if you see a warning that tells you to contact me, please do.
1998-08-15 22:03:32 +00:00
scott
01e6a823ad Fixed a merge error. --sg 1998-08-15 20:03:04 +00:00
scott
85393964a0 Another tile tweak. This one eliminates tile levels (which add
bookkeeping without being used).  Made copy_region more intelligent on
when to use tile sharing; some changes made to pixel_regions to
facilitate this.  Fixed a refcount problem with xcf load and probably
a few other bugs that I've forgotten about.  Added a sanity check in
set_undo_tiles to help with a problem larry is reporting with airbrush
and xinput.  --sg
1998-08-15 19:17:36 +00:00
Sven Neumann
14394b2e6b We have entries in the info dialog now that allow to enter exact values
for the transformations and crop.

Changed "Clip perspective" to "Clip result" in the ransform tool options
and made it available for all transformations.

Minor cosmetic changes to rect_select and ink option dialogs.


--Sven
1998-08-15 13:34:54 +00:00
Sven Neumann
e9363dbcac A few fixes to the new transform tool UI.
--Sven
1998-08-14 14:46:24 +00:00
Sven Neumann
dbac5e9ef6 Minor cosmetic changes to the transform tool options dialog.
Made "Traditional" the default behaviour.


--Sven
1998-08-13 20:22:13 +00:00
Sven Neumann
844a3481ee Applied the transform tool UI patch from Tor Lillqvist <tml@iki.fi>.
It still has a few problems, but I guess there are easier to solve, if the
patch is applied.


--Sven
1998-08-13 20:19:09 +00:00
Seth Burgess
d27db074bc Made flip tool work normally again. -- Seth Burgess <sjburges@gimp.org> 1998-08-12 04:23:48 +00:00
scott
0ffabfe95b Bunch of tile-related stuff. 1998-08-11 17:35:34 +00:00
Sven Neumann
7422ae2e03 Finally a font-selector.
--Sven
1998-08-10 15:06:58 +00:00
Adam D. Moss
5b6e6cd6f0 On all gimp-core fopen()s changed "[rw]"->"[rw]b" to appease OS/2 folk.
* app/[lots of files].c: On all gimp-core fopen()s
        changed "[rw]"->"[rw]b" to appease OS/2 folk.
1998-07-31 18:34:05 +00:00
Sven Neumann
426322f47b More statusbar stuff.
--Sven
1998-07-26 21:49:42 +00:00
Manish Singh
5007176bba applied gimp-tml-980724-1 for new transform tool ui. It's still a little
rough, needs fixes

-Yosh
1998-07-24 21:05:02 +00:00
Adam D. Moss
814a4285c6 Attempt to speed-up and/or sanitize MAX/MIN/CLAMP macro usage throughout
* app/appenv.h app/brightness_contrast.c app/color_balance.c
	app/curves.c app/gdisplay.h app/gdisplay_ops.c
	app/hue_saturation.c app/paint_core.c app/paint_funcs.c
	app/undo.c: Attempt to speed-up and/or sanitize
	MAX/MIN/CLAMP macro usage throughout gimp-core.
1998-07-24 18:52:03 +00:00
jaycox
69d922412a ----------------------------------------------------------------------
----------------------------------------------------------------------
 Modified Files:
 	ChangeLog app/Makefile.am app/brush_select.c app/gimpbrush.c
 	app/gimpbrush.h app/gimpbrushgenerated.c app/gimpbrushlist.c
 	app/gimplist.c app/paint_core.c app/paint_core.h
    added axis to brushes.  paint_core now references a brush instead
    of a mask.  cleaned up some [brush]list removal stuff.


 Added Files:
 	app/vector2d.c app/vector2d.h
    very basic vector math struct/functions.
----------------------------------------------------------------------
1998-07-24 08:56:18 +00:00
Sven Neumann
1f73342df7 Display the move offset in the statusbar and some code cleanup in
rect_select.c. Sorry for committing so much half-done stuff in the last
time. I'll do more testing in the future...


--Sven
1998-07-23 18:33:01 +00:00
Sven Neumann
6b01e79246 Display the selection-mode in the statusbar.
Restoring saved sessions works again.


--Sven
1998-07-22 23:55:43 +00:00
Sven Neumann
72577b161b Added session-managment support to the device-status-dialog.
The restore-function is still not working, will have a look at it tomorrow...


--Sven
1998-07-21 00:15:24 +00:00
Sven Neumann
abe13ecfe8 Just found out that the fixed_[width|height] should better be always > 0 ...
--Sven
1998-07-20 18:32:19 +00:00
Sven Neumann
5d2753c2ff The new "Fixed Size" option now works with
ellipse_select too. Made the entries use spinbuttons. Minor change
to the selection_size indicator in the status-bar.

Made fopen() use "rb" and "wb" instead if "r" and "w" since the OS/2
port needs it.


--Sven
1998-07-20 18:19:20 +00:00
jaycox
2f93825eb2 ----------------------------------------------------------------------
----------------------------------------------------------------------
 Modified Files:
 	ChangeLog app/brush_select.c
 	app/gimpbrush.c app/gimpbrush.h app/gimpbrushgenerated.c
 	app/gimpbrushlist.c app/gimpbrushlist.h
     removed the index field from GimpBrush.  tweaked the brush renaming
     code

	app/edit_selection.c:
     look ahead in the event queue and process as many arrow keys as we
     can.
 ----------------------------------------------------------------------
1998-07-20 14:05:33 +00:00
Sven Neumann
0f00346973 Show the selection size in the statusbar.
--Sven
1998-07-18 19:24:57 +00:00
Adam D. Moss
4d50fdb98d app/gimprc.c app/gimprc.h app/ink.c app/paint_core.c Now the
* app/gimprc.c
	* app/gimprc.h
	* app/ink.c
	* app/paint_core.c
	* app/preferences_dialog.c: Now the perfect-mouse-tracking
	normally enabled by pressing MOD1 is a preferences option,
	and MOD1 inverts the affect.

	* app/ink.c: Mildly tweaked the default brush size/range for
	my own twisted sense of esthetics.  Forgive me.
1998-07-18 17:39:23 +00:00
Adam D. Moss
964b6f504d Fixed my idiotic comment syntax Less wussy default/max rate
* app/fileops.c: Fixed my idiotic comment syntax
	* app/airbrush.c: Less wussy default/max rate
1998-07-18 15:49:22 +00:00
EDT 1998 Adrian Likins
be6d4825df argh, s/snprintf/g_snprintf
Mon Jul 13 22:00:31 EDT 1998 Adrian Likins <adrian@gimp.org>

        * app/rect_select.c : argh, s/snprintf/g_snprintf

-adrian
1998-07-14 03:12:31 +00:00
EDT 1998 Adrian Likins
649815a8c9 applied gimp-chap-980709-0 from Chap Lovejoy (chap@cc.gatech.edu)
Mon Jul 13 17:48:21 EDT 1998 Adrian Likins <adrian@gimp.org>

        * app/rect_select.[ch]: applied gimp-chap-980709-0
        from  Chap Lovejoy  (chap@cc.gatech.edu)

        From the README:

        Adds fixed size and fixed ratio rectangular selections to the
        gimp.

        Fixed size is enabled by filling in the height and width boxes in
        the rectangular selection tool options box and checking the
        "fixed size" checkbox.

        Fixed ratio is enabled by enabling fixed size (set the height and
        width to the desired ratio values) and holding shift after
        starting the selection (holding shift while starting the selection
        will change the selection operation to add).

-adrian
1998-07-13 23:08:00 +00:00
Owen Taylor
1cba88aacc Free last_blob when destroying tool.
Sat Jul 11 23:57:09 1998  Owen Taylor  <otaylor@gtk.org>

	* app/ink.c (tools_free_ink): Free last_blob when destroying
	  tool.

	* app/blob.c: Fix off-by-one error when searhing for gaps.
1998-07-12 03:59:23 +00:00
Sven Neumann
329e2072d8 More session-managment functionality. Opened dialogs are saved and eventually
reopened. Try to use the --restore-session command-line option.


--Sven
1998-07-11 22:23:23 +00:00
scott
df2b147050 Fixed a really dumb bug in tile management in paint_core. --sg 1998-07-11 14:00:55 +00:00
jaycox
8fca3091fe Modified Files: ChangeLog app/brush_select.c app/brush_select.h
Modified Files:
 	ChangeLog app/brush_select.c app/brush_select.h
 	app/gimpbrushgenerated.c app/gimpbrushlist.c
 	app/gimpbrushlist.h app/paint_core.c app/paint_core.h
       Signalified the brushes and cleaned up a few things.

 	app/paint_funcs.c: Minor speed tweak
 ----------------------------------------------------------------------
1998-07-10 08:59:55 +00:00
scott
83963c3697 A few tile tweaks (stuff I messed up on the frist commit) --sg 1998-07-10 04:33:21 +00:00
scott
9ccef4a648 Tile overhaul. Mostly minor changes, except for tile*.*, which are
barely recognizable.
1998-07-10 02:43:12 +00:00
EDT 1998 Michael K. Johnson
1f1c9e1684 clone_motion: silently ignore cloning if the clone source hasn't been
Thu Jul  9 22:04:04 EDT 1998  Michael K. Johnson <johnsonm@redhat.com>

       * app/clone.c: clone_motion: silently ignore cloning if the
         clone source hasn't been selected or no longer exists.

Slightly modified last commit to be less noisy.
1998-07-10 02:17:20 +00:00
EDT 1998 Michael K. Johnson
42270eb6dc clone_motion: error message instead of segv if the clone source hasn't
Thu Jul  9 22:04:04 EDT 1998  Michael K. Johnson <johnsonm@redhat.com>

        * app/clone.c: clone_motion: error message instead of segv
          if the clone source hasn't been selected or no longer exists.
1998-07-10 01:59:40 +00:00
jaycox
b7d8e6ea91 Modified Files: ChangeLog app/Makefile.am app/airbrush.c app/app_procs.c
Modified Files:
 	ChangeLog app/Makefile.am app/airbrush.c app/app_procs.c
 	app/brush_select.c app/brush_select.h app/clone.c
 	app/colormaps.c app/commands.c app/convolve.c app/devices.c
 	app/eraser.c app/gimage_mask.c app/gimpobject.h app/ink.c
 	app/internal_procs.c app/paint_core.c app/paint_core.h
 	app/paintbrush.c app/pencil.c app/preferences_dialog.c
      Minor modifications to support new brush functionality

 Added Files:
 	app/brush_edit.c app/brush_edit.h app/gimpbrush.c
 	app/gimpbrush.h app/gimpbrushgenerated.c
 	app/gimpbrushgenerated.h app/gimpbrushlist.c
 	app/gimpbrushlist.h
      new files to support vector generated brushes and
      reorganization/objectification of the brush class

 Removed Files:
 	app/brushes.c app/brushes.h
    Obsoleted by gimpbrush.? and gimpbrushlist.?

 ----------------------------------------------------------------------
1998-07-09 05:31:06 +00:00
scott
217b494f52 Makefile.am blend.c boundary.c by_color_select.c channel.c color_picker.c
* Makefile.am blend.c boundary.c by_color_select.c channel.c
* color_picker.c drawable_cmds.c fuzzy_select.c gimpimage.c
* image_render.c ink.c layer.c main.c paint_core.c paint_funcs.c
* pixel_region.c plug_in.c tile.c tile.h tile_cache.c tile_manager.c
* tile_swap.c transform_core.c undo.c xcf.c: split off tile_pvt.h
from tile.h so changes in the tile implementation don't force a
complete recompile.
--sg
1998-07-08 06:41:58 +00:00
scott
3423aeff07 splits pixmaps up into two headers fixed a doublelock deadlock --sg
* pixmaps.h pixmaps2.h tools.c: splits pixmaps up into two headers
* tile.c: fixed a doublelock deadlock
--sg
1998-07-06 18:20:28 +00:00
scott
27e90260db Incorporated Adam's copy-on-write patches. Seems to not break anything,
Incorporated Adam's copy-on-write patches.  Seems to not break
anything, but I'm sure they do somewhere. --sg
1998-07-02 23:29:44 +00:00
Manish Singh
5a6bc8de49 Cosmetic fix
-Yosh
1998-07-01 23:37:24 +00:00
Lauri Alanko
6a02cda396 Started gimpset, a generic class for handling collections of
objects. (And to automatically manage their signals, not implemented
yet)

Moved drawable_apply_image to drawable.c

Created a global context object (image_context) to handle the
collection of images that the app manages.
1998-07-01 23:06:49 +00:00
Lauri Alanko
ef3e162eae start collecting some core stuff to libgimpim.a
Started separating crud out of drawables.

	Isolated the id system of images entirely within pdb. Even the
	window titles and menus use pointers instead of ids. Should at
	least remind people that this is a developers' version. :)
1998-06-30 15:31:32 +00:00
Lauri Alanko
5c5c73f3f5 Misc cleaning up here and there. Note that since the ids were used
to detect if an image still exists, some things may, for now,
access freed images and break. This will be fixed once proper
destroy handlers are added.
1998-06-30 01:14:36 +00:00
Lauri Alanko
faeaa7cc23 Removed most of the image id system. They're still used with pdb.
At quick glance, nothing seems to be broken, but if things weird
	out, blame me.

	Now just the same for layers, channels and displays...
1998-06-29 00:24:44 +00:00
Manish Singh
edb4e825e0 corrected typo
* app/Makefile.am: corrected typo

* app/bezier_select.c
* app/rect_select.[ch]: merged in bezier extend patch by Raphael
FRANCOIS (fraph@ibm.net)

* app/menus.c: restored "lost" menu items and shortcuts
These really aren't tools.. maybe they should go somewhere else?

* plug-ins/Lighting/lighting_main.c: added gimp_displays_flush

-Yosh
1998-06-26 08:03:50 +00:00
Manish Vachharajani
e6a03c8573 Ok, try to at least have eraser work for non-xinput devices 1998-06-23 03:41:59 +00:00
Manish Vachharajani
8403ce3308 Fixed eraser pressure sensitivity for non-tablet devices and added Changelog entry 1998-06-23 03:24:19 +00:00
Sven Neumann
d16b3aba04 Rough outline of session-managment. A new config
file 'sessionrc' is written and the position of some windows is
remembered. Still has some problems (offset by wm decorations).
Can be switched off in the preferences.
1998-06-22 17:30:40 +00:00
CDT 1998 Larry Ewing
db79dc64df app/bezier_select.c app/commands.[ch] app/devices.c app/disp_callbacks.c
Sun Jun 21 15:16:46 CDT 1998 Larry Ewing <lewing@gimp.org>

	* app/bezier_select.c
	* app/commands.[ch]
	* app/devices.c
	* app/disp_callbacks.c
	* app/interface.c
	* app/menus.c
	* app/pixmaps.h
	* app/tools.[ch]
	* app/undo.c: Lots of changes to the way tools are intialized and
	accessed.  All information about a tool type is now contained in a
	single ToolInfo array.  There are still some small issues to
	adress about tool groups and we need some way of getting menu
	ordering/grouping to work better (plug-ins need this too).  There
	is still much to be done, but this is the next in cleaning up the
	tools.

	* app/posterize.[ch]
	* app/threshold.[ch]
	* app/histogram_tool.[ch]
	* app/hue_saturation.[ch]
	* app/levels.[ch]
	* app/brightness_contrast.[ch]
	* app/by_color_select.[ch]
	* app/color_balance.[ch]
	* app/curves.[ch]: Changed the *_initalize function prototypes from
	gpointer to GDisplay, to allow better type chacking and provide a
	uniform interface for all the dialog tools.
1998-06-21 20:17:21 +00:00
Owen Taylor
2d46c61b87 Set active_tool before updating device status dialog.
Sun Jun 21 15:49:43 1998  Owen Taylor  <otaylor@gtk.org>

	* app/tools.c (tools_select): Set active_tool before
	updating device status dialog.
1998-06-21 19:55:33 +00:00
Manish Vachharajani
343574c669 Make eraser sensitive to pressure from xinput devices 1998-06-21 15:37:48 +00:00
Owen Taylor
77b19d2d99 Shift the range to smaller brushes. (1/8 - 25 pixel radius, instead of
Thu Jun 18 23:11:36 1998  Owen Taylor  <otaylor@gtk.org>

	* app/ink.c: Shift the range to smaller brushes.
	(1/8 - 25 pixel radius, instead of 1-100 pixels)
1998-06-19 03:16:42 +00:00
Owen Taylor
95118f347f Removed calls to gtk_container_[dis/en]able_resize()
Thu Jun 18 21:20:12 1998  Owen Taylor  <otaylor@gtk.org>

	* app/interface.c app/tools.c: Removed calls to
	  gtk_container_[dis/en]able_resize()

Thu Jun 18 21:03:33 1998  Owen Taylor  <otaylor@gtk.org>

	* app/interface.c (create_display_shell): Set the resize
	mode on the statusbar to prevent the window from being
	unnecessarily auto-shrunk.

	* plug-ins/gfig/gfig.c (my_gtk_label_set): Removed unused
	function using deprecated gtk_container_need_resize()

Thu Jun 18 16:31:16 1998  Owen Taylor  <otaylor@gtk.org>

	* app/blob.c: Try to prevent overflows when drawing ellipses)
	(fixes the ink => line bug for big sizes)
1998-06-19 01:39:02 +00:00
CDT 1998 Larry Ewing
8e6f42e4cf added menu entry and changed loop bounds to get the new ink tool
Tue Jun 16 15:06:19 CDT 1998 Larry Ewing <lewing@gimp.org>

	* app/interface.c:
	* app/menus.c: added menu entry and changed loop bounds to get the
	new ink tool functioning properly

	* app/tools.[ch]: added new and free funcs to the ToolInfo struct,
	and began small cleanup of tools
1998-06-16 20:09:19 +00:00
Owen Taylor
b0e08ede22 Added new files for handling scan-converted convex polygons. (From gsumi)
Sun Jun 14 18:37:06 1998  Owen Taylor  <otaylor@gtk.org>

	* Makefile.am app/blob.[ch] (blob_bounds): Added new files for
	handling scan-converted convex polygons. (From
	gsumi) (these will be moved out to a plug-in tool directory
	when such a thing exists)

	* app/ink.[ch]: New tool for drawing with a hard-edged
	pressure and tilt-sensitive brush.

	* gimprc.c interface.c paint_core.c pixmaps.h tools.[ch]
	All the modifications for adding a new tool. We need
	to fix this.
1998-06-14 22:42:36 +00:00
Manish Singh
5cc38d44a2 divide paint mode stuff
-Yosh
1998-06-09 04:04:43 +00:00
Owen Taylor
46d0250869 Simple pressure sensitivity.
Mon Jun  8 22:09:07 1998  Owen Taylor  <otaylor@gtk.org>

	* app/airbrush.c: Simple pressure sensitivity.
1998-06-09 02:06:33 +00:00
Owen Taylor
f6a5a9383c app/Makefile.am app/app_procs.c app/brushes.c app/commands.[ch]
Fri Jun  5 22:37:40 1998  Owen Taylor  <otaylor@gtk.org>

	* app/Makefile.am app/app_procs.c app/brushes.c app/commands.[ch]
	  app/disp_callbacks.c app/gdisplay.[ch] app/gimprc.c
	  app/interface.[ch] app/menus.c app/paint_core.[ch]
	  app/paintbrush.c app/palette.c app/scroll.c
	  app/tools.[ch] app/undo.c

	- Added two new dialogs - input devices; (GtkInputDialog)
	  and DeviceStatus - which shows the tool/color for
	  each device.

	- Added device_status_update() call that gets called
	  whenever the tool/color etc. are changed.

	- Added ~/.gimp/devicerc file to store settings

	- Code to draw cursor on canvas for non XFree86 XInput
	  where device can't control cursor and extended input
	  device simultaneously.

	- Changed input handling so that we always use the pointer
	  position from the device, not from gdk_input_window_get_cursor,
	  so that motion and cursor position sync.

	- Various changes so things work with non-integer coordinates

	- Pay attention to pressure and tilt in basic tool support.

        - New paint mode PRESSURE that changes the brush based on
	  the brush pressure

	- Left in a few XInput hacks that should be removed, but I no longer
	  remember what they are.
1998-06-06 03:49:01 +00:00
Manish Singh
6ddbb705a3 more g_message changes
* more g_message changes

* CEL plugin update

* INSTALL: info on why plugins don't get built

-Yosh
1998-05-30 07:32:37 +00:00
Manish Singh
1d95a05af0 gimp_message. libgimp also overrides g_message for all plugins. Converted
* redid the error message handling. g_message now calls message_box or prints
to console depending on whether the no_interface is set or not. gimp-message
is also exported to the PDB as a wrapper to g_message, and libgimp has a new
API: gimp_message. libgimp also overrides g_message for all plugins. Converted
lots of messages in app/* to g_message. Made script-fu a little friendlier.

* updated the regex code from grep 2.2

* said goodbye to the old script-fu logo in script-fu.h

-Yosh
1998-05-28 09:03:57 +00:00
Manish Singh
bc539b9a3a do "-" to "_" conversion after an failed pdb lookup, just to make sure
* app/batch.c: do "-" to "_" conversion after an failed pdb lookup, just to
make sure

* app/paint_core.c: fix for some uninitialized vars

-Yosh
1998-05-26 19:06:03 +00:00
EDT 1998 Matthew Wilson
cbf41509e9 fixed bezierify on offset layers
Fri May 15 03:03:00 EDT 1998  Matthew Wilson  <msw@gimp.org>

        * app/iscissors.c: fixed bezierify on offset layers

--Matt
1998-05-15 07:03:47 +00:00
EDT 1998 Matthew Wilson
74b6888036 a very sad attempt to fix some iscissors lockups/segfaults --Matt
Thu May 14 21:18:27 EDT 1998  Matthew Wilson  <msw@gimp.org>

        * app/iscissors.c: a very sad attempt to fix some iscissors
        lockups/segfaults
--Matt
1998-05-15 01:20:29 +00:00
Manish Singh
343aef675b added --install-bin options for installing already built plugins
* gimptool.in: added --install-bin options for installing already built plugins

* app/convolve.c: check for indexed images properly

* app/layer.c: fix tile refcount oversight

* app/text_tool.c: fix for unlikely memleak

* libgimp/gimpimage.c: stupid ytpo ;)

* plug-ins/gfli/gfli.c: applied gimp-wh-980507-0 to fix "chunk-type-7-bug"

-Yosh
1998-05-12 00:12:47 +00:00
Manish Singh
f15158ace9 another special case fix from Nick Lamb. I said it before, and I'll say it
* plug-ins/tiff/tiff.c: another special case fix from Nick Lamb. I said it
before, and I'll say it again: TIFF sucks

* app/fuzzy_select.c: find_boundary works nicer in indexed mode

* app/paint_funcs.c: generate dissolve random number table better (thanks Owen)

* README: bring up to date

-Yosh
1998-05-02 07:44:58 +00:00
EDT 1998 Matthew Wilson
821bbbc475 Another small change to keep the segfaults away An attempt to squelch some
Thu Apr 30 03:15:51 EDT 1998 Matthew Wilson <msw@gimp.org>

        * app/curves.c: Another small change to keep the segfaults away
        * app/disp_callbacks.c: An attempt to squelch some warnings
--Matt
1998-04-30 07:16:54 +00:00
Manish Singh
c7712c9cb4 don't die on corrupted fonts. Give some error messages instead.
-Yosh
1998-04-29 08:47:24 +00:00
Tim Janik
2114b5abeb enable adjustment of the scrolled window to keep the focused font visible.
Wed Apr 29 00:56:19 1998  Tim Janik  <timj@gtk.org>

        * app/text_tool.c (text_create_dialog): enable adjustment of the
                scrolled window to keep the focused font visible.
1998-04-28 23:03:26 +00:00
Matt Wilson
010dc35e8a Wee!!! No more curves crash! (Hopefully ;) Watch for this kind of stuff
in other dialog code.  Widget event handlers get called before the data that
they reference gets initialized.  Move all that init code inside the dialog
creation.

-Matt
1998-04-28 01:01:34 +00:00
Manish Singh
5e4287a181 app/procedural_db.c applied mem leak patch from Mattias Gronlund
* app/procedural_db.c
* app/text_tool.c: applied mem leak patch from Mattias Gronlund

* plug-ins/tiff/tiff.c: fix for indexed save from Dan Mitchell

-Yosh
1998-04-26 23:28:04 +00:00
Manish Singh
8137f724ef Added sharpen to stable dist
* Added sharpen to stable dist

* updated sgi and despeckle plugins

* plug-ins/xd/xd.c: works with xdelta 0.18. The use of xdelta versions prior
to this is not-supported.

* plug-in/gfig/gfig.c: spelling corrections :)

* app/fileops.c: applied gimp-gord-980420-0, fixes stale save procs in the
file dialog

* app/text_tool.c: applied gimp-egger-980420-0, text tool optimization

-Yosh
1998-04-24 02:18:52 +00:00
EDT 1998 Matthew Wilson
405af739a0 removed the tool reset when changing gdisplays stop draw_core when
Tue Apr 21 15:11:21 EDT 1998 Matthew Wilson <msw@gimp.org>

	* app/disp_callbacks.c: removed the tool reset when changing gdisplays
	* app/bezier_select.c: stop draw_core when changing gdisplays
--Matt
1998-04-21 20:07:53 +00:00
Matt Wilson
aaaeed098b Tus Apr 21 01:59:12 EDT 1998 Matthew Wilson <msw@gimp.org>
* app/iscissors.c: Remove the iscissors outline by stopping the
	draw_core before bezierifying the selection.  There may be
	memory leaks here (the iscissors stuff does not appear to be freed
	on bezierify)

--Matt
1998-04-21 18:31:09 +00:00
Sven Neumann
41d17fb403 Changed the toggle_buttons in the iscissors tool options dialog to
check_buttons, since all tools use them and we should try to have a
consistent interface.


--Sven
1998-04-15 15:47:34 +00:00
Manish Singh
0ecdced2c1 partially applied gimp-monniaux-980413-0, corrects nonfunctional interface
elements

-Yosh
1998-04-14 23:17:58 +00:00
Sven Neumann
c5d9a5e9b8 Changed the Ok and Cancel buttons in the histogram dialog to a simple Close,
because that's what they were actually doing.


--Sven
1998-04-13 21:59:28 +00:00
Manish Singh
84abd5d700 Have fun recompiling gimp everyone. It's the great FSF address change!
-Yosh
1998-04-13 05:44:11 +00:00
Manish Singh
6ea6e68604 more fixes... when will it all end...
* configure.in: more fixes... when will it all end...

* plug-ins/xd/xd.c: compile with >= 0.15 now

* app/transform.[ch]: applied gimp-alt-980412, fixes control point selection
for transforms

-Yosh
1998-04-12 08:27:16 +00:00
EDT 1998 Matthew Wilson
84bf7845f9 Don't destroy tool.
Wed Apr  8 01:40:45 EDT 1998 Matthew Wilson <msw@gimp.org>

	* app/by_color_select.c: Don't destroy tool.

--Matt
1998-04-08 05:50:36 +00:00
Matt Wilson
e43fc9027c Sun Apr 5 17:43:50 EDT 1998 Matthew Wilson <msw@gimp.org
* app/bezier_select.c: Destroy the tool when changing displays.
	* app/command.c: initialize pointers to drawables when selecting
	tools
	* app/disp_callbacks.c: initialize pointers to drawables on first
	click of a gdisplay
	* app/gimage.c: removed extra tool destruction
	* app/tools.c: make a fallback case when starting tools so that
	you'll always have an active tool.

--Matt
1998-04-05 22:49:16 +00:00
Sven Neumann
69fc983a33 Added buttons to access the menu functions in the Layers&Channels-dialog
more directly. They are connected to the menu-item-callback-functions.


--Sven
1998-04-03 10:29:25 +00:00
EST 1998 Matthew Wilson
70d84d2eba added a change to make a note of the current drawable in the
Thu Apr  2 01:49:34 EST 1998 Matthew Wilson <msw@gimp.org>

	* app/transform_core.c: added a change to make a note of the
	current drawable in the button_release.  This prevents the tool
	from being restarted when the transform_core makes a floating
	selection.
	* app/tools.c: Initialize the current drawable to NULL if
	there is gdisp == NULL.

--Matt
1998-04-03 06:51:56 +00:00
Matt Wilson
0fee9209e3 Thu Apr 2 23:52:54 EST 1998 Matthew Wilson <msw@gimp.org
* app/gimage.c
	* app/tools.c: Made changes to restart tools properly when
	the current drawable changes.

--Matt
1998-04-03 05:01:32 +00:00
Matt Wilson
f75645a26c Wed Apr 1 11:10:15 EST 1998 Matthew Wilson <msw@gimp.org
* app/brightness_contrast.c
	* app/by_color_select.c
	* app/color_balance.c
	* app/color_picker.c
	* app/curves.c
	* app/histogram_tool.c
	* app/hue_saturation.c
	* app/levels.c
	* app/posterize.c
	* app/threshold.c
	* app/transform_core.c: modified to call the cancel callback
	instead of the ok callback when freed.  modified to save the
	last used drawable so that we might be able to check later
	and restart the tool if need be.

	* app/disp_callbacks.c
	* app/gimage.c: modified tool restart/destruction code

	* app/tools.c
	* app/tools.h: added tools_initialize, made changes to
	be able save the last used drawable in the tool.

--Matt
1998-04-02 04:51:44 +00:00
Sven Neumann
abdc50068d Applied gimp-simon-980331-0. Cosmetic change to the Layers&Channels-dialog.
I will hopefully finish my changes to the dialog tonight and will upload a
new version of my patch. Could you (the core developers) please make up your
mind whether to include it in 1.0 or not...

The Blend-Tool dialog now changes the repeat_mode_menu to insensitive when
the Gradient-Type is one of the Shapeburst-types.


--Sven
1998-04-01 18:48:34 +00:00
EST 1998 Matthew Wilson
beb9573a9b Set tool->preserve to TRUE in tools_new_iscissors.
Tue Mar 31 03:10:12 EST 1998 Matthew Wilson <msw@gimp.org>

	* app/iscissors.c: Set tool->preserve to TRUE in tools_new_iscissors.

--Matt "forgets files when committing" Wilson
1998-03-31 08:04:22 +00:00
EST 1998 Matthew Wilson
7dcd8e85ab app/gimage.c app/tools.c Added a field in the Tools struct, preserve.
Tue Mar 31 02:21:15 EST 1998 Matthew Wilson <msw@gimp.org>

	* app/gimage.c
	* app/tools.c
	* app/tools.h: Added a field in the Tools struct, preserve.
	During gimage_dirty, if this flag is not set the tool will be
	reset.  This is good for tools that keep a copy of the image
	in cache for local manipulation like transform_core.

	* app/bezier_select.c
	* app/blend.c
	* app/brightness_contrast.c
	* app/bucket_fill.c
	* app/color_balance.c
	* app/color_picker.c
	* app/crop.c
	* app/curves.c
	* app/ellipse_select.c
	* app/free_select.c
	* app/histogram_tool.c
	* app/hue_saturation.c
	* app/levels.c
	* app/move.c
	* app/paint_core.c
	* app/posterize.c
	* app/rect_select.c
	* app/text_tool.c
	* app/transform_core.c: Set the preserve flag to the correct
	values in the new functions and wrapped calls to functions that
	dirty the gimage to prevent tool restarts.

	* app/disp_callbacks.c
	* app/menus.c: Removed Nether's tool patch.

--phew.  Matt
1998-03-31 07:23:50 +00:00
Manish Singh
bd6b3ae4b9 app/brush_select.c get rid of unused variable warnings
* app/brush_select.c
* app/iscissors.c: get rid of unused variable warnings

* app/fileops.c: refresh the filesel better

* app/plug_in.c: make sure everything gets initialized to something in the
plug-in struct

-Yosh
1998-03-31 06:08:08 +00:00
Sven Neumann
83ef9d15b3 By-color-select now checks if the image it is working on still exists.
This fixes the crashes when closing an image with the by-color-select-dialog
associated to it still open and pressing "Reset" or clicking into the preview.

The checks produce some warnings like
** WARNING **: invalid class type (unknown)' in cast to impDrawable'
when failing, but I consider this less evil than a crash.

There is still a problem: Sometimes the by-color-select-dialog is closed
when the image is closed and can't be opened anymore. Anyone?


--Sven
1998-03-30 12:10:54 +00:00
EST 1998 Matthew Wilson
57c8796d53 Offset brush buffer when painting on edges of the canvas. Set window to
Fri Mar 26 03:13:15 EST 1998 Matthew Wilson <msw@gimp.org>
	* app/paint_core.c: Offset brush buffer when painting on edges
	of the canvas.
	* app/text_tool.c: Set window to auto_shrink = FALSE

-Matt
1998-03-27 08:13:45 +00:00
EST 1998 Matthew Wilson
2bdb815447 app/iscissors.c Change to select the bezier tool properly when converting
Fri Mar 26 01:30:45 EST 1998 Matthew Wilson <msw@gimp.org>
	* app/iscissors.c
	* app/bezier_select.c: Change to select the bezier tool properly
	when converting from iscissors to bezier

-Matt
1998-03-27 06:29:39 +00:00
Nate Summers
1d3eb2375d No more sigsegv lalalalalalalala 1998-03-27 00:42:56 +00:00
Nate Summers
4f901c84da fix a typo (i where a j should be)
* app/iscissors.c: fix a typo (i where a j should be)
1998-03-26 23:32:55 +00:00
Nate Summers
bf0a1c431c This version works much better. outstanding bugs <VERY IMPORTANT>:
* app/iscissors.c: This version works much better.
        outstanding bugs <VERY IMPORTANT>:

        1. the edgemap does not seem to be constructed quite right
        (construct_edge_map) -- uncomment #define
        ISCISSORS_STILL_DOES_NOT_WORK and take a look at the edgemap -- it
        will be saved to the file "dump"

        2. sigsegvs if the layer offset isn't 0,0.  dunno why.

        3. convert to bezier still does not work!  Any tools experts wanna
        help me with it?  (it converts to bezier fine, it just doesn't set
        the active tool to bezier currectly.)
1998-03-26 22:37:08 +00:00
Nate Summers
cdd1e67305 fixes the display artifact where the preview outline of the selected area
* app/iscissors.c: fixes the display artifact where the preview
outline of the selected area would not appear or would appear in
the wrong place or have the wrong shape
1998-03-26 19:17:42 +00:00
Nate Summers
0b9cf33499 This should hopefully fix most of the UMRs (uninitialized memory reads)
* iscissors.c: This should hopefully fix most of the UMRs
(uninitialized memory reads) found with Purify.  No noticable
change in iscissors's behavior, unfortunately.
1998-03-26 19:03:10 +00:00
Manish Singh
4119ff4245 Fix speeling error.
-Yosh
1998-03-26 05:49:30 +00:00
Nate Summers
49f2e5601c iscissors.c: fix a problem of using uninitialize variables 1998-03-26 05:42:33 +00:00
Manish Singh
c26040d182 corrected test for libXmu for some systems; added test for difftime
* configure.in: corrected test for libXmu for some systems; added test for
difftime

* app/main.c: use glib ATEXIT macro

* app/text_tool.c: applied gimp-stric-980321-0 (text preview refresh)

* plug-ins/script-fu/script-fu-console.c: don't need to init gtkpreview stuff,
since we don't use them

* plug-ins/script-fu/*: many portability fixes

* plug-ins/pnm/pnm.c: sprintf portability patch

* plug-ins now #define RAND_MAX if needed

* plug-ins/sparkle/sparkle.c: applied gimp-joke-980322-1

-Yosh
1998-03-25 02:17:42 +00:00
Manish Singh
09a5fde1ce app/gimage_mask.c applied patch from Ben Jackson to fix fractional pixel
* app/gimage_mask.c
* app/paint_core.c: applied patch from Ben Jackson to fix fractional pixel
errors and reverted the old fix.

* app/paint_funcs.h: changed the #defines for ERASE_MODE and REPLACE_MODE to
correctly match layer_modes[]

-Yosh
1998-03-24 02:18:58 +00:00
Adrian Likins
1bfe515fe1 gimp-joke-980321
* app/iscissors.c, app/tips_dialog.c, app/gradient.c,
        libgimp/gimp.c, plug-ins/AlienMap/AlienMap.c,
        plug-ins/bmp/bmp.c, plug-ins/fits/fitsrw.h,
        plug-ins/fits/fitsrw.c, plug-ins/flarefx/flarefx.c,
        plug-ins/gfig/gfig.c, plug-ins/gfli/gfli.c,
        plug-ins/gicon/gicon.c, plug-ins/gqbist/gqbist.c,
        plug-ins/gtm/gtm.c, plug-ins/hot/hot.c,
        plug-ins/ifscompose/ifscompose.c,
        plug-ins/ifscompose/ifscompose_utils.c
        plug-ins/max_rgb/max_rgb.c, plug-ins/nlfilt/nlfilt.c,
        plug-ins/pat/pat.c, plug-ins/pcx/pcx.c, plug-ins/rotate/rotate.c,
        plug-ins/script-fu/script-fu-server.c, plug-ins/snoise/snoise.c,
        plug-ins/threshold_alpha/threshold_alpha.c,
        plug-ins/zealouscrop/zealouscrop.c :gimp-joke-980321

        plug-ins/CML_explorer, plug-ins/autocrop,
        plug-ins/align_layers, plug-ins/blinds,
        plug-ins/bmp, plug-ins/megawidget: gimp-joke-980322

        Applied gimp-joke-980322-0.patch and gimp-joke-980321-0.patch
        from Yasuhiro SHIRASAKI <joke@awa.tohoku.ac.jp>. Mostly
        portability for DEC osf1's cc. Lots of MAIN();'s, trailing
        commas in enums, and guchar/gchar madness.

	Gimp now sends mail, cleans vinyl records,
	removes stubborn stains, julien fries, and more!

-adrian
1998-03-22 20:44:39 +00:00
Manish Singh
23f486db2a #define M_PI_4 if not already
-Yosh
1998-03-20 03:57:42 +00:00
Manish Singh
b07e146676 Applied gimp-jbuhler-980315-0
-Yosh
1998-03-19 09:10:25 +00:00
Manish Singh
7cb1950fd7 M_PI madness...
-Yosh
1998-03-18 23:40:52 +00:00
Adrian Likins
9132cbb666 appied most of gimp-hpux-980316-0.patch from ???? Mostly added static's
* blend.c brightness_contrast.c brush_select.c brushes.c
          bucket_fill.c by_color_select.c channels_dialog.c
          color_balance.c convolve.c crop.c curves.c eraser.c fileops.c
          frac.c gradient.c histogram_tool.c hue_saturation.c
          image_render.c indexed_palette.c layers_dialog.c levels.c
          move.c paintbrush.c pattern_select.c pencil.c
          perspective_tool.c posterize.c rect_select.c scale_tool.c
          threshold.c tips_dialog.c:
                 appied most of gimp-hpux-980316-0.patch
        from ???? Mostly added static's here and there
         and casting stuff.

        * app/indexed_palette.c: made dialog non-resizeable

-adrian
1998-03-18 22:35:31 +00:00
Sven Neumann
3c5699b11d Fixed an indented #define.
--Sven
1998-03-18 20:20:20 +00:00
Manish Singh
7a90885404 More iscissors fun. Corrected error in HACKING
More iscissors fun.
Corrected error in HACKING

-Yosh
1998-03-16 23:59:27 +00:00
CST 1998 Larry Ewing
d5cfeb6643 Reworked the guide drawing and picking code to remove all known guide
Mon Mar 16 05:12:00 CST 1998  Larry Ewing  <lewing@gimp.org>

	* app/move.c:
	* app/gdisplay.c:
	* app/gimage.c: Reworked the guide drawing and picking code to
	remove all known guide artifacts.
1998-03-16 11:13:24 +00:00
Manish Singh
9610c8c901 new, improved, still buggy iscissors! correctly hide the file selector a
* app/iscissors.c: new, improved, still buggy iscissors!
* app/fileops.c: correctly hide the file selector
* app/transform_core.c: a better fix for the display artifacts
* added aa plugin back in

-Yosh
1998-03-15 02:46:15 +00:00
Manish Singh
374b123995 updated to use libtool 1.1
* updated to use libtool 1.1

* app/transform_core.c: fixed display artifacts for the transform tools, sorta.

* plug-ins/pcx/pcx.c: updated pcx plug-in

and some admistrivia

-Yosh
1998-03-14 23:21:07 +00:00
Sven Neumann
b3d28f6fdb Applied gimp-edas-980305-0.patch (after a small fix).
Now registry and encoding can be choosen in the text tool and
two new pdb-functions are available to access this functionality.

Changed i26-gunya2.scm to make it follow the naming-convention.


--Sven
1998-03-14 16:24:56 +00:00
Manish Singh
0a3e54e10a Doh.. good to increase buffer length too... grep lied to me.
-Yosh
1998-03-13 08:57:18 +00:00
Manish Singh
591abe973e Added display of hex triplets for HTML people
-Yosh
1998-03-13 08:53:33 +00:00
Manish Singh
382eb47914 Fix for select by color on multilayer indexed images. Turned it back on for
indexed images.
Quelled warnings about uninited vars in disp_callbacks.
Updated COPYING files with latest FSF address.

-Yosh
1998-03-13 03:35:33 +00:00
Tim Janik
2b52f8a864 fixed a lot of the destroy handlers and delete_event handlers, still
not everything perfect, though.
-timj
1998-03-12 22:01:43 +00:00
Manish Singh
1fe238af74 More fixes for .20
-Yosh
1998-03-12 06:43:44 +00:00
Manish Singh
154bc6ca0d iscissors update changes for .20 release
iscissors update
changes for .20 release

-Yosh
1998-03-12 05:43:35 +00:00
Manish Singh
89ec6691ee fixed memory overrun error
* app/convert.c: fixed memory overrun error

* app/gdisplay.c
* app/menus.c: reapplied the tools patch from Nether, looks
like it doesn't trip up anymore. Added some sanity checks
anyway

* app/disp_callbacks.c
* app/transform_core.c: plugged some harmless build warnings

-Yosh
1998-03-11 08:58:42 +00:00
Manish Singh
13d0beecb4 Bye naughty flip tool bug and other transform problems. You add alpha
correctly now.

-Yosh
1998-03-10 08:44:59 +00:00
Manish Singh
7bf752c87b Cleanups for 0.99.19 release
-Yosh
1998-03-02 02:47:35 +00:00
Manish Singh
0fc01db1ed Fixed a stoopid speeling erorr.
-Yosh
1998-03-01 06:06:19 +00:00
Manish Singh
2afd3ffb75 From the Changelog:
* Makefile.am: don't do docs generation by default

        * configure.in: -lXt for webbrowser plugin

        * libgimp/gimp.c
        * libgimp/gimpprotocol.c
        * libgimp/gimptile.c
        * libgimp/gimpwire.c
        * app/plug_in.c: applied memory leak patch from Mattias Gronlund

        * app/eraser.c
        * app/eraser.h
        * app/internal_procs.c
        * app/paintbrush.c
        * app/paintbrush.h: incremental modes for eraser and paintbrush,
        as well as a "hard eraser"

        * plug-ins/ifscompose/ifscompose.c: pixmap visual fixups

-Yosh
1998-03-01 01:18:45 +00:00
Manish Singh
ae7184b6fa Use our own sort function, because the glib sort doesn't work for us
anymore.

-Yosh
1998-02-22 10:45:12 +00:00
Manish Singh
33944dab1c iscissors for public consumption
-Yosh
1998-02-14 23:35:56 +00:00
scott
411e605ebd More refcounting stuff.
--sg
1998-02-14 00:44:47 +00:00
Manish Singh
d6a289869a Another iscissors update... beat on it some everyone
Made gtkmultioptionmenu more analogous to the current gtk optionmenu.

-Yosh
1998-02-08 00:43:39 +00:00
Tim Janik
8fd700c869 added some variable initializations.
segfaults appear less spurious now.
-timj
1998-02-05 03:52:22 +00:00
Manish Singh
0a3253096d In the middle of all this gtk hoopla, iscissors sorta, kinda, almost works
now.

-Yosh
1998-02-04 04:43:33 +00:00
Adrian Likins
bae5bae79d *plug-ins/ edge.c added a check so it woudlnt segfault when passed a
*plug-ins/ edge.c
                added a check so it woudlnt segfault when
        passed a non-existend drawable

        threshold_alpha  added a non-interactive mode

        *app/brightness_contrast.c
         app/color_balance.c
         app/colormaps.c
         app/curves.c
         app/hue_saturation.c
         app/posterize.c
         app/threshold.c

                -added a check so it wouldnt except
         a indexed drawable. This was previosly possible via the pdb.

-adrian
1998-02-01 01:58:47 +00:00
Manish Singh
88bcda0a20 xpm uses g_strcasecmp now
-Yosh
1998-01-31 09:13:49 +00:00
Manish Singh
4e2056a419 Fixed really silly error during the GSList change in xcf.c
Current (still nonfunctional) iscissors code

-Yosh
1998-01-30 01:24:32 +00:00
Manish Singh
7e4a76203a updated refract and warp plugins changed the INSTALL file to reflect the
* updated refract and warp plugins
* changed the INSTALL file to reflect the fact that gtk is a separate package
* app/text_tool.c: small patch for indexed images and antialiased toggle

-Yosh
1998-01-29 09:09:30 +00:00
Manish Singh
89b600d2bc removed all usage of linked.[ch] and switched to GSLists
-Yosh
1998-01-29 08:03:27 +00:00
Adrian Likins
8cd58f4bae Fixed carve-it.scm and circuit.scm (circuit broke due to a plugin update,
* Fixed carve-it.scm and circuit.scm (circuit broke due
         to a plugin update, carve-it broke due to theadd-layer stuff)

        * Added a close button to the color picker info window

        * changed index_palette.c a bit...now if you click with
        MB11, it changes the current active color, clicking with MB3
        opens the color in the color selector for editing

        * Made some of the <Image>/Color/* menus sensitive to the image
        type (gdisplay.c)

-adrian


CVS:
1998-01-29 03:13:44 +00:00
Adrian Likins
c62f70ab13 added a call to gtk_window_set_wmclass to most of the gimp
dialogs

-adrian
1998-01-25 22:13:00 +00:00
Manish Singh
2ce0e15023 Misc changes for .18
* app/indexed_palette.c: fix for wrong color selected in indexed
        palette dialog

        * app/xcf.c: don't crash on bad input (0 byte files)

        * app/plug_in.h
        * app/plug_in.c: fixes Gimp's most obscure bug. Failed plugin
        queries are handle correctly now

        * app/commands.c: added marching ants speed to preferences

        * plug-ins/tiff/tiff.c: correction for inversion for MINISWHITE
        images without alpha

        * plug-ins/pcx/pcx.c: updated to new version

        * app/paint_funcs.h: changed OPAQUE and TRANSPARENT to
        OPAQUE_OPACITY and TRANSPARENT_OPACITY to avoid possible
        conflicts. All affects .c files changed.

-Yosh
1998-01-25 01:24:46 +00:00
scott
c267c55bbe Rewrite to make drawables (layers, channels, layer masks) into GtkObjects.
--sg
1998-01-22 07:02:57 +00:00
Manish Singh
ab52da1735 Commit the junk in my tree before I go back to school:
* ltconfig
        * ltmain.sh: downgraded to libtool 1.0f at Jay's suggestion

        * app/gimage.c: Fix for the "merge to alpha" bug from Nathan
        Summers

        * app/text_tool.c: Fix for the font spec bug from Nathan
        Summers

        * plug-ins/maze/maze.c
        * plug-ins/rotate/rotate.c: updated from registry

        * plug-ins/blur/blur.c
        * plug-ins/randomize/randomize.c
        * plug-ins/vpropagate/vpropagate.c
        * plug-ins/warp/warp.c: more portability fixes for DEC OSF1

-Yosh
1998-01-14 05:44:12 +00:00
Manish Singh
c871eb39a9 From ChangeLog:
* INSTALL: updated to properly reflect installation procedure

        * app/text_tool.c: Fixed bad string in tool description

        * libgimp/gimppixelrgn.c: tiles aren't marked dirty in
        gimp_pixel_rgn_get_pixel

        * plug-ins/edge/edge.c
        * plug-ins/edge/emboss.c
        * plug-ins/edge/laplace.c
        * plug-ins/edge/sobel.c: DEC OSF1 cannont handle reference to
        array element with a negative arugment with an unsigned int
        (gimp-joke-980108-0)

        * plug-ins/sinus/sinus_logo.h: got rid of really long string

        * plug-ins/refract/Makefile.am
        * plug-ins/refract/refmain.c: fixed megawidget reference

        * plug-ins/xpm/xpm.c: made our own case-insenstive strcmp
        for checking for transperancy

-Yosh
1998-01-09 09:26:28 +00:00
Manish Singh
3d3d8eac4a fix for indexed images
* app/by_color_select.c: fix for indexed images

        * plug-ins/script-fu/scripts/i26-gunya2.scm: proper registration

        * plug-ins/xpm.c: fix for transparent images

        * Updated to libtool 1.0h

        * libgimp/Makefile.am: removed spurious -rpath

-Yosh
1998-01-06 03:44:53 +00:00
Manish Singh
1e24291db2 Check for div-by-zero in by_color_select.c when threshold is 0
The text tool handles the no fonts case better
Minor bug in tile saving squashed
updated png plugin
added flarefx plugin

-Yosh
1998-01-05 09:30:23 +00:00
Manish Singh
a4e97e61f9 Lots o' changes for 0.99.17. See ChangeLog for details.
-Yosh
1998-01-04 00:43:51 +00:00
Eric L. Hernes
0f1c6e81be back out the previous botch
-Eric
1997-12-23 17:10:46 +00:00
Shawn Amundson
81eb53df7b Changes from Owen Taylor which allow GIMP to compile with
new GTK changes.  ChangeLog is more specific.

-Shawn
1997-12-18 06:30:11 +00:00
People doing a 16 bpc version of gimp
e8f7ed532c fix problem where menus_activate_callback() causes tool options dialog to
appear empty by destroying the active tool.
  rayl@netrover.com
1997-12-15 03:18:13 +00:00
People doing a 16 bpc version of gimp
a07e23927d fixed div-by-zero when using custom gradients with offset 100
rayl@netrover.com
1997-12-15 00:21:15 +00:00
Eric L. Hernes
f447cb8efe make the airbrush behave like paintbrush when called non-interactively...
just try to draw a box non-interactively with the airbrush before
this patch...

Eric.
1997-12-09 01:39:08 +00:00
Manish Singh
7d148f0288 Added Sven's patch for the scale and resize dialogs
Added Raph's patch for the transperancy blur problem
1997-12-08 01:13:10 +00:00
Gnome CVS User
05c73c4146 Several fixes, most notably a bug in undo when drawing outside an image,
and the "out of paint bug".
1997-11-26 19:30:17 +00:00
Elliot Lee
32cefec8f7 Initial revision 1997-11-24 22:05:25 +00:00