2004-09-01 08:26:48 -07:00
|
|
|
|
2004-09-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.c
|
|
|
|
|
|
* app/widgets/gimpprogressdialog.c: gracefully handle progress
|
|
|
|
|
|
calls after the widget is destroyed. Re-fixes bug #150194.
|
|
|
|
|
|
|
2004-09-01 07:01:10 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.[ch]
|
|
|
|
|
|
* libgimpwidgets/gimppreview.[ch]: always show the "Preview" check
|
|
|
|
|
|
button. Simplified the preview APIs, moved the "size" style
|
|
|
|
|
|
property to the GimpPreview class.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/gtkrc: changed the example accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/despeckle.c
|
|
|
|
|
|
* plug-ins/common/gauss.c
|
|
|
|
|
|
* plug-ins/common/neon.c
|
|
|
|
|
|
* plug-ins/common/sobel.c
|
|
|
|
|
|
* plug-ins/common/softglow.c
|
|
|
|
|
|
* plug-ins/common/spread.c
|
|
|
|
|
|
* plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API.
|
|
|
|
|
|
|
2004-09-01 06:51:51 -07:00
|
|
|
|
2004-09-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
2004-09-01 08:26:48 -07:00
|
|
|
|
* plug-ins/script-fu/script-fu-types.h (struct SFOption): changed
|
2004-09-01 06:51:51 -07:00
|
|
|
|
"guint history" to "gint history".
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-interface.c: added callbacks for
|
|
|
|
|
|
string entries and combo boxes and connect *all* widgets to callbacks.
|
|
|
|
|
|
|
|
|
|
|
|
(script_fu_ok): don't touch the widgets at all but get the values
|
|
|
|
|
|
directly now that the callbacks correctly write them to their
|
|
|
|
|
|
structs.
|
|
|
|
|
|
|
|
|
|
|
|
(script_fu_reset): don't copy the default values manually but
|
|
|
|
|
|
simply set the default values on the widgets; their callbacks will
|
|
|
|
|
|
do the rest.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script):
|
|
|
|
|
|
added some line breaks and spaces to make it more readable.
|
|
|
|
|
|
|
2004-09-01 05:38:41 -07:00
|
|
|
|
2004-09-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* libgimp/gimpui.h
|
|
|
|
|
|
* libgimp/gimpuitypes.h
|
|
|
|
|
|
* libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which
|
|
|
|
|
|
automatically redirects any progress calls to itself while
|
|
|
|
|
|
it exists.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-interface.c: removed all progress
|
2004-09-01 08:26:48 -07:00
|
|
|
|
callbacks and simply use a GimpProgressBar.
|
2004-09-01 05:38:41 -07:00
|
|
|
|
|
2004-09-01 05:10:09 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.[ch]: set a busy cursor while the
|
|
|
|
|
|
preview is being recalculated.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original):
|
|
|
|
|
|
do nothing if there's no drawable.
|
|
|
|
|
|
|
2004-09-01 01:18:13 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-09-01 01:50:52 -07:00
|
|
|
|
* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x
|
|
|
|
|
|
and y variables.
|
|
|
|
|
|
|
2004-09-01 01:18:13 -07:00
|
|
|
|
* libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup.
|
|
|
|
|
|
|
2004-09-01 00:57:15 -07:00
|
|
|
|
2004-09-01 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/gimpfu.py
|
|
|
|
|
|
* plug-ins/pygimp/gimpmodule.c: Hacked up support for the new
|
|
|
|
|
|
progress interface. Emphasis on hacked.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor
|
|
|
|
|
|
cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/pygimp-image.c
|
|
|
|
|
|
* plug-ins/pygimp/pygimp-tile.c: Minor cleanups.
|
|
|
|
|
|
|
2004-08-31 22:30:47 -07:00
|
|
|
|
2004-08-31 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/plug-ins/gimpcons.py
|
|
|
|
|
|
* plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop
|
|
|
|
|
|
calls.
|
|
|
|
|
|
|
2004-08-31 19:10:40 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c: increased default preview size to
|
2004-08-31 19:36:42 -07:00
|
|
|
|
150 pixels. Added a border of 2 pixels around the bounding box of
|
2004-08-31 19:10:40 -07:00
|
|
|
|
the selection.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor
|
|
|
|
|
|
if there's something to pan. Set the correct page size on the
|
|
|
|
|
|
scrollbar adjustments.
|
|
|
|
|
|
|
2004-08-31 18:18:19 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreviewarea.[ch]: added new function
|
|
|
|
|
|
gimp_preview_area_set_offsets().
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c: use the new function to let the
|
|
|
|
|
|
checkerboard scroll with the preview.
|
|
|
|
|
|
|
2004-08-31 16:37:04 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.[ch]: delay the emission of the
|
|
|
|
|
|
"invalidated" signal using a timeout. Removed hack that used to
|
|
|
|
|
|
invalidate the preview on button-release.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: no need to fiddle with the slider
|
|
|
|
|
|
update policies any longer.
|
|
|
|
|
|
|
2004-08-31 15:41:15 -07:00
|
|
|
|
2004-09-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
|
|
|
|
|
|
gimp_dialog_factory_dialog_new() to let the caller decide whether
|
|
|
|
|
|
the window should be presented or not.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dialogs-commands.c
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/templates-commands.c
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/gui/gui.c
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
|
|
|
|
|
|
gimp_dialog_factory_dialog_new() present the dialog if we need to
|
|
|
|
|
|
change it after creation. This avoids annoying resizes, noticeable
|
|
|
|
|
|
especially with the error dialog.
|
|
|
|
|
|
|
2004-08-31 14:29:30 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.c
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
|
|
|
|
|
|
|
2004-08-31 14:15:03 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c: added a style property for the
|
|
|
|
|
|
minimum size.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/gtkrc: show how to adjust the size of GimpDrawablePreviews.
|
|
|
|
|
|
|
2004-08-31 14:07:35 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.c
|
|
|
|
|
|
(gimp_data_factory_view_activate_item): emit "clicked" on the
|
|
|
|
|
|
edit_button only if it exists and is sensitive. Fixes bug #151343.
|
|
|
|
|
|
|
2004-08-31 13:30:23 -07:00
|
|
|
|
2004-08-31 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message
|
|
|
|
|
|
to GSourceFunc.
|
|
|
|
|
|
|
2004-08-31 13:12:58 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c: handle the widget size dynamically.
|
|
|
|
|
|
Hide scrollbars when there's nothing to scroll.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars
|
|
|
|
|
|
are handled completely in the GimpPreview widget now.
|
|
|
|
|
|
|
2004-08-31 11:06:36 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c: removed the hardcoded preview size,
|
|
|
|
|
|
removed some redundant assertions.
|
|
|
|
|
|
|
2004-08-31 10:54:46 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code...
|
|
|
|
|
|
Also did some minor cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-types.h: new file keeping the
|
|
|
|
|
|
various struct defs needed by both the above files.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/Makefile.am
|
|
|
|
|
|
* plug-ins/script-fu/siod-wrapper.c: changed accordingly.
|
|
|
|
|
|
|
2004-08-31 08:27:53 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
|
|
|
|
|
|
notify the "update" property on the preview, not the toggle.
|
|
|
|
|
|
|
2004-08-31 08:13:31 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c: allow to pan the preview with all
|
|
|
|
|
|
mouse buttons. Set a cursor to indicate that panning is possible.
|
|
|
|
|
|
|
2004-08-31 07:29:25 -07:00
|
|
|
|
2004-08-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c
|
|
|
|
|
|
* libgimpwidgets/gimppreview.h: renamed the "updated" signal to
|
|
|
|
|
|
"invalidated" and the confusing "update" virtual function to "draw".
|
|
|
|
|
|
|
2004-08-31 08:13:31 -07:00
|
|
|
|
Gave the properties saner names, too.
|
2004-08-31 07:29:25 -07:00
|
|
|
|
|
|
|
|
|
|
Removed _get_width and _get_height functions in favor of a _get_size
|
2004-08-31 08:13:31 -07:00
|
|
|
|
one.
|
2004-08-31 07:29:25 -07:00
|
|
|
|
|
2004-08-31 08:13:31 -07:00
|
|
|
|
Added gimp_preview_invalidate function that emits the "invalidated"
|
2004-08-31 07:29:25 -07:00
|
|
|
|
signal if needed.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.h: modified accordingly and fixed the
|
|
|
|
|
|
scrollbar range.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/despeckle.c
|
|
|
|
|
|
* plug-ins/common/gauss.c
|
|
|
|
|
|
* plug-ins/common/neon.c
|
|
|
|
|
|
* plug-ins/common/sobel.c
|
|
|
|
|
|
* plug-ins/common/softglow.c
|
|
|
|
|
|
* plug-ins/common/spread.c
|
|
|
|
|
|
* plug-ins/common/unsharp.c: modified accordingly.
|
|
|
|
|
|
|
2004-08-31 07:20:38 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c: removed the script title
|
|
|
|
|
|
label and moved the "About" button to the action_area. Minor
|
|
|
|
|
|
cleanups.
|
|
|
|
|
|
|
2004-08-31 07:17:33 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.[ch]: added GimpProgress
|
|
|
|
|
|
parameter to gimp_drawable_transform_affine().
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/edit.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend"
|
|
|
|
|
|
and all transform functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/edit_cmds.c
|
|
|
|
|
|
* app/pdb/transform_tools_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-08-31 07:02:10 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW
|
|
|
|
|
|
to restore the default cursor, simply pass NULL to
|
|
|
|
|
|
gdk_window_set_cursor().
|
|
|
|
|
|
|
2004-08-31 06:20:57 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info"
|
|
|
|
|
|
member and construct property. Changed gimp_paint_options_new()
|
|
|
|
|
|
to take only a GimpPaintInfo parameter.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.c (gimp_item_stroke)
|
|
|
|
|
|
* app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.c (gimp_channel_stroke)
|
|
|
|
|
|
* app/vectors/gimpvectors.c (gimp_vectors_stroke): use
|
|
|
|
|
|
paint_options->paint_info->paint_type directly instead of casting
|
|
|
|
|
|
to GimpToolOptions and using
|
|
|
|
|
|
tool_options->tool_info->paint_info->paint_type (eek). Fixes crash
|
|
|
|
|
|
when stroking via the PDB because newly created GimpToolOptions
|
|
|
|
|
|
instances have no "tool_info" pointer yet.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers
|
|
|
|
|
|
accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/paint_tools_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-08-31 06:16:08 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig.c (gimp_config_iface_duplicate): set
|
|
|
|
|
|
construct_param->foo, not construct_param*s*->foo, so we don't set
|
|
|
|
|
|
the first construct param again and crash.
|
|
|
|
|
|
|
2004-08-31 04:45:16 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/cubism.c: added "..." to the progress text.
|
|
|
|
|
|
|
2004-08-31 04:43:42 -07:00
|
|
|
|
2004-08-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c (file_actions): added "..." to "Revert".
|
|
|
|
|
|
|
2004-08-31 02:16:47 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpuitypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview
|
|
|
|
|
|
typedef to the header file that it belongs to.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.[ch]: minor include cleanups and
|
|
|
|
|
|
gtk-doc fixes.
|
|
|
|
|
|
|
2004-08-30 16:50:04 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss.c (gauss_dialog): update the preview when
|
|
|
|
|
|
the blur radius is being changed. gimp_coordinates_new() seems to
|
|
|
|
|
|
be broken though; there shouldn't be two signal connections needed
|
|
|
|
|
|
here.
|
|
|
|
|
|
|
2004-08-30 15:49:06 -07:00
|
|
|
|
2004-08-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.[ch]
|
|
|
|
|
|
* libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to
|
|
|
|
|
|
gtk-doc comments and to the handling of object properties.
|
|
|
|
|
|
|
2004-08-30 15:10:26 -07:00
|
|
|
|
2004-08-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreview.c
|
|
|
|
|
|
* libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract
|
|
|
|
|
|
base for a GimpDrawablePreview.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h: modified accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.c
|
|
|
|
|
|
* libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget
|
|
|
|
|
|
to ease the use of previews by plug-ins.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* libgimp/gimpui.h: Changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/despeckle.c
|
|
|
|
|
|
* plug-ins/common/gauss.c
|
|
|
|
|
|
* plug-ins/common/neon.c
|
|
|
|
|
|
* plug-ins/common/sobel.c
|
|
|
|
|
|
* plug-ins/common/softglow.c
|
|
|
|
|
|
* plug-ins/common/spread.c
|
|
|
|
|
|
* plug-ins/common/unsharp.c: use a GimpDrawablePreview with these
|
|
|
|
|
|
plug-ins.
|
|
|
|
|
|
|
2004-08-30 14:03:52 -07:00
|
|
|
|
2004-08-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.[ch]: added boolean return values
|
|
|
|
|
|
to plug_in_progress_install(), uninstall() and cancel(). Added
|
|
|
|
|
|
checks to make sure the installed progress_callback exists, has
|
|
|
|
|
|
the correct signature and was installed by this plug-in.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/progress.pdb: use the return values to let the
|
|
|
|
|
|
PDB wrappers succeed/fail.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/progress_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-08-30 14:01:55 -07:00
|
|
|
|
2004-08-30 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def: added gimp_progress_install &
|
|
|
|
|
|
gimp_progress_uninstall
|
|
|
|
|
|
|
2004-08-30 13:43:48 -07:00
|
|
|
|
2004-08-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpregioniterator.c: document the fact that "run_mode"
|
|
|
|
|
|
is unused. Also did some code cleanup.
|
|
|
|
|
|
|
2004-08-30 13:07:08 -07:00
|
|
|
|
2004-08-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpregioniterator.c: always update the progress.
|
|
|
|
|
|
Makes all "run_mode" parameters useless.
|
|
|
|
|
|
|
2004-08-30 13:02:31 -07:00
|
|
|
|
2004-08-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss.c: add "..." to the progress text.
|
|
|
|
|
|
|
2004-08-30 12:19:02 -07:00
|
|
|
|
2004-08-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpprogress.c: added some gtk-doc comments, could be
|
|
|
|
|
|
improved further.
|
|
|
|
|
|
|
2004-08-30 12:01:41 -07:00
|
|
|
|
2004-08-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/colortoalpha.c
|
|
|
|
|
|
* plug-ins/common/compose.c
|
|
|
|
|
|
* plug-ins/common/decompose.c
|
|
|
|
|
|
* plug-ins/common/film.c
|
|
|
|
|
|
* plug-ins/fits/fits.c: always use the progress API, not doing it
|
|
|
|
|
|
in non-interactive mode has always been wrong.
|
|
|
|
|
|
|
2004-08-30 11:36:43 -07:00
|
|
|
|
2004-08-30 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the
|
|
|
|
|
|
user_data pointer on uninstall. Eases language binding work.
|
|
|
|
|
|
|
2004-08-30 08:31:22 -07:00
|
|
|
|
2004-08-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed
|
|
|
|
|
|
drawing of brushes that extend beyond the preview.
|
|
|
|
|
|
|
2004-08-30 08:08:02 -07:00
|
|
|
|
2004-08-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
|
2004-08-30 08:31:22 -07:00
|
|
|
|
avoid excessive use of strdup() and strcmp(). The strings are all
|
2004-08-30 08:08:02 -07:00
|
|
|
|
constant anyway.
|
|
|
|
|
|
|
2004-08-30 07:57:24 -07:00
|
|
|
|
2004-08-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Brought the PDB progress into a working state. Fixes bug #6010,
|
2004-08-30 13:02:31 -07:00
|
|
|
|
addresses bugs #97266 and #135185 and unfortunately reopens bug
|
2004-08-30 07:57:24 -07:00
|
|
|
|
#150194 (will fix that later).
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimppdbprogress.c
|
|
|
|
|
|
* libgimp/gimpprogress.c: use the enum instead of integer
|
|
|
|
|
|
constants for the different progress commands. Cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.c
|
|
|
|
|
|
* app/plug-in/plug-in-run.c
|
2004-08-30 08:31:22 -07:00
|
|
|
|
* app/plug-in/plug-in.c: switch back to real refcounting for
|
2004-08-30 07:57:24 -07:00
|
|
|
|
plug_in->progress (reopens bug #150194) and enabled the PDB
|
|
|
|
|
|
progress code.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c: cleaned up the
|
|
|
|
|
|
progress stuff and the script-fu interface a bit.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/gimpenums.py
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-constants.c
|
|
|
|
|
|
* tools/pdbgen/enums.pl: regenerated.
|
|
|
|
|
|
|
2004-08-29 15:21:53 -07:00
|
|
|
|
2004-08-29 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.c (plug_in_open): set can_recurse on the
|
|
|
|
|
|
recv_message watch, so we don't block on recursive calls to the
|
|
|
|
|
|
handler. plug_in_recv_message needs some refcounting help now
|
|
|
|
|
|
though.
|
|
|
|
|
|
|
2004-08-29 13:07:06 -07:00
|
|
|
|
2004-08-29 Helvetix Victorinox <helvetix@gimp.org>
|
|
|
|
|
|
|
2004-08-29 14:06:31 -07:00
|
|
|
|
* app/composite/gimp-composite-x86.h
|
|
|
|
|
|
* app/composite/gimp-composite-sse.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse2.c: Fixed a bunch of
|
|
|
|
|
|
warnings due to bad type casting.
|
|
|
|
|
|
|
2004-08-29 13:07:06 -07:00
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse.c
|
|
|
|
|
|
* app/composite/gimp-composite-x86.h
|
|
|
|
|
|
* app/composite/gimp-composite-sse2.c:
|
|
|
|
|
|
The last changes to fix the the clobber registers bug #147013.
|
|
|
|
|
|
Commented out some dead code to be reviewed later.
|
|
|
|
|
|
|
2004-08-29 11:36:30 -07:00
|
|
|
|
2004-08-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Added an API to allow plug-ins to embed the progress for the
|
|
|
|
|
|
actions they trigger into their own GUI (attention: half-done and
|
|
|
|
|
|
broken code ahead...)
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/core-types.h
|
|
|
|
|
|
* app/core/gimppdbprogress.[ch]: new object implementing dispatching
|
|
|
|
|
|
progress calls to a temporary PDB procedure in a plug-in.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: force to link gimppdbprogress.o, bah!
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.[ch]: added API to install,
|
|
|
|
|
|
uninstall and cancel a PDB progress for this plug-in, but disabled
|
|
|
|
|
|
the implementation because it doesn't work yet.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new
|
|
|
|
|
|
install, uninstall and cancel functions.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* libgimp/gimp.h
|
|
|
|
|
|
* libgimp/gimpprogress.[ch]: added an API around the PDB progress
|
|
|
|
|
|
stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* app/pdb/progress_cmds.c
|
|
|
|
|
|
* libgimp/gimpprogress_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c: use the new API to show
|
|
|
|
|
|
the progress in the script-fu dialog.
|
|
|
|
|
|
|
2004-08-29 05:32:43 -07:00
|
|
|
|
2004-08-29 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def: added
|
|
|
|
|
|
gimp_scale_entry_set_logarithmic
|
|
|
|
|
|
|
2004-08-29 05:20:04 -07:00
|
|
|
|
2004-08-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfigwriter.c: don't emit critical warnings
|
|
|
|
|
|
about a messed up state of GimpConfigWriter if the writer is
|
|
|
|
|
|
disabled because of a write error that occured earlier.
|
|
|
|
|
|
|
2004-08-29 04:58:05 -07:00
|
|
|
|
2004-08-29 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.c: Regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dockable-actions.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpcoreconfig.c
|
|
|
|
|
|
* app/config/gimpcoreconfig.h
|
|
|
|
|
|
* app/config/gimpdisplayconfig.c
|
|
|
|
|
|
* app/config/gimpdisplayconfig.h
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpundo.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpnavigationeditor.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs.c
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c
|
|
|
|
|
|
* app/tools/gimptextoptions.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrushselect.c
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpcontainerview.c
|
|
|
|
|
|
* app/widgets/gimpdialogfactory.c
|
|
|
|
|
|
* app/widgets/gimpfontselect.c
|
|
|
|
|
|
* app/widgets/gimpgradientselect.c
|
|
|
|
|
|
* app/widgets/gimppaletteselect.c
|
|
|
|
|
|
* app/widgets/gimppatternselect.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.c
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c
|
|
|
|
|
|
* app/widgets/gimpundoeditor.c
|
|
|
|
|
|
* app/widgets/gimpundoeditor.h
|
|
|
|
|
|
* app/widgets/gimpviewablebutton.c: Changed accordingly.
|
|
|
|
|
|
|
2004-08-28 14:21:07 -07:00
|
|
|
|
2004-08-28 Helvetix Victorinox <helvetix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-sse.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse2.c: More updates to accomodate
|
2004-08-29 05:20:04 -07:00
|
|
|
|
the clobber registers. Additional progress against bug #147013.
|
2004-08-28 14:21:07 -07:00
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-sse.h: Fixed a bug where the wrong
|
|
|
|
|
|
manifest constant definition caused sse2 instructions to never be
|
|
|
|
|
|
compiled.
|
|
|
|
|
|
|
2004-08-28 14:16:42 -07:00
|
|
|
|
2004-08-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/vpropagate.c (run): fixed confusion about which
|
|
|
|
|
|
mode to use when being run with last values (bug #151308).
|
|
|
|
|
|
|
2004-08-28 11:56:46 -07:00
|
|
|
|
2004-08-28 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugindetails.c: workaround to avoid a warning
|
2004-08-28 16:02:54 -07:00
|
|
|
|
by gcc about the use of "%c" in the format string for strftime.
|
2004-08-28 11:56:46 -07:00
|
|
|
|
|
2004-08-28 09:57:37 -07:00
|
|
|
|
2004-08-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
|
|
|
|
|
|
S. O. Bueno which adds an API that allows to make the scale widget
|
|
|
|
|
|
of a GimpScaleEntry behave logarithmic. Fixes bug #149420.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c: use the new functionality for the
|
|
|
|
|
|
radius control.
|
|
|
|
|
|
|
2004-08-28 05:10:48 -07:00
|
|
|
|
2004-08-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/compose.c (compose_dialog): applied patch from
|
|
|
|
|
|
Markus Triska that improves which layers are choosen by
|
|
|
|
|
|
default (bug #148172).
|
|
|
|
|
|
|
2004-08-28 04:48:00 -07:00
|
|
|
|
2004-08-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-contiguous-region.c
|
|
|
|
|
|
(find_contiguous_region_helper): applied a patch from Eric Cheung
|
|
|
|
|
|
that changes the function to use a GQueue to implement recursion
|
|
|
|
|
|
instead of recursive function calls. Fixes bug #151124.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/noisify.c (noisify_dialog): left-align the
|
|
|
|
|
|
preview.
|
|
|
|
|
|
|
2004-08-28 03:57:24 -07:00
|
|
|
|
2004-08-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h
|
|
|
|
|
|
* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
|
|
|
|
|
|
help-id for the image area.
|
|
|
|
|
|
|
2004-08-27 13:06:17 -07:00
|
|
|
|
2004-08-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Moved the gimp_progress_init() and gimp_progress_update() PDB
|
|
|
|
|
|
functions to their own group because they don't belong to the
|
|
|
|
|
|
"Plug-In" namespace and will soon get more functions.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/progress.pdb: ...and added it here.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/Makefile.am
|
|
|
|
|
|
* tools/pdbgen/groups.pl
|
|
|
|
|
|
* app/pdb/Makefile.am
|
|
|
|
|
|
* libgimp/Makefile.am: changed accordingly.
|
|
|
|
|
|
|
2004-08-27 13:20:35 -07:00
|
|
|
|
* app/pdb/progress_cmds.c
|
2004-08-27 13:06:17 -07:00
|
|
|
|
* libgimp/gimpprogress_pdb.[ch]: new generated files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c
|
|
|
|
|
|
* libgimp/gimp_pdb.h
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
2004-08-27 10:38:57 -07:00
|
|
|
|
2004-08-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
(gimp_container_editor_construct): call
|
|
|
|
|
|
gimp_container_editor_select_item() manually at construction time
|
|
|
|
|
|
so views show the initially selected object's state correctly
|
|
|
|
|
|
(e.g. the brush spacing). Fixes bug #151227.
|
|
|
|
|
|
|
2004-08-26 17:42:46 -07:00
|
|
|
|
2004-08-27 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpnavigationpreview.c
|
|
|
|
|
|
* app/widgets/gimpnavigationpreview.h: renamed these files to ...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpnavigationview.c
|
|
|
|
|
|
* app/widgets/gimpnavigationview.h: to these.
|
|
|
|
|
|
And renamed the GimpNavigationPreview type to GimpNavigationView.
|
|
|
|
|
|
|
|
|
|
|
|
Hopefully, this is the last change in file names for the Preview->View
|
|
|
|
|
|
renaming process.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpnavigationeditor.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h: Changed accordingly.
|
|
|
|
|
|
|
2004-08-26 09:33:42 -07:00
|
|
|
|
2004-08-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.[ch]: removed "gboolean use_default_values"
|
|
|
|
|
|
from GimpItem::stroke().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.c
|
|
|
|
|
|
* app/core/gimpselection.c
|
|
|
|
|
|
* app/vectors/gimpvectors.c: changed accordingly.
|
|
|
|
|
|
|
2004-08-26 09:06:13 -07:00
|
|
|
|
2004-08-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.c (gimp_item_stroke): implement the whole
|
|
|
|
|
|
paint_options fiddling here instead of in each subclass and pass
|
|
|
|
|
|
either GimpStrokeOptions or GimpPaintOptions (instead of
|
|
|
|
|
|
GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().
|
|
|
|
|
|
|
|
|
|
|
|
Also copied code (that needs to be abstracted to a utility
|
|
|
|
|
|
function) from the tool_manager which makes sure we really use the
|
|
|
|
|
|
global brush, pattern etc. if these options are checked in prefs.
|
|
|
|
|
|
Fixes bug #150716.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.c (gimp_channel_stroke)
|
|
|
|
|
|
* app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
|
|
|
|
|
|
duplicated code mentioned above and simply use the paint_options
|
|
|
|
|
|
passed.
|
|
|
|
|
|
|
2004-08-26 07:59:31 -07:00
|
|
|
|
2004-08-26 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
|
|
|
|
|
|
really derived from GimpViewRenderer and not from
|
|
|
|
|
|
GimpViewRendererDrawable.
|
|
|
|
|
|
|
2004-08-26 07:20:30 -07:00
|
|
|
|
2004-08-26 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer-utils.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer-utils.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererbrush.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererbrush.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererdrawable.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererdrawable.h
|
|
|
|
|
|
* app/widgets/gimppreviewrenderergradient.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderergradient.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimage.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimage.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimagefile.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimagefile.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererlayer.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererlayer.h
|
|
|
|
|
|
* app/widgets/gimppreviewrenderervectors.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpviewrenderer-utils.c
|
|
|
|
|
|
* app/widgets/gimpviewrenderer-utils.h
|
|
|
|
|
|
* app/widgets/gimpviewrendererbrush.c
|
|
|
|
|
|
* app/widgets/gimpviewrendererbrush.h
|
|
|
|
|
|
* app/widgets/gimpviewrendererdrawable.c
|
|
|
|
|
|
* app/widgets/gimpviewrendererdrawable.h
|
|
|
|
|
|
* app/widgets/gimpviewrenderergradient.c
|
|
|
|
|
|
* app/widgets/gimpviewrenderergradient.h
|
|
|
|
|
|
* app/widgets/gimpviewrendererimage.c
|
|
|
|
|
|
* app/widgets/gimpviewrendererimage.h
|
|
|
|
|
|
* app/widgets/gimpviewrendererimagefile.c
|
|
|
|
|
|
* app/widgets/gimpviewrendererimagefile.h
|
|
|
|
|
|
* app/widgets/gimpviewrendererlayer.c
|
|
|
|
|
|
* app/widgets/gimpviewrendererlayer.h
|
|
|
|
|
|
* app/widgets/gimpviewrenderervectors.c
|
|
|
|
|
|
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
|
|
|
|
|
|
changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpview.c
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpviewrenderer.c
|
|
|
|
|
|
* app/widgets/gimpviewrenderer.h: modified accordingly.
|
|
|
|
|
|
|
2004-08-26 02:48:32 -07:00
|
|
|
|
2004-08-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/sanity.c (sanity_check_filename_encoding): try to convert
|
|
|
|
|
|
the result of gimp_directory() to UTF-8 and bail out with a
|
|
|
|
|
|
moderately helpful error message if this conversion fails. Works
|
|
|
|
|
|
around bug #150917. Also marked these strings for translation.
|
|
|
|
|
|
|
2004-08-26 02:41:18 -07:00
|
|
|
|
2004-08-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
|
|
|
|
|
|
as the default tool as suggested in bug #151091.
|
|
|
|
|
|
|
2004-08-25 17:50:45 -07:00
|
|
|
|
2004-08-26 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview-popup.c
|
|
|
|
|
|
* app/widgets/gimppreview-popup.h
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer.h: really removed these files from
|
|
|
|
|
|
cvs.
|
|
|
|
|
|
|
2004-08-25 15:32:54 -07:00
|
|
|
|
2004-08-25 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gifload.c: Guard against bogus logical screen
|
|
|
|
|
|
dimensions. Fixes bug #151053.
|
|
|
|
|
|
|
2004-08-25 15:31:44 -07:00
|
|
|
|
2004-08-26 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview-popup.c
|
|
|
|
|
|
* app/widgets/gimppreview-popup.h: renamed these files...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpview-popup.c
|
|
|
|
|
|
* app/widgets/gimpview-popup.h: .. to these files, and changed the
|
|
|
|
|
|
GimpPreviewPopup type to GimpViewPopup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer.h: renamed these files...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpviewrenderer.c
|
|
|
|
|
|
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
|
|
|
|
|
|
GimpPreviewRenderer to GimpViewRenderer.
|
|
|
|
|
|
|
|
|
|
|
|
This is the second step of the great Preview->View renaming process.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-layer-select.c
|
|
|
|
|
|
* app/display/gimpnavigationeditor.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpbrushfactoryview.c
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpcellrendererviewable.c
|
|
|
|
|
|
* app/widgets/gimpcellrendererviewable.h
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.c
|
|
|
|
|
|
* app/widgets/gimpcontainercombobox.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainerentry.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimpcontainerview.c
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimpnavigationpreview.c
|
|
|
|
|
|
* app/widgets/gimppatternfactoryview.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer-utils.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererbrush.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererbrush.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererdrawable.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererdrawable.h
|
|
|
|
|
|
* app/widgets/gimppreviewrenderergradient.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderergradient.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimage.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimage.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimagefile.c
|
|
|
|
|
|
* app/widgets/gimppreviewrendererimagefile.h
|
|
|
|
|
|
* app/widgets/gimppreviewrendererlayer.c
|
|
|
|
|
|
* app/widgets/gimppreviewrenderervectors.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c
|
|
|
|
|
|
* app/widgets/gimptoolview.c
|
|
|
|
|
|
* app/widgets/gimpview.c
|
|
|
|
|
|
* app/widgets/gimpview.h
|
|
|
|
|
|
* app/widgets/gimpviewablebutton.c
|
|
|
|
|
|
* app/widgets/widgets-enums.h
|
|
|
|
|
|
* app/widgets/widgets-types.h: Modified accordingly.
|
|
|
|
|
|
|
2004-08-25 12:49:50 -07:00
|
|
|
|
2004-08-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
|
|
|
|
|
|
adding message boxes and redirect messages to stderr if there are
|
|
|
|
|
|
too many messages.
|
|
|
|
|
|
|
2004-08-25 11:26:06 -07:00
|
|
|
|
2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
|
|
|
|
|
|
|
2004-08-25 10:58:52 -07:00
|
|
|
|
2004-08-25 Sven Neumann <sven@gimp.org>
|
2004-08-25 10:50:35 -07:00
|
|
|
|
|
2004-08-25 10:58:52 -07:00
|
|
|
|
* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().
|
2004-08-25 10:50:35 -07:00
|
|
|
|
|
2004-08-25 10:58:52 -07:00
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
|
|
|
|
|
|
GimpMessageBox for each message added. Fixes bug #92604.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
|
|
|
|
|
|
functionality.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs-constructors.[ch]
|
|
|
|
|
|
* app/gui/dialogs.c: manage GimpErrorDialog as singleton.
|
2004-08-25 10:41:34 -07:00
|
|
|
|
|
2004-08-25 10:58:52 -07:00
|
|
|
|
* app/gui/gui-vtable.c (gui_message): use the new error dialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
|
|
|
|
|
|
domain.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
|
|
|
|
|
|
when being called with a NULL domain.
|
2004-08-25 10:54:12 -07:00
|
|
|
|
|
|
|
|
|
|
2004-08-25 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
|
|
|
|
|
|
in favor of views.
|
|
|
|
|
|
|
2004-08-25 10:58:52 -07:00
|
|
|
|
2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* devel-docs/Makefile.am
|
|
|
|
|
|
* devel-docs/ggr.txt: added new file decribing the ggr (Gimp
|
|
|
|
|
|
gradient) file format.
|
|
|
|
|
|
|
2004-08-25 09:02:10 -07:00
|
|
|
|
2004-08-25 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpnavigationview.c
|
|
|
|
|
|
* app/display/gimpnavigationview.h: renamed these files to...
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpnavigationeditor.c
|
|
|
|
|
|
* app/display/gimpnavigationeditor.h: ... these files, and of course
|
|
|
|
|
|
changed GimpNavigationView to GimpNavigationEditor since it is really
|
|
|
|
|
|
inherited from GimpEditor anyway.
|
|
|
|
|
|
|
|
|
|
|
|
This will leave the gimp_navigation_view namespace for the renaming
|
|
|
|
|
|
from gimp_navigation_preview.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/Makefile.am
|
|
|
|
|
|
* app/display/display-types.h
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/gui/dialogs-constructors.c: Changed accordlingly.
|
|
|
|
|
|
|
2004-08-25 07:38:49 -07:00
|
|
|
|
2004-08-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-title.c
|
|
|
|
|
|
(gimp_display_shell_format_title): print bad '%' sequences
|
|
|
|
|
|
literally instead of warning (g_warning() is for programming
|
|
|
|
|
|
errors only and must never be triggered by bad or intermediate
|
|
|
|
|
|
user input). Fixes bug #150676
|
|
|
|
|
|
|
2004-08-24 14:42:29 -07:00
|
|
|
|
2004-08-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
|
|
|
|
|
|
layouts.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-close.c
|
|
|
|
|
|
* app/gui/quit-dialog.c: use a GimpMessageBox.
|
|
|
|
|
|
|
2004-08-24 13:08:33 -07:00
|
|
|
|
2004-08-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
|
|
|
|
|
|
Modeled after the proposed new API for GtkMessageDialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c: changed accordingly.
|
|
|
|
|
|
|
2004-08-24 10:16:46 -07:00
|
|
|
|
2004-08-24 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview.c
|
|
|
|
|
|
* app/widgets/gimppreview.h: renamed these two files to...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpview.c
|
|
|
|
|
|
* app/widgets/gimpview.h: ... these files.
|
|
|
|
|
|
|
|
|
|
|
|
Also renamed GimpPreview to GimpView.
|
|
|
|
|
|
This is the first step of the great Preview->View renaming process.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/palettes-commands.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-layer-select.c
|
|
|
|
|
|
* app/display/gimpnavigationview.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/palette-import-dialog.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpaction.c
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.h
|
|
|
|
|
|
* app/widgets/gimpdevicestatus.c
|
|
|
|
|
|
* app/widgets/gimpdnd.c
|
|
|
|
|
|
* app/widgets/gimpdockbook.c
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpnavigationpreview.c
|
|
|
|
|
|
* app/widgets/gimpnavigationpreview.h
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.c
|
|
|
|
|
|
* app/widgets/gimppreview-popup.c
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c
|
|
|
|
|
|
* app/widgets/gimptoolbox-image-area.c
|
|
|
|
|
|
* app/widgets/gimptoolbox-indicator-area.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c
|
|
|
|
|
|
* app/widgets/gimpviewabledialog.c
|
|
|
|
|
|
* app/widgets/widgets-types.h: changed accordingly.
|
|
|
|
|
|
|
2004-08-23 16:22:46 -07:00
|
|
|
|
2004-08-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
|
|
|
|
|
|
|
2004-08-23 02:32:06 -07:00
|
|
|
|
2004-08-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
|
|
|
|
|
|
the filename if gtk_file_chooser_set_uri() failed.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c: trivial cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c: removed an unused extern
|
|
|
|
|
|
variable declaration.
|
|
|
|
|
|
|
2004-08-22 17:45:40 -07:00
|
|
|
|
2004-08-23 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/tools-utils.c: fixed a typo that broke the build.
|
|
|
|
|
|
|
2004-08-22 14:48:50 -07:00
|
|
|
|
2004-08-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/Makefile.am
|
|
|
|
|
|
* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
|
|
|
|
|
|
instead of duplicating that functionality.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
|
|
|
|
|
|
instead of implementing completely different constraints.
|
|
|
|
|
|
|
2004-08-22 05:31:47 -07:00
|
|
|
|
2004-08-22 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
|
|
|
|
|
|
shape differently to avoid possible rounding issues with
|
|
|
|
|
|
the _arcto () command.
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c: properly close the rounded
|
|
|
|
|
|
rectangles.
|
|
|
|
|
|
|
2004-08-22 03:50:22 -07:00
|
|
|
|
2004-08-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c (parse_svg_transform): support
|
|
|
|
|
|
optional center coordinates for the "rotate" transformations.
|
|
|
|
|
|
(parse_svg_transform): apply transformations in reverse order. The
|
|
|
|
|
|
SVG spec is rather confusing here.
|
|
|
|
|
|
|
2004-08-21 08:47:31 -07:00
|
|
|
|
2004-08-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
|
|
|
|
|
|
a bug I introduced with my last commit.
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c: added support for the basic
|
|
|
|
|
|
SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
|
|
|
|
|
|
|
2004-08-21 06:50:19 -07:00
|
|
|
|
2004-08-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.[ch]: added new function
|
|
|
|
|
|
gimp_bezier_stroke_new_ellipse() that provides a simple API to
|
|
|
|
|
|
create a bezier stroke that represents an ellipse.
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c: added support for the basic
|
|
|
|
|
|
SVG shapes "circle" and "ellipse".
|
|
|
|
|
|
|
2004-08-21 03:38:38 -07:00
|
|
|
|
2004-08-21 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
|
|
|
|
|
|
between the dimension parameter and the rank thingies more clear
|
|
|
|
|
|
also changed to a nicer layout.
|
|
|
|
|
|
|
2004-08-21 02:41:12 -07:00
|
|
|
|
2004-08-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c: added support for the basic
|
|
|
|
|
|
SVG shapes "polyline" and "polygon".
|
|
|
|
|
|
|
2004-08-21 01:03:39 -07:00
|
|
|
|
2004-08-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c: added support for importing
|
|
|
|
|
|
the basic SVG shape "line". Other shapes will follow...
|
|
|
|
|
|
|
2004-08-20 15:32:14 -07:00
|
|
|
|
2004-08-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/layers-actions.[ch]
|
|
|
|
|
|
* app/actions/layers-commands.[ch]
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c: added actions to handle layer
|
|
|
|
|
|
masks as suggested in bug #150446.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/layers-menu.xml: added menu entries for new actions,
|
|
|
|
|
|
commented out raise/lower menu entries.
|
|
|
|
|
|
|
2004-08-20 13:58:12 -07:00
|
|
|
|
2004-08-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: declare local function as static.
|
|
|
|
|
|
|
2004-08-19 07:26:24 -07:00
|
|
|
|
2004-08-19 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/guillotine.c: modified the coordinate insertion
|
|
|
|
|
|
into the file name to leave the file extension intact, changed the
|
|
|
|
|
|
format of the coordinates. Fixes bug #101901.
|
|
|
|
|
|
|
2004-08-18 17:21:55 -07:00
|
|
|
|
2004-08-18 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcellrendereraccel.c
|
|
|
|
|
|
* app/widgets/gimphistogrambox.c
|
|
|
|
|
|
* plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
|
|
|
|
|
|
|
2004-08-18 14:50:26 -07:00
|
|
|
|
2004-08-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/color-notebook.c: no need to set a size_request here.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorscales.c
|
|
|
|
|
|
* modules/colorsel_cmyk.c: don't set a minimum width on the color
|
|
|
|
|
|
scales. Improves behaviour for narrow color dockables.
|
|
|
|
|
|
|
2004-08-18 11:09:06 -07:00
|
|
|
|
2004-08-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_triangle.c: fixed crashes that occured with
|
|
|
|
|
|
small sizes, some code cleanups and a simple optimization.
|
|
|
|
|
|
|
2004-08-18 02:53:38 -07:00
|
|
|
|
2004-08-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdock.c
|
|
|
|
|
|
* app/widgets/gimpdockable.c: help-ids are never used directly,
|
|
|
|
|
|
use the defines from app/widgets/gimphelp-ids.h instead.
|
|
|
|
|
|
|
2004-08-17 13:21:11 -07:00
|
|
|
|
2004-08-17 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_triangle.c: Made the triangle colorselector
|
|
|
|
|
|
resizeable. Removed minimum size request (would probably need some
|
|
|
|
|
|
testing for *very* small sizes though).
|
|
|
|
|
|
|
2004-08-17 10:46:48 -07:00
|
|
|
|
2004-08-17 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdock.c
|
|
|
|
|
|
* app/widgets/gimpdockable.c: add help-ids.
|
|
|
|
|
|
|
2004-08-17 08:16:44 -07:00
|
|
|
|
2004-08-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
|
|
|
|
|
|
the "cancel" signal handler id when a new progress is set.
|
|
|
|
|
|
|
2004-08-17 08:07:27 -07:00
|
|
|
|
2004-08-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_cmyk.c: minor cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_water.c: let the widget take the available
|
|
|
|
|
|
space, don't set a minimum size.
|
|
|
|
|
|
|
2004-08-17 01:21:30 -07:00
|
|
|
|
2004-08-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.c
|
|
|
|
|
|
* app/plug-in/plug-in-run.c
|
|
|
|
|
|
* app/plug-in/plug-in.c: don't keep a strong reference to the
|
|
|
|
|
|
GimpProgress object, instead use a weak reference and deal with
|
|
|
|
|
|
the progress being destroyed while the plug-in is running.
|
|
|
|
|
|
Fixes bug #150194.
|
|
|
|
|
|
|
2004-08-16 00:24:42 -07:00
|
|
|
|
2004-08-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
|
|
|
|
|
|
labels in CMYK mode. Fixes bug #150213.
|
|
|
|
|
|
|
2004-08-15 18:30:33 -07:00
|
|
|
|
2004-08-16 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
|
|
|
|
|
|
redrawn correctly in some case. Reported by AndyFitz.
|
|
|
|
|
|
|
2004-08-15 11:01:11 -07:00
|
|
|
|
2004-08-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_triangle.c: minor cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_water.c: GimpPreviewArea seems like overkill
|
|
|
|
|
|
here, use a GtkDrawingArea instead.
|
|
|
|
|
|
|
2004-08-15 08:31:20 -07:00
|
|
|
|
2004-08-15 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/colorsel_triangle.c
|
|
|
|
|
|
* modules/colorsel_water.c: Replaced the GtkPreviews by
|
|
|
|
|
|
GimpPreviewAreas.
|
|
|
|
|
|
|
2004-08-14 23:52:45 -07:00
|
|
|
|
2004-08-14 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
|
|
|
|
|
|
length values are not negative, to prevent bad calls to g_new.
|
|
|
|
|
|
Addresses bug #150154.
|
|
|
|
|
|
|
2004-08-14 10:53:40 -07:00
|
|
|
|
2004-08-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-08-14 11:13:41 -07:00
|
|
|
|
* plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
|
|
|
|
|
|
any GIMP libraries.
|
|
|
|
|
|
|
2004-08-14 10:53:40 -07:00
|
|
|
|
* plug-ins/help/domain.[ch]: allow to specify the location of the
|
|
|
|
|
|
index files independently from the base URL.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/help.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/gimp-help-lookup.c: added command-line options to
|
|
|
|
|
|
specify base URI and root directory for index files.
|
|
|
|
|
|
|
2004-08-14 09:59:16 -07:00
|
|
|
|
2004-08-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/locales.c (locales_parse): don't mess up the order
|
|
|
|
|
|
of languages.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/gimp-help-lookup.c: parse command-line options,
|
|
|
|
|
|
added --help output.
|
|
|
|
|
|
|
2004-08-14 08:47:22 -07:00
|
|
|
|
2004-08-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/help.[ch]: moved some defines to the header file.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/domain.c: trivial change to remove the libgimpbase
|
|
|
|
|
|
dependency.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/Makefile.am
|
|
|
|
|
|
* plug-ins/help/gimp-help-lookup.c: added a very simple
|
|
|
|
|
|
command-line tool that allows to lookup a help-id.
|
|
|
|
|
|
|
2004-08-12 16:31:15 -07:00
|
|
|
|
2004-08-13 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/edge.c: update the preview when the user choose a
|
|
|
|
|
|
different algorithm from the combo box. This was one of the main
|
|
|
|
|
|
reasons to have a preview here, after all.
|
|
|
|
|
|
|
2004-08-12 15:30:25 -07:00
|
|
|
|
2004-08-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/edge.c (edge_dialog): use a combo box instead of
|
|
|
|
|
|
too many radio buttons.
|
|
|
|
|
|
|
2004-08-12 13:04:19 -07:00
|
|
|
|
2004-08-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
|
|
|
|
|
|
make sure that all actions, even if they have no menu proxy, can
|
|
|
|
|
|
be invoked by their accelerators. Fixes bug #149938.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
|
|
|
|
|
|
removed the same code here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
|
|
|
|
|
|
function which disconnects from "accel_changed" of the accel_group
|
|
|
|
|
|
before upchaining (== before emitting "destroy").
|
|
|
|
|
|
|
|
|
|
|
|
The above changes make this one redundant, but since the crash in
|
|
|
|
|
|
bug #149938 was triggered by "accel_changed" emitted in the middle
|
|
|
|
|
|
of g_object_unref(tree_model), it feels better to be paranoic here
|
|
|
|
|
|
(fiddling with objects in destruction is no fun).
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_action_view_accel_edited): don't warn if assigning the same
|
|
|
|
|
|
accel to the same action again.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_action_view_new): don't leak all accel_closures.
|
|
|
|
|
|
|
2004-08-12 10:14:25 -07:00
|
|
|
|
2004-08-12 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/edge.c: added a preview.
|
|
|
|
|
|
|
2004-08-11 17:01:05 -07:00
|
|
|
|
2004-08-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sel_gauss.c
|
|
|
|
|
|
* plug-ins/common/unsharp.c: place the preview widget into the
|
|
|
|
|
|
upper left corner like all other plug-ins do.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/domain.c: added some (disabled) debug output.
|
|
|
|
|
|
|
2004-08-11 16:18:31 -07:00
|
|
|
|
2004-08-12 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sel_gauss.c: added a preview.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: removed unused variables.
|
|
|
|
|
|
|
2004-08-11 16:14:02 -07:00
|
|
|
|
2004-08-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c: changed the icons to indicate
|
|
|
|
|
|
what part of the context is affected by the action. Looks better
|
|
|
|
|
|
in the shortcut editor.
|
|
|
|
|
|
|
2004-08-11 08:25:14 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/cartoon.c
|
|
|
|
|
|
* plug-ins/common/neon.c
|
|
|
|
|
|
* plug-ins/common/photocopy.c
|
|
|
|
|
|
* plug-ins/common/softglow.c: added four new plug-ins contributed
|
|
|
|
|
|
by Spencer Kimball. Ported them from 1.2 to 2.1 APIs.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl: added them here.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mkgen.pl: removed tab insanity now that
|
2004-08-11 14:46:12 -07:00
|
|
|
|
libgimpoldpreview is gone.
|
2004-08-11 08:25:14 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/.cvsignore
|
|
|
|
|
|
* plug-ins/common/Makefile.am: regenerated.
|
|
|
|
|
|
|
2004-08-11 07:53:43 -07:00
|
|
|
|
2004-08-11 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
Bad DindinX! Don't break the build!
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in
|
|
|
|
|
|
* plug-ins/common/mkgen.pl
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from
|
|
|
|
|
|
here too.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am: regenerated.
|
|
|
|
|
|
|
2004-08-11 07:39:13 -07:00
|
|
|
|
2004-08-11 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
Removed the GimpOldPreview stuff. Die, crap, die!
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/libgimpoldpreview/*: removed.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Makefile.am
|
|
|
|
|
|
* plug-ins/common/Makefile.am: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/max_rgb.c
|
|
|
|
|
|
* plug-ins/common/noisify.c
|
|
|
|
|
|
* plug-ins/common/tileit.c: removed last forgotten
|
|
|
|
|
|
#include "libgimpoldpreview.h".
|
|
|
|
|
|
|
2004-08-11 07:07:35 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainercombobox.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c: when removing the last item
|
|
|
|
|
|
from the view, manually clear all GimpCellRendererViewables'
|
|
|
|
|
|
"renderer" properties; otherwise we have stale GimpPreviewRenderers
|
|
|
|
|
|
with still-refed viewables hanging around in the cells.
|
|
|
|
|
|
Works around GTK+ bug #149906.
|
|
|
|
|
|
|
2004-08-11 07:00:08 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c
|
|
|
|
|
|
* app/core/gimpimagefile.c: converted tabs to spaces, cosmetic
|
|
|
|
|
|
changes.
|
|
|
|
|
|
|
2004-08-11 06:37:40 -07:00
|
|
|
|
2004-08-11 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/waves.c: GimpPreviewArea-ified.
|
|
|
|
|
|
|
2004-08-11 03:45:47 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Restored sane sorting order for menus which are created
|
|
|
|
|
|
entirely by plug-ins (like Xtns/Script-Fu/...).
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/plug-in-menus.c (plug_in_menus_build_path): made it
|
|
|
|
|
|
return the built path. For each sub-menu created, add a "Menus"
|
|
|
|
|
|
placeholder and a separator. Make sure all sub-menus end up in the
|
|
|
|
|
|
"Menus" placeholder. More readable because we can use the path
|
|
|
|
|
|
returned by the recursive invocation now.
|
|
|
|
|
|
|
|
|
|
|
|
(plug_in_menus_add_proc): simplified by using the path
|
|
|
|
|
|
plug_in_menus_build_path() returns.
|
|
|
|
|
|
|
2004-08-11 03:29:56 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpprogress.[ch]: added virtual function
|
|
|
|
|
|
gboolean GimpProgressInterface::is_active().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.c
|
|
|
|
|
|
* app/display/gimpstatusbar.c
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
* app/widgets/gimpprogressbox.c
|
|
|
|
|
|
* app/widgets/gimpprogressdialog.c
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c: implement it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.h: removed "gboolean progress_active" and
|
|
|
|
|
|
added "gulong progress_cancel_id" instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
|
|
|
|
|
|
we correctly handle the "cancel" connections of progress instances
|
|
|
|
|
|
passed from other plug-ins.
|
|
|
|
|
|
|
2004-08-11 02:41:48 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-message.c
|
|
|
|
|
|
* app/plug-in/plug-in-run.c (plug_in_temp_run)
|
|
|
|
|
|
* libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN
|
|
|
|
|
|
#define and all code which was in #ifndef ENABLE_TEMP_RETURN.
|
|
|
|
|
|
|
2004-08-11 02:36:51 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.[ch]: reenabled showing the
|
|
|
|
|
|
progress in a particular display.
|
|
|
|
|
|
|
2004-08-11 02:16:36 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: added a commented-out midi controller entry
|
|
|
|
|
|
with some example mappings.
|
|
|
|
|
|
|
2004-08-10 19:36:40 -07:00
|
|
|
|
2004-08-11 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plasma.c: converted to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-10 17:59:21 -07:00
|
|
|
|
2004-08-11 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/noisify.c: converted to GimpPreviewArea. Also added
|
|
|
|
|
|
scrollbars to move around. The preview was rather useless without
|
|
|
|
|
|
them.
|
|
|
|
|
|
|
2004-08-10 17:34:34 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-blend.c
|
|
|
|
|
|
* app/core/gimpprogress.c: some progress cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
|
|
|
|
|
|
need to warn if there is already a progress active, just silently
|
|
|
|
|
|
return NULL as all other GimpProgressInterface implementors.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-progress.c: several progress fixes.
|
|
|
|
|
|
It's still a mess.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/url.c: don't show progress depending on
|
|
|
|
|
|
run_mode. Run the actual file plug-in with the same run_mode we
|
|
|
|
|
|
were invoked with.
|
|
|
|
|
|
|
2004-08-10 16:37:06 -07:00
|
|
|
|
2004-08-11 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c
|
|
|
|
|
|
* app/widgets/gimpprogressbox.c: increased horizontal size request
|
|
|
|
|
|
to reduce resizing.
|
|
|
|
|
|
|
2004-08-10 15:34:45 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
|
|
|
|
|
|
fixed annoying resizing when thumbnailing exactly one image.
|
|
|
|
|
|
|
2004-08-10 15:21:56 -07:00
|
|
|
|
2004-08-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
|
|
|
|
|
|
a label and a progressbar. Implements GimpProgressIterface.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
|
|
|
|
|
|
by a GimpProgressBox. Delegate most progress functionality to it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.[ch]: factored out utility
|
|
|
|
|
|
function gimp_dialog_set_sensitive().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
|
|
|
|
|
|
use it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c (file_open_location_response):
|
|
|
|
|
|
embed the called file procedure's progress using a GimpProgressBox.
|
|
|
|
|
|
|
2004-08-10 14:20:38 -07:00
|
|
|
|
2004-08-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.[ch]
|
|
|
|
|
|
(gimp_file_dialog_set_sensitive): new function which works on all
|
|
|
|
|
|
widgets in the dialog except the cancel button.
|
|
|
|
|
|
|
|
|
|
|
|
Remember if the active progress is cancelable and added two
|
|
|
|
|
|
booleans "busy" and "canceled". Added GtkDialog::response()
|
|
|
|
|
|
implementation which, if the dialog is busy, cancels the active
|
|
|
|
|
|
progress and sets the dialog's "canceled" state.
|
|
|
|
|
|
|
|
|
|
|
|
Moved the progress bar right above the action area so it is next
|
|
|
|
|
|
to the cancel button and in the same place for both open and save
|
|
|
|
|
|
dialogs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-dialog.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c: use the new API to make image loading
|
|
|
|
|
|
and saving cancelable again.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c: use the same stuff to make
|
|
|
|
|
|
thumbnailing cancelable. Increased the minimum height a bit so it
|
|
|
|
|
|
doesn't resize when the progress bars are shown.
|
|
|
|
|
|
|
2004-08-10 11:47:21 -07:00
|
|
|
|
2004-08-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Redid the whole internal progress stuff: don't pass around
|
|
|
|
|
|
progress_callback and progress_data; instead, provide a
|
|
|
|
|
|
pointer to a GimpProgressInterface which can be implemented
|
|
|
|
|
|
by a variety of backends.
|
|
|
|
|
|
|
|
|
|
|
|
Addresses (but not yet fixes) bugs #6010, #97266 and #135185.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/Makefile.am
|
|
|
|
|
|
* app/display/gimpprogress.[ch]: removed the old progress hack.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/core-types.h
|
|
|
|
|
|
* app/core/gimpprogress.[ch]: implement GimpProgressInterface.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpprogressdialog.[ch]: the standalone progress
|
|
|
|
|
|
dialog as widget implementing GimpProgressInterface.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.c
|
|
|
|
|
|
* app/display/gimpstatusbar.[ch]
|
|
|
|
|
|
* app/widgets/gimpfiledialog.[ch]
|
|
|
|
|
|
* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
|
|
|
|
|
|
implementation to these classes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-gui.[ch]
|
|
|
|
|
|
* app/gui/gui-vtable.c: replaced the old progress vtable entries
|
|
|
|
|
|
by two new to create and destroy a GimpProgressDialog in case
|
|
|
|
|
|
no other progress is available.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/procedural_db.[ch]
|
|
|
|
|
|
* app/plug-in/plug-in-run.[ch]
|
|
|
|
|
|
* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
|
|
|
|
|
|
all plug-ins.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.[ch]
|
|
|
|
|
|
* app/plug-in/plug-ins.c
|
|
|
|
|
|
* app/plug-in/plug-in-message.c
|
|
|
|
|
|
* app/plug-in/plug-in-progress.c: handle the case there the
|
|
|
|
|
|
plug-in was crated with a progress as well as the case where it
|
|
|
|
|
|
wasn't.
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c
|
|
|
|
|
|
* app/batch.c
|
|
|
|
|
|
* app/xcf/xcf.c
|
|
|
|
|
|
* app/file/file-open.[ch]
|
|
|
|
|
|
* app/file/file-save.[ch]
|
|
|
|
|
|
* app/widgets/gimphelp.c
|
|
|
|
|
|
* app/widgets/gimpbrushselect.c
|
|
|
|
|
|
* app/widgets/gimpfontselect.c
|
|
|
|
|
|
* app/widgets/gimpgradientselect.c
|
|
|
|
|
|
* app/widgets/gimppaletteselect.c
|
|
|
|
|
|
* app/widgets/gimppatternselect.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimagefile.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.c
|
|
|
|
|
|
* app/gui/file-open-dialog.c
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
|
|
|
|
|
|
related functions. Embed the progress in the file dialog where
|
|
|
|
|
|
possible.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-blend.[ch]
|
|
|
|
|
|
* app/core/gimpdrawable-transform.[ch]
|
|
|
|
|
|
* app/core/gimpimage-convert.[ch]
|
|
|
|
|
|
* app/core/gimpimage-flip.[ch]
|
|
|
|
|
|
* app/core/gimpimage-resize.[ch]
|
|
|
|
|
|
* app/core/gimpimage-rotate.[ch]
|
|
|
|
|
|
* app/core/gimpimage-scale.[ch]
|
|
|
|
|
|
* app/core/gimpitem-linked.[ch]
|
|
|
|
|
|
* app/core/gimpitem.[ch]
|
|
|
|
|
|
* app/core/gimpchannel.c
|
|
|
|
|
|
* app/core/gimpdrawable.c
|
|
|
|
|
|
* app/core/gimplayer.c
|
|
|
|
|
|
* app/core/gimpselection.c
|
|
|
|
|
|
* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpblendtool.c
|
|
|
|
|
|
* app/tools/gimptransformtool.c
|
|
|
|
|
|
* app/gui/convert-dialog.c
|
|
|
|
|
|
* app/actions/documents-commands.c
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/plug-in-commands.c
|
|
|
|
|
|
* app/actions/vectors-commands.c
|
|
|
|
|
|
* tools/pdbgen/pdb/convert.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/edit.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/*_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-08-10 11:00:03 -07:00
|
|
|
|
2004-08-10 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/blinds.c: GimpPreviewArea-ified.
|
|
|
|
|
|
|
2004-08-10 08:07:50 -07:00
|
|
|
|
2004-08-10 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum
|
|
|
|
|
|
for the color model instead of some defines and use gboolean instead
|
|
|
|
|
|
of gint where appropriate.
|
|
|
|
|
|
|
2004-08-10 04:33:13 -07:00
|
|
|
|
2004-08-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.c (gimp_brush_generated_load):
|
|
|
|
|
|
plugged more file descriptor leaks.
|
|
|
|
|
|
|
2004-08-09 19:37:44 -07:00
|
|
|
|
2004-08-10 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.c: don't leak a file descriptor when
|
|
|
|
|
|
reading a bad .vbr file.
|
|
|
|
|
|
|
2004-08-09 16:35:40 -07:00
|
|
|
|
2004-08-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: don't show progress on the image
|
|
|
|
|
|
window while updating the preview.
|
|
|
|
|
|
|
2004-08-09 14:07:57 -07:00
|
|
|
|
2004-08-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c (unsharp_region): reset the progress
|
|
|
|
|
|
when done; some code cleanup.
|
|
|
|
|
|
|
2004-08-09 12:10:31 -07:00
|
|
|
|
2004-08-09 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: continuously show the (original) image
|
|
|
|
|
|
during a scrollbar movement. This makes it easier to navigate.
|
|
|
|
|
|
|
2004-08-09 09:08:36 -07:00
|
|
|
|
2004-08-09 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Applied (slightly modified) patch from Shlomi Fish which adds a
|
|
|
|
|
|
progress bar to the RGB -> INDEXED conversion. Fixes bug #145274
|
|
|
|
|
|
and shows that we really really need a GimpProgressInterface in
|
|
|
|
|
|
the core to give progress users full access to the progress API.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-convert.[ch]: added special
|
|
|
|
|
|
GimpImageConvertProgress function typedef to cope with the
|
|
|
|
|
|
different stages of converting. Support passing such a callback &
|
|
|
|
|
|
data to gimp_image_convert() and update the progress accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/convert-dialog.[ch]: added a convert progress callback
|
|
|
|
|
|
and pass it to gimp_image_convert().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* tools/pdbgen/pdb/convert.pdb: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/convert_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-08-09 04:04:42 -07:00
|
|
|
|
2004-08-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* data/misc/gimp.desktop.in.in: added GenericName and Version,
|
|
|
|
|
|
updated Categories.
|
|
|
|
|
|
|
2004-08-09 03:25:50 -07:00
|
|
|
|
2004-08-09 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.c
|
|
|
|
|
|
(plug_ins_file_register_magic)
|
|
|
|
|
|
(plug_ins_file_register_mime): don't dereference
|
|
|
|
|
|
gimp->current_plug_in->plug_in_def if it's NULL.
|
|
|
|
|
|
Fixes bug #149678.
|
|
|
|
|
|
|
|
|
|
|
|
(plug_ins_file_register_mime): moved returning the proc_def inside
|
|
|
|
|
|
the right if() statement.
|
|
|
|
|
|
|
2004-08-08 15:47:23 -07:00
|
|
|
|
2004-08-09 Hans Breuer <hans@breuer.org>
|
|
|
|
|
|
|
2004-08-09 04:04:42 -07:00
|
|
|
|
* app/core/gimp-edit.c (gimp_edit_paste_as_new):
|
2004-08-08 15:47:23 -07:00
|
|
|
|
gimp_create_display() with the right parameters order
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
|
|
|
|
|
|
handle gtk_style_lookup_icon_set() returnig NULL
|
|
|
|
|
|
|
|
|
|
|
|
* app/gimpcore.def app/widgets/makefile.msc
|
|
|
|
|
|
themes/default/images/makefile.msc : updated
|
|
|
|
|
|
|
2004-08-08 15:26:17 -07:00
|
|
|
|
2004-08-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/postscript.c (save_ps_header): use the basename
|
|
|
|
|
|
as Title, not the full filename. Fixes bug #149669.
|
|
|
|
|
|
|
2004-08-08 12:15:06 -07:00
|
|
|
|
2004-08-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a
|
|
|
|
|
|
character array, don't flush the buffer for each byte but wait
|
|
|
|
|
|
until it is filled.
|
|
|
|
|
|
|
2004-08-08 11:44:31 -07:00
|
|
|
|
2004-08-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use
|
|
|
|
|
|
g_strdup_vprintf() instead of guessing the string length. Also
|
|
|
|
|
|
declare the function using G_GNUC_PRINTF().
|
|
|
|
|
|
|
2004-08-08 11:17:53 -07:00
|
|
|
|
2004-08-08 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/ifscompose/README.ifscompose: fix out of date info,
|
|
|
|
|
|
pointed out by the author.
|
|
|
|
|
|
|
2004-08-08 04:55:34 -07:00
|
|
|
|
2004-08-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am: do not build test-preview-area by
|
|
|
|
|
|
default, put it into EXTRA_PROGRAMS. Fixes parallel builds.
|
|
|
|
|
|
|
2004-08-08 03:53:19 -07:00
|
|
|
|
2004-08-08 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive):
|
|
|
|
|
|
new function which checks a GimpImageType against the
|
|
|
|
|
|
proc_def->image_types_val mask.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c: use the new function here. Also
|
|
|
|
|
|
separated setting the "Repeat last" and "Reshow last" actions'
|
|
|
|
|
|
labels from setting their sensitivity and made them use the same
|
|
|
|
|
|
sensitivity logic as all other plug-in actions. Fixes bug #149567.
|
|
|
|
|
|
|
2004-08-07 11:53:32 -07:00
|
|
|
|
2004-08-07 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal
|
|
|
|
|
|
when the hex entry is changed.
|
|
|
|
|
|
|
2004-08-07 11:37:31 -07:00
|
|
|
|
2004-08-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/sanity.c: abort if the configured filename encoding can't be
|
|
|
|
|
|
converted to UTF-8. Fixes bug #149464 for the HEAD branch.
|
|
|
|
|
|
|
2004-08-07 08:56:13 -07:00
|
|
|
|
2004-08-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose):
|
|
|
|
|
|
corrected dither offset.
|
|
|
|
|
|
|
2004-08-07 08:36:12 -07:00
|
|
|
|
2004-08-07 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of
|
|
|
|
|
|
GimpOldPreview.
|
|
|
|
|
|
|
2004-08-07 07:44:58 -07:00
|
|
|
|
2004-08-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of
|
|
|
|
|
|
GtkPreview.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpbrushmenu.c
|
|
|
|
|
|
* libgimp/gimppatternmenu.c: minor cleanup.
|
|
|
|
|
|
|
2004-08-07 06:29:02 -07:00
|
|
|
|
2004-08-07 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some
|
|
|
|
|
|
cleanup and removed tabs.
|
|
|
|
|
|
|
2004-08-07 02:07:02 -07:00
|
|
|
|
2004-08-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: bumped version number to 2.1.4.
|
|
|
|
|
|
|
2004-08-06 17:49:05 -07:00
|
|
|
|
2004-08-07 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/illusion.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-06 17:04:16 -07:00
|
|
|
|
2004-08-07 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED
|
|
|
|
|
|
and INDEXEDA image types.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/grid.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-06 13:52:44 -07:00
|
|
|
|
2004-08-06 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/glasstile.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-06 12:38:13 -07:00
|
|
|
|
2004-08-06 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/nlfilt.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-06 09:39:11 -07:00
|
|
|
|
2004-08-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.h: removed the recently added
|
|
|
|
|
|
"gdouble aspect_ratio"...
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
|
|
|
|
|
|
|
2004-08-06 09:27:13 -07:00
|
|
|
|
2004-08-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Transform tool cleanup:
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.[ch]: added new virtual function
|
|
|
|
|
|
GimpTransformTool::dialog_update().
|
|
|
|
|
|
Made wrapper for ::recalc() public and function
|
|
|
|
|
|
transform_bounding_box() private.
|
|
|
|
|
|
Call ::dialog_update() and transform_bounding_box() from the
|
|
|
|
|
|
::recalc() wrapper.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpperspectivetool.[ch]
|
|
|
|
|
|
* app/tools/gimprotatetool.[ch]
|
|
|
|
|
|
* app/tools/gimpscaletool.[ch]
|
|
|
|
|
|
* app/tools/gimpsheartool.[ch]: turned all info_dialog update
|
|
|
|
|
|
functions into GimpTransformTool::dialog_update() implementations
|
|
|
|
|
|
and don't call them from ::recalc(), also removed calls to
|
|
|
|
|
|
transform_bounding_box(); both functions are called by the parent
|
|
|
|
|
|
class now. Call gimp_transform_tool_recalc() when dialog values
|
|
|
|
|
|
were changed, not the tool's internal function.
|
|
|
|
|
|
Moved all static variables to the instance structs.
|
|
|
|
|
|
|
2004-08-06 06:56:34 -07:00
|
|
|
|
2004-08-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
|
|
|
|
|
|
Pollak which enables controlling the shear direction from the
|
|
|
|
|
|
dialog and changing the shear direction without hitting "Reset".
|
|
|
|
|
|
Fixes bug #149467.
|
|
|
|
|
|
|
|
|
|
|
|
Also moved all static variables to the GimpShearTool struct and
|
|
|
|
|
|
converted tabs to spaces.
|
|
|
|
|
|
|
2004-08-06 06:30:49 -07:00
|
|
|
|
2004-08-06 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/nova.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-05 18:45:32 -07:00
|
|
|
|
2004-08-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Made 2.1.3 release.
|
|
|
|
|
|
|
2004-08-05 18:28:01 -07:00
|
|
|
|
2004-08-06 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/polar.c: ported to GimpPreviewArea (from
|
|
|
|
|
|
GimpOldPreview).
|
|
|
|
|
|
|
2004-08-05 18:04:13 -07:00
|
|
|
|
2004-08-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/test-color-parser.c: include <glib-object.h>.
|
|
|
|
|
|
|
2004-08-05 17:59:58 -07:00
|
|
|
|
2004-08-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/depthmerge.c:
|
|
|
|
|
|
* plug-ins/common/despeckle.c: removed unused variables.
|
|
|
|
|
|
|
2004-08-05 17:36:47 -07:00
|
|
|
|
2004-08-06 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/flarefx.c: ported to GimpPreviewArea (from
|
2004-08-05 17:59:58 -07:00
|
|
|
|
GimpOldPreview)
|
2004-08-05 17:36:47 -07:00
|
|
|
|
|
2004-08-05 17:12:40 -07:00
|
|
|
|
2004-08-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove
|
|
|
|
|
|
tw_sess.c here.
|
|
|
|
|
|
|
2004-08-05 09:43:20 -07:00
|
|
|
|
2004-08-05 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/wind.c: ported to GimpPreviewArea (from
|
|
|
|
|
|
GimpOldPreview)
|
|
|
|
|
|
|
2004-08-05 08:44:34 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c: increased the handle size from 8
|
|
|
|
|
|
to 9 pixels (which is the same as in the path tool) as suggested
|
|
|
|
|
|
in bug #134250.
|
|
|
|
|
|
|
2004-08-05 07:56:18 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.c: make the cursor coordinates label
|
|
|
|
|
|
insensitive when displaying out-of-image coordinates.
|
|
|
|
|
|
|
2004-08-05 07:15:37 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB):
|
|
|
|
|
|
s/pseudocolor visuals/8-bit (256 colors) displays/.
|
|
|
|
|
|
Fixes bug #137078.
|
|
|
|
|
|
|
2004-08-05 06:43:38 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Enabled previewing items without selecting them in all list and
|
|
|
|
|
|
grid views using mouse button 2. Implicitly enables previewing of
|
|
|
|
|
|
items in container popups and thus fixes bug #121011:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview.c (gimp_preview_button_press_event)
|
|
|
|
|
|
* app/widgets/gimpcellrendererviewable.c
|
|
|
|
|
|
(gimp_cell_renderer_viewable_clicked): show the preview also on
|
|
|
|
|
|
mouse button 2 click.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
(gimp_container_tree_view_button_press): dispatch mouse button 2
|
|
|
|
|
|
clicks to GimpCellRendererViewable, but don't select or change
|
|
|
|
|
|
anything in the tree_view.
|
|
|
|
|
|
|
|
|
|
|
|
Unrelated cleanup:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview.c (gimp_preview_button_press_event):
|
|
|
|
|
|
don't offset bevent->x,y by widget->allocation.x,y before calling
|
|
|
|
|
|
gimp_preview_popup_show() ...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
|
|
|
|
|
|
... instead, do it here generically (check if the parent widget is
|
|
|
|
|
|
GTK_WIDGET_NO_WINDOW()).
|
|
|
|
|
|
|
2004-08-05 05:13:02 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty):
|
|
|
|
|
|
allocate the empty_iter using g_new0(). Fixes valgrind warnings
|
|
|
|
|
|
about reads from uninitialized memory.
|
|
|
|
|
|
|
2004-08-05 04:57:36 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for
|
|
|
|
|
|
all "Set" actions (like context-foreground-red-set).
|
|
|
|
|
|
|
2004-08-05 04:12:58 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpscaletool.c
|
|
|
|
|
|
* app/tools/gimptransformtool.h: applied patch from Jordi Gay
|
|
|
|
|
|
(attached to bug #131111) which adds an aspect ratio spinbutton to
|
2004-08-05 04:20:36 -07:00
|
|
|
|
the scale dialog and keeps the aspect ratio intact when width or
|
2004-08-05 04:12:58 -07:00
|
|
|
|
height are changed using the dialog. Fixes bug #132274.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
|
|
|
|
|
|
"wrap" and decrease their climb_rate.
|
|
|
|
|
|
|
2004-08-05 03:29:19 -07:00
|
|
|
|
2004-08-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c
|
|
|
|
|
|
* app/actions/context-commands.[ch]
|
|
|
|
|
|
* menus/image-menu.xml.in: added actions, callbacks and menu items
|
|
|
|
|
|
for the brush shape and spikes.
|
|
|
|
|
|
|
2004-08-04 11:53:04 -07:00
|
|
|
|
2004-08-04 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/grid.c: changed the default colors for the
|
|
|
|
|
|
first invocation to the current foregroud color which is more
|
|
|
|
|
|
likely to be useful than the blue shades.
|
|
|
|
|
|
|
2004-08-04 11:15:41 -07:00
|
|
|
|
2004-08-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/images/Makefile.am
|
|
|
|
|
|
* themes/Default/images/stock-brush-generated-*-16.png: removed ...
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/images/stock-shape-*-16.png: ... and added back
|
|
|
|
|
|
with more generic names.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpstock.[ch]
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
|
|
|
|
|
|
well.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
|
|
|
|
|
|
editor widget factored out of app/tools/gimpinkoptions-gui.c.
|
|
|
|
|
|
|
2004-08-04 10:41:33 -07:00
|
|
|
|
2004-08-04 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.c: Enhanced the range of the hardness
|
|
|
|
|
|
parameter to make more soft brushes possible. Please note that this
|
|
|
|
|
|
makes existing generated brushes look more soft. But since people
|
|
|
|
|
|
apparently rarely use more than one or two generated brushes and
|
|
|
|
|
|
these get changed frequently I guess it should be OK.
|
|
|
|
|
|
|
2004-08-04 10:11:39 -07:00
|
|
|
|
2004-08-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
|
|
|
|
|
|
linked against GLib >= 2.4.5. Fixes bug #148140.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-utils.[ch]: added gimp_check_glib_version().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpselectiondata.c: added runtime check for GLib
|
|
|
|
|
|
versions that encode file:// URIs correctly (>= 2.4.5). For older
|
|
|
|
|
|
(broken) GLibs, leave the code path as is, for newer (fixed) ones,
|
|
|
|
|
|
perform an additional check if the dropped URI is in the (broken)
|
|
|
|
|
|
escaped-UTF-8 format and convert it to local filename encoding.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c: warn the user that non-ASCII filenames can't
|
|
|
|
|
|
be used when linked against GLib 2.4.4.
|
|
|
|
|
|
|
2004-08-04 07:00:14 -07:00
|
|
|
|
2004-08-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
2004-08-05 04:20:36 -07:00
|
|
|
|
* app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in"
|
|
|
|
|
|
to "PlugInProcDef *last_plug_in". Added function
|
2004-08-04 07:00:14 -07:00
|
|
|
|
gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-commands.c
|
|
|
|
|
|
* app/plug-in/plug-in-run.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c: factored out updating of the
|
|
|
|
|
|
"Reshow Last" and "Rerun Last" actions to a private function.
|
|
|
|
|
|
Connect each "plug-in" action group to Gimp::last-plug-in-changed
|
|
|
|
|
|
and update the actions' label and sensitivity in the
|
|
|
|
|
|
callback. Fixes bug #149139.
|
|
|
|
|
|
|
2004-08-04 03:15:49 -07:00
|
|
|
|
2004-08-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
|
|
|
|
|
|
|
2004-08-04 02:00:34 -07:00
|
|
|
|
2004-08-04 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Really really really really fix WINDRES logic.
|
|
|
|
|
|
|
2004-08-03 09:16:19 -07:00
|
|
|
|
2004-08-03 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs
|
|
|
|
|
|
work.
|
|
|
|
|
|
|
2004-08-03 07:55:31 -07:00
|
|
|
|
2004-08-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
(gimp_container_grid_view_item_context): ref/unref the view around
|
|
|
|
|
|
the calls to gimp_container_view_item_selected() and _item_context()
|
|
|
|
|
|
because the former may destroy the view which leads to a crash
|
|
|
|
|
|
when trying the latter. Fixes bug #148955.
|
|
|
|
|
|
|
2004-08-03 07:09:49 -07:00
|
|
|
|
2004-08-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
|
|
|
|
|
|
new function which checks if undo compression is possible:
|
|
|
|
|
|
|
|
|
|
|
|
(1) is the image dirty? Fixes bug #148853.
|
|
|
|
|
|
(2) is redo stack empty?
|
|
|
|
|
|
(3) do both the passed undo object_type and undo_type
|
|
|
|
|
|
match the top undo item?
|
|
|
|
|
|
|
|
|
|
|
|
Consistently name the GType and GimpUndoType passed to undo
|
|
|
|
|
|
functions "object_type" and "undo_type" to avoid confusion.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
* app/tools/gimptexttool.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c: use the new utility function
|
|
|
|
|
|
instead of checking the above conditions manually.
|
|
|
|
|
|
|
2004-08-03 05:56:19 -07:00
|
|
|
|
2004-08-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't
|
|
|
|
|
|
leak the brush's name if parsing the shape fails.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_brush_generated_dirty): shut up bogus compiler warnings
|
|
|
|
|
|
about uninitialized variables.
|
|
|
|
|
|
|
2004-08-03 04:35:59 -07:00
|
|
|
|
2004-08-03 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_preview.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-03 03:43:29 -07:00
|
|
|
|
2004-08-03 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-02 17:58:10 -07:00
|
|
|
|
2004-08-03 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/fp/fp.c: converted to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-02 15:16:35 -07:00
|
|
|
|
2004-08-03 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/rcm/rcm_callback.c
|
|
|
|
|
|
* plug-ins/rcm/rcm_dialog.c
|
|
|
|
|
|
* plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-02 14:34:12 -07:00
|
|
|
|
2004-08-02 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes
|
|
|
|
|
|
with >= 2 spikes. Spotted by Joao S. O. Bueno.
|
|
|
|
|
|
|
|
|
|
|
|
Fixes bug #149099.
|
|
|
|
|
|
|
2004-08-02 01:51:49 -07:00
|
|
|
|
2004-08-02 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/whirlpinch.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-02 01:18:16 -07:00
|
|
|
|
2004-08-02 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/video.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-01 15:40:47 -07:00
|
|
|
|
2004-08-02 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the
|
|
|
|
|
|
preview, too.
|
|
|
|
|
|
|
2004-08-01 14:59:13 -07:00
|
|
|
|
2004-08-01 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tileit.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-01 13:54:09 -07:00
|
|
|
|
2004-08-01 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sinus.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-01 13:30:50 -07:00
|
|
|
|
2004-08-01 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Really really really fix WINDRES logic.
|
|
|
|
|
|
|
2004-08-01 13:13:27 -07:00
|
|
|
|
2004-08-01 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mkgen.pl: update install-% rule to match newer
|
|
|
|
|
|
libtool commands.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am: regenerated.
|
|
|
|
|
|
|
2004-08-01 13:00:12 -07:00
|
|
|
|
2004-08-01 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Really really fix WINDRES logic.
|
|
|
|
|
|
|
2004-08-01 12:55:40 -07:00
|
|
|
|
2004-08-01 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Really fix WINDRES logic.
|
|
|
|
|
|
|
2004-08-01 12:43:06 -07:00
|
|
|
|
2004-08-01 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-08-02 11:34:01 -07:00
|
|
|
|
2004-08-01 Hans Breuer <hans@breuer.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/makefile.msc app/widgets/makefile.msc : build
|
|
|
|
|
|
but *dont link* display-enums.obj, widget-enums.obj and
|
|
|
|
|
|
gimpdisplayoptions.obj. They must be in the dll
|
|
|
|
|
|
* app/makefile.msc : build gimp.exe and gimp-console.exe both
|
|
|
|
|
|
using the same gimp-core.dll
|
|
|
|
|
|
* app/gimpcore.def : new file, exports for gimp-core.dll
|
|
|
|
|
|
* app/Makefile.am : added to EXTRA_DIST
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/makefile.msc : new file to create gimp-tool-cursors.h
|
|
|
|
|
|
* cursors/Makefile.am : added to EXTRA_DIST
|
|
|
|
|
|
|
|
|
|
|
|
* **/makefile.msc : updated
|
|
|
|
|
|
|
|
|
|
|
|
* app/main.c app/app_procs.c : moved code to close the console
|
|
|
|
|
|
from the former to the later. It only is to be used if The Gimp
|
|
|
|
|
|
is not build as console app.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
|
|
|
|
|
|
drawable twice
|
|
|
|
|
|
* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
|
|
|
|
|
|
crashing on File/Import
|
|
|
|
|
|
|
2004-08-01 11:09:41 -07:00
|
|
|
|
2004-08-01 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
|
|
|
|
|
|
reset the number of spikes to 2.
|
|
|
|
|
|
|
2004-08-01 10:20:00 -07:00
|
|
|
|
2004-08-01 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
|
|
|
|
|
|
the generated brushes, enabling star shaped generated brushes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.[ch]: GUI for this.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrush.c: changed accordingly.
|
|
|
|
|
|
|
2004-08-01 10:16:42 -07:00
|
|
|
|
2004-08-01 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mapcolor.c
|
|
|
|
|
|
* plug-ins/common/sample_colorize.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though
|
|
|
|
|
|
it should use some pngs instead.
|
|
|
|
|
|
|
2004-08-01 10:11:14 -07:00
|
|
|
|
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: modified the checks. hopefully it works on all
|
|
|
|
|
|
platforms this time.
|
|
|
|
|
|
|
2004-08-01 09:26:20 -07:00
|
|
|
|
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: move an AM_CONDITIONAL out of an if block
|
|
|
|
|
|
|
2004-08-01 09:13:01 -07:00
|
|
|
|
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: added checks for windres. Fixes bug #148443
|
2004-08-01 09:26:20 -07:00
|
|
|
|
together with my last commit.
|
2004-08-01 09:13:01 -07:00
|
|
|
|
|
2004-08-01 08:28:32 -07:00
|
|
|
|
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: added checks and rules to build and link the
|
|
|
|
|
|
win32 icon resource if the resource compiler windres is found by
|
|
|
|
|
|
configure. First part of a fix for bug #148443.
|
|
|
|
|
|
|
2004-08-01 07:50:09 -07:00
|
|
|
|
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill
|
|
|
|
|
|
|
2004-08-01 07:36:50 -07:00
|
|
|
|
2004-08-01 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/flame/flame.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 20:06:58 -07:00
|
|
|
|
2004-08-01 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.h
|
|
|
|
|
|
* app/core/gimpbrushgenerated.[ch]: Implement three different
|
|
|
|
|
|
brush shapes for generated brushes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrush.c: changed accordingly.
|
|
|
|
|
|
* app/core/core-enums.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
|
|
|
|
|
|
* themes/Default/images/stock-brush-generated-*-16.png: New stock
|
|
|
|
|
|
icons for the brush shapes.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/images/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpstock.[ch]: changed accordingly
|
|
|
|
|
|
|
|
|
|
|
|
untabified the files touched.
|
|
|
|
|
|
|
2004-07-31 16:32:31 -07:00
|
|
|
|
2004-08-01 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/iwarp.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 12:31:57 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gqbist.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 11:42:47 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/fractaltrace.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 09:06:20 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/exchange.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 06:58:19 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/emboss.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 06:18:31 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/diffraction.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 05:51:01 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/despeckle.c: use even more GimpPreviewArea's
|
|
|
|
|
|
facilities.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/destripe.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 04:17:39 -07:00
|
|
|
|
2004-07-31 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gflare/gflare.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 03:38:05 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/despeckle.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-31 01:42:44 -07:00
|
|
|
|
2004-07-31 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/brush.c
|
|
|
|
|
|
* plug-ins/gimpressionist/orientmap.c
|
|
|
|
|
|
* plug-ins/gimpressionist/paper.c
|
|
|
|
|
|
* plug-ins/gimpressionist/preview.c
|
|
|
|
|
|
* plug-ins/gimpressionist/size.c:
|
|
|
|
|
|
Converted the code from using GtkPreview to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-30 21:34:33 -07:00
|
|
|
|
2004-07-30 Seth Burgess <sjburges@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss.c: added some non-interactive modes (if called
|
|
|
|
|
|
from the pdb with RUN_INTERACTIVE).
|
|
|
|
|
|
|
2004-07-30 18:59:46 -07:00
|
|
|
|
2004-07-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorselect.c: minor cleanup.
|
|
|
|
|
|
|
2004-07-30 18:27:11 -07:00
|
|
|
|
2004-07-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimppatternmenu.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpbrushmenu.c: some small changes for consistency.
|
|
|
|
|
|
|
2004-07-30 18:03:00 -07:00
|
|
|
|
2004-07-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreviewarea.[ch]: added new function
|
|
|
|
|
|
gimp_preview_area_fill().
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/test-preview-area.c: added a test for new function.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpbrushmenu.c: ported to GimpPreviewArea.
|
|
|
|
|
|
|
2004-07-30 16:33:00 -07:00
|
|
|
|
2004-07-31 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a
|
|
|
|
|
|
GtkPreview. Some code cleanup, too.
|
|
|
|
|
|
|
2004-07-30 16:03:45 -07:00
|
|
|
|
2004-07-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and
|
|
|
|
|
|
a GdkPixbuf instead of the deprecated GtkPreview widget.
|
|
|
|
|
|
|
2004-07-30 14:29:45 -07:00
|
|
|
|
2004-07-30 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of
|
|
|
|
|
|
GtkPreview.
|
|
|
|
|
|
|
2004-07-30 13:56:29 -07:00
|
|
|
|
2004-07-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-07-30 13:59:58 -07:00
|
|
|
|
Applied a bunch of small changes contributed by Tim Mooney to fix
|
2004-07-30 13:56:29 -07:00
|
|
|
|
stack corruption on Tru64 and Aix (bug #129867).
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* plug-ins/script-fu/Makefile.am: changed the dependency order so
|
|
|
|
|
|
that $(REGEXREPL) is linked earlier.
|
|
|
|
|
|
|
|
|
|
|
|
* regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream
|
|
|
|
|
|
fix for re_max_failures value.
|
|
|
|
|
|
|
2004-07-30 13:42:53 -07:00
|
|
|
|
2004-07-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: always do the check for perl and use the
|
|
|
|
|
|
substituted perl executable name in the call for gimp-mkenums.
|
|
|
|
|
|
Fixes the build on platforms where perl is not available as
|
|
|
|
|
|
/usr/bin/perl. Closes bug #148813.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.c: added missing include.
|
|
|
|
|
|
|
2004-07-30 12:55:03 -07:00
|
|
|
|
2004-07-30 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus
|
|
|
|
|
|
some minor code cleanups.
|
|
|
|
|
|
|
2004-07-30 11:45:34 -07:00
|
|
|
|
2004-07-30 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a
|
|
|
|
|
|
GimpPreviewArea and the other to a simple GtkDrawingArea, since this
|
|
|
|
|
|
makes the code simpler.
|
|
|
|
|
|
|
2004-07-30 07:52:29 -07:00
|
|
|
|
2004-07-30 Shlomi Fish <shlomif@iglu.org.il>
|
2004-07-30 07:38:11 -07:00
|
|
|
|
|
2004-07-30 07:43:44 -07:00
|
|
|
|
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
|
|
|
|
|
|
corrected a typo causing mayhem in previews of non-alpha grayscale
|
|
|
|
|
|
images. Fixes bug #148873.
|
2004-07-30 07:38:11 -07:00
|
|
|
|
|
2004-07-30 05:26:11 -07:00
|
|
|
|
2004-07-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c (fillPreview): optimized preview
|
|
|
|
|
|
filling a little bit, removed trailing whitespace.
|
|
|
|
|
|
|
2004-07-30 05:03:30 -07:00
|
|
|
|
2004-07-30 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
2004-07-30 05:26:11 -07:00
|
|
|
|
* plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea,
|
|
|
|
|
|
and some small cleanups (g_malloc to g_new, removing tabs)
|
2004-07-30 05:03:30 -07:00
|
|
|
|
|
2004-07-30 05:01:44 -07:00
|
|
|
|
2004-07-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
|
|
|
|
|
|
optimized alpha blending.
|
|
|
|
|
|
|
2004-07-29 17:57:22 -07:00
|
|
|
|
2004-07-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Applied a bunch of AIX portability fixes (bug #148813):
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: when testing for Xmu library, link with -lXt -lX11.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/tips-parser.c
|
|
|
|
|
|
* app/gui/user-install-dialog.c
|
|
|
|
|
|
* app/tools/tools-enums.h
|
|
|
|
|
|
* app/widgets/gimpdasheditor.c
|
|
|
|
|
|
* app/widgets/widgets-enums.h
|
|
|
|
|
|
* libgimpthumb/gimpthumb-error.h
|
|
|
|
|
|
* libgimpwidgets/gimpcolorbutton.c
|
|
|
|
|
|
* plug-ins/common/edge.c: removed trailing commas from enums.
|
|
|
|
|
|
|
2004-07-29 18:13:50 -07:00
|
|
|
|
* plug-ins/common/snoise.c: renamed defines to avoid collision
|
|
|
|
|
|
with system headers.
|
2004-07-29 17:57:22 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs-generic.h
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.c: use integers for bit fields.
|
|
|
|
|
|
|
2004-07-29 16:41:36 -07:00
|
|
|
|
2004-07-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/bumpmap.c: removed preview code that isn't used
|
|
|
|
|
|
any longer.
|
|
|
|
|
|
|
2004-07-29 15:52:09 -07:00
|
|
|
|
2004-07-30 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/bumpmap.c: use GimpPreviewArea instead of
|
|
|
|
|
|
GtkPreview (which leads to much simpler code)
|
|
|
|
|
|
|
2004-07-29 14:08:13 -07:00
|
|
|
|
2004-07-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppreviewarea.c: only invalidate the buffer
|
|
|
|
|
|
on size_allocate; allocate a new one on the next call to
|
|
|
|
|
|
gimp_preview_area_draw(). Fixed buffer offset in expose method.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/test-preview-area.c: more a benchmark than a
|
|
|
|
|
|
test; quite similar to testrgb from the GTK+ source tree.
|
|
|
|
|
|
|
2004-07-29 13:52:56 -07:00
|
|
|
|
2004-07-29 DindinX <david@dindinx.org>
|
|
|
|
|
|
|
2004-07-29 14:08:13 -07:00
|
|
|
|
* plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview
|
|
|
|
|
|
widgets to GimpPreviewArea.
|
2004-07-29 13:52:56 -07:00
|
|
|
|
|
2004-07-29 12:22:32 -07:00
|
|
|
|
2004-07-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed
|
|
|
|
|
|
unused #if 0'ed prototype and unused #includes, minor cleanups.
|
|
|
|
|
|
|
2004-07-29 11:41:47 -07:00
|
|
|
|
2004-07-29 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/*.[ch]: normalized the names of the fields
|
|
|
|
|
|
of gimpressionist_vals_t.
|
|
|
|
|
|
|
2004-07-29 10:10:28 -07:00
|
|
|
|
2004-07-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a
|
|
|
|
|
|
replacement for GtkPreview, loosely based on patches from Geert
|
|
|
|
|
|
Jordaens and David Odin. Fixes bug #144759.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sharpen.c: use the new widget instead of a
|
|
|
|
|
|
GtkPreview; saves about 100 lines of rather complex code :)
|
|
|
|
|
|
|
2004-07-29 09:45:39 -07:00
|
|
|
|
2004-07-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: changed default configuration of the keyboard
|
|
|
|
|
|
controller: scroll the display one step on cursor_key, scroll by
|
|
|
|
|
|
one page on <shift>+cursor_key and scroll to top/bottom/left/right
|
|
|
|
|
|
on <control>+cursor_key. Fixes bug #53988.
|
|
|
|
|
|
|
|
|
|
|
|
Moved the old opacity-modifying actions to <alt>+cursor_key.
|
|
|
|
|
|
|
2004-07-29 07:16:21 -07:00
|
|
|
|
2004-07-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Replaced the concept of having a boolean indicating if an undo
|
|
|
|
|
|
step dirties the image by a bitfield indicating which parts
|
|
|
|
|
|
of the image are dirtied:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.[ch]: reordered two values in enum
|
|
|
|
|
|
GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.
|
|
|
|
|
|
|
|
|
|
|
|
The values of GimpDirtyMask are still questionable and will
|
|
|
|
|
|
probably change...
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.[ch]: removed signal "undo_start" and added
|
|
|
|
|
|
a GimpDirtyMask parameter to the "dirty" and "clean" signals.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
|
|
|
|
|
|
"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
|
|
|
|
|
|
it to gimp_image_dirty().
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_image_undo_group_start): added *ugly* code which tries to
|
|
|
|
|
|
figure GimpDirtyMask from the group's GimpUndoType and store it in
|
|
|
|
|
|
the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
|
|
|
|
|
|
gimp_image_undo_start(). This means the undo group now dirties the
|
|
|
|
|
|
image just like one of its undo steps, but that's no problem since
|
|
|
|
|
|
undoing cleans it in the same way.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_undo_pop): emit clean/dirty signals *before* performing the
|
|
|
|
|
|
actual undo step so listeners can detach from the image before it
|
|
|
|
|
|
is changed by undo.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
|
|
|
|
|
|
GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
|
|
|
|
|
|
because it makes no sense to use GimpImageMap noninteractively.
|
|
|
|
|
|
Don't freeze()/thaw() undo while the image_map is active which
|
|
|
|
|
|
fixes many ways of trashing the image's undo state but probably
|
|
|
|
|
|
introduces new ways of doing evil things.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay-foreach.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c: changed according
|
|
|
|
|
|
to the GimpImage::clean()/dirty() signal changes. Small fixes
|
|
|
|
|
|
in the quit dialog's dirty image container.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptoolcontrol.[ch]: added member and API to
|
|
|
|
|
|
set/get the dirty_mask.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c
|
|
|
|
|
|
* app/tools/gimptexttool.c
|
|
|
|
|
|
* app/tools/gimptransformtool.c: whenever setting "preserve" to
|
|
|
|
|
|
FALSE, also set a "dirty_mask" which specifies on which image
|
|
|
|
|
|
changes the tool wants to be canceled.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/tool_manager.c: removed "undo_start" connection and
|
|
|
|
|
|
connect to both "dirty" *and* "clean" to check if the active_tool
|
|
|
|
|
|
needs to be canceled. Cancel the tool only if the dirty_mask
|
|
|
|
|
|
passed in the signal has common bits with the tool's dirty_mask.
|
|
|
|
|
|
|
|
|
|
|
|
Fixes bug #109561 and probably opens some new ones...
|
|
|
|
|
|
|
2004-07-29 06:53:26 -07:00
|
|
|
|
2004-07-29 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def
|
|
|
|
|
|
* libgimp/gimpui.def: added some missing symbols
|
|
|
|
|
|
|
2004-07-29 06:40:56 -07:00
|
|
|
|
2004-07-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpbase.def: added new symbols.
|
|
|
|
|
|
|
2004-07-29 06:21:55 -07:00
|
|
|
|
2004-07-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Added support for motion event history as provided by some input
|
|
|
|
|
|
device drivers. If you have a tablet driver supporting this,
|
|
|
|
|
|
please try and report back.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
|
|
|
|
|
|
member "guint32 last_motion_time".
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
(gimp_display_shell_tool_events): remember the last_motion_time on
|
|
|
|
|
|
button_press() and after motion() and ask the current device for
|
|
|
|
|
|
its motion history; in motion(), if the active_tool asks for exact
|
|
|
|
|
|
motions, check if the input device recorded a motion history and
|
|
|
|
|
|
process the history instead of the motion event.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_display_shell_get_time_coords): new utility function which
|
|
|
|
|
|
gets GimpCoords from a GdkTimeCoord struct as used by the motion
|
|
|
|
|
|
history.
|
|
|
|
|
|
|
2004-07-29 05:55:46 -07:00
|
|
|
|
2004-07-29 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/repaint.c: converted a multiple if into
|
|
|
|
|
|
a nested one.
|
|
|
|
|
|
|
2004-07-29 05:33:15 -07:00
|
|
|
|
2004-07-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.h: removed enums GimpImageType and
|
|
|
|
|
|
GimpImageBaseType ...
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
|
|
|
|
|
|
all enums from gimpbasetypes.h to this new file.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/Makefile.am
|
|
|
|
|
|
* tools/pdbgen/Makefile.am: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.c
|
|
|
|
|
|
* libgimp/gimpenums.h
|
|
|
|
|
|
* libgimpbase/gimpbaseenums.c
|
|
|
|
|
|
* tools/pdbgen/enums.pl: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpparasite.c
|
|
|
|
|
|
* libgimpbase/gimpprotocol.c
|
|
|
|
|
|
* libgimp/gimp.c: include <glib-object.h>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
|
|
|
|
|
|
translation domain on a GType. This is used for translatable enum
|
|
|
|
|
|
values.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimputils.[ch]: added API to retrieve the translated
|
|
|
|
|
|
name for an enum value.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.c
|
|
|
|
|
|
* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
|
|
|
|
|
|
|
2004-07-29 05:05:45 -07:00
|
|
|
|
2004-07-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawable.c: fixed gtk-doc comments.
|
|
|
|
|
|
|
2004-07-29 04:40:27 -07:00
|
|
|
|
2004-07-29 Dave Neary <bolsh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.c: Stop signed ints overflowing
|
|
|
|
|
|
while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2.
|
|
|
|
|
|
Fixes bug #128594 for drawables less than 32K wide.
|
|
|
|
|
|
|
2004-07-28 18:19:12 -07:00
|
|
|
|
2004-07-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: renamed "Cleared saved foobar now"
|
|
|
|
|
|
buttons to "Reset saves foobar to default values". Fixes bug #5673.
|
|
|
|
|
|
Added mnemonics for all the configure/save/reset buttons.
|
|
|
|
|
|
|
2004-07-28 15:39:49 -07:00
|
|
|
|
2004-07-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script):
|
|
|
|
|
|
applied patch by Kevin Cozens that moves a g_free() to the right
|
|
|
|
|
|
place (bug #148729).
|
|
|
|
|
|
|
2004-07-28 13:45:02 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c (action_groups): register the
|
|
|
|
|
|
GIMP_STOCK_VISIBLE icon with the "view" action group.
|
|
|
|
|
|
|
2004-07-28 12:35:36 -07:00
|
|
|
|
2004-07-28 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/brush.c: removed a redundant parameter
|
|
|
|
|
|
from one of the internal functions.
|
|
|
|
|
|
* plug-ins/gimpressionist/utils.c: Made sure that resources that
|
|
|
|
|
|
are selected by the presets will position their list views
|
|
|
|
|
|
accordingly.
|
|
|
|
|
|
|
2004-07-28 11:52:40 -07:00
|
|
|
|
2004-07-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* autogen.sh: if the check for libtoolize fails, try glibtoolize.
|
|
|
|
|
|
|
2004-07-28 11:42:46 -07:00
|
|
|
|
2004-07-28 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/presets.c: created a base function for
|
|
|
|
|
|
two functions with duplicate code.
|
|
|
|
|
|
|
2004-07-28 09:50:50 -07:00
|
|
|
|
2004-07-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_default_dialog.c: no need to include
|
|
|
|
|
|
"libgimp/stdplugins-intl.h" here.
|
|
|
|
|
|
|
2004-07-28 09:24:51 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c (prefs_dialog_new): reordered
|
|
|
|
|
|
buttons in the Interface -> Keyboard Shortcuts section to be
|
|
|
|
|
|
consistent with other sections which provide configure/save/clear
|
|
|
|
|
|
buttons.
|
|
|
|
|
|
|
2004-07-28 09:21:00 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
|
|
|
|
|
|
* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
|
|
|
|
|
|
don't call gimp_tool_control_set_preserve (tool->control, FALSE)
|
2004-07-28 18:19:12 -07:00
|
|
|
|
because these tools don't cache any image state and don't care
|
2004-07-28 09:21:00 -07:00
|
|
|
|
about the image changing under their feet.
|
|
|
|
|
|
|
2004-07-28 09:16:39 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_reconnect):
|
|
|
|
|
|
emit "reconnect" *before* emitting scale and scroll events so
|
|
|
|
|
|
listeners (the navigation view) can switch to the new image at the
|
|
|
|
|
|
right time.
|
|
|
|
|
|
|
2004-07-28 08:54:50 -07:00
|
|
|
|
2004-07-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Applied a patch from Brion Vibber that makes the TWAIN plug-in
|
|
|
|
|
|
available on Mac OS X (bug #147962):
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in
|
|
|
|
|
|
* plug-ins/Makefile.am: check for Mac OS X twain support.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/twain/Makefile.am
|
|
|
|
|
|
* plug-ins/twain/tw_local.h
|
|
|
|
|
|
* plug-ins/twain/tw_mac.c
|
|
|
|
|
|
* plug-ins/twain/tw_platform.h
|
|
|
|
|
|
* plug-ins/twain/tw_win.c: new files with platform specific code.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/twain/README
|
|
|
|
|
|
* plug-ins/twain/tw_dump.[ch]
|
|
|
|
|
|
* plug-ins/twain/tw_func.[ch]
|
|
|
|
|
|
* plug-ins/twain/tw_util.[ch]
|
|
|
|
|
|
* plug-ins/twain/twain.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/twain/gimp-twain.png: twain application icon used by
|
|
|
|
|
|
the Mac port.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/twain/tw_sess.c: removed, doesn't seem to be used.
|
|
|
|
|
|
|
2004-07-28 08:12:45 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in
|
|
|
|
|
|
parameter description.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/image_cmds.c
|
|
|
|
|
|
* libgimp/gimpimage_pdb.c: regenerated.
|
|
|
|
|
|
|
2004-07-28 06:58:08 -07:00
|
|
|
|
2004-07-28 DindinX <david.odin@cpe.fr>
|
|
|
|
|
|
|
2004-08-05 17:12:40 -07:00
|
|
|
|
* plug-ins/common/unsharp.c: Added a toggle button to enable/disable
|
2004-07-28 06:58:08 -07:00
|
|
|
|
preview updating. Should fix #144972.
|
|
|
|
|
|
|
2004-07-28 05:10:20 -07:00
|
|
|
|
2004-07-28 DindinX <david.odin@cpe.fr>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/shift.c
|
|
|
|
|
|
* plug-ins/common/sinus.c
|
|
|
|
|
|
* plug-ins/common/snoise.c
|
|
|
|
|
|
* plug-ins/common/spheredesigner.c: added missing calls to
|
|
|
|
|
|
g_rand_free (), remove tabs while I was at it.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/smooth_palette.c: minor cleanup
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/spread.c: removed tabs.
|
|
|
|
|
|
|
2004-07-28 04:50:20 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.h: added still unused flags type
|
|
|
|
|
|
GimpDirtyMask.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/Makefile.am
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/display/Makefile.am
|
|
|
|
|
|
* app/paint/Makefile.am
|
|
|
|
|
|
* app/text/Makefile.am
|
|
|
|
|
|
* app/tools/Makefile.am
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
|
|
|
|
|
|
support GTypeFlags and to make the value arrays private to the
|
|
|
|
|
|
get_type() functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/base-enums.c
|
|
|
|
|
|
* app/core/core-enums.c
|
|
|
|
|
|
* app/display/display-enums.c
|
|
|
|
|
|
* app/paint/paint-enums.c
|
|
|
|
|
|
* app/text/text-enums.c
|
|
|
|
|
|
* app/tools/tools-enums.c
|
|
|
|
|
|
* app/widgets/widgets-enums.c: regenerated.
|
|
|
|
|
|
|
2004-07-28 04:17:49 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpclone.c: converted tabs to spaces.
|
|
|
|
|
|
|
2004-07-28 02:45:53 -07:00
|
|
|
|
2004-07-28 DindinX <david.odin@cpe.fr>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/spread.c: fix a smallish memory leak.
|
|
|
|
|
|
|
2004-07-27 19:28:12 -07:00
|
|
|
|
2004-07-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/gimp-mkenums: synced with glib-mkenums (execept for the
|
|
|
|
|
|
newly added template feature).
|
|
|
|
|
|
|
2004-07-27 17:04:13 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpbrushselect.c
|
|
|
|
|
|
* libgimp/gimpfontselect.c
|
|
|
|
|
|
* libgimp/gimpgradientselect.c
|
|
|
|
|
|
* libgimp/gimppalettemenu.c
|
|
|
|
|
|
* libgimp/gimppaletteselect.c
|
|
|
|
|
|
* libgimp/gimppatternselect.c (gimp_*_select_destroy): don't
|
|
|
|
|
|
leak the selected object's name and its data (brush mask etc).
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpfontmenu.c: moved the icon to the left side of the
|
|
|
|
|
|
button.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to
|
|
|
|
|
|
API docs.
|
|
|
|
|
|
|
2004-07-27 15:38:40 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c
|
|
|
|
|
|
(gimp_action_group_set_action_label): forgot to strip mnemonics
|
|
|
|
|
|
here.
|
|
|
|
|
|
|
2004-07-27 15:17:30 -07:00
|
|
|
|
2004-07-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Enabled disabling all menu mnemonics. Addresses bug #120034:
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpguiconfig.[ch]
|
|
|
|
|
|
* app/config/gimprc-blurbs.h: added boolean RESTART property
|
|
|
|
|
|
"menu-menonics".
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added a GUI for it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
|
|
|
|
|
|
property "mnemonics".
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_action_group_add_*_actions): call gimp_strip_uline() on
|
|
|
|
|
|
the actions' labels if mnemonics is FALSE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionfactory.[ch]
|
|
|
|
|
|
* app/actions/actions.c: pass gui_config->menu_menmonics to
|
|
|
|
|
|
all action groups.
|
|
|
|
|
|
|
2004-07-27 14:17:16 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: commented out "Context" menu now that
|
|
|
|
|
|
we have a shortcut editor.
|
|
|
|
|
|
|
2004-07-27 12:34:27 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient-load.c: don't leak empty SVG gradients.
|
|
|
|
|
|
|
2004-07-27 09:46:43 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.c: include "libgimpbase/gimpbase.h",
|
|
|
|
|
|
not an individual header out of libgimpbase.
|
|
|
|
|
|
|
2004-07-27 09:39:00 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/Makefile.am
|
|
|
|
|
|
* libgimpbase/gimpbase.h
|
|
|
|
|
|
* libgimpbase/gimpbase.def
|
|
|
|
|
|
* libgimpbase/gimpmemsize.[ch]: added new files with memsize
|
|
|
|
|
|
related functions (moved here from gimputil.c) and
|
|
|
|
|
|
GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
|
|
|
|
|
|
app/config/gimpconfig-types.[ch]).
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpbase-private.c
|
|
|
|
|
|
* libgimp/gimptile.c
|
|
|
|
|
|
* libgimp/gimpunitcache.c
|
|
|
|
|
|
* plug-ins/help/domain.c
|
|
|
|
|
|
* app/xcf/xcf-read.c: need to include glib-object.h.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-types.[ch]: removed code that lives in
|
|
|
|
|
|
libgimpbase now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-deserialize.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpbaseconfig.c
|
|
|
|
|
|
* app/config/gimpdisplayconfig.c
|
|
|
|
|
|
* app/core/gimpcontext.c
|
|
|
|
|
|
* app/gui/grid-dialog.c
|
|
|
|
|
|
* app/tools/gimpcolortool.c
|
|
|
|
|
|
* app/widgets/gimpaction.c
|
|
|
|
|
|
* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
|
|
|
|
|
|
any longer.
|
|
|
|
|
|
|
|
|
|
|
|
004-07-27 Michael Natterer <mitch@gimp.org>
|
2004-07-27 08:15:58 -07:00
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* libgimp/gimp.h
|
|
|
|
|
|
* libgimp/gimpui.h
|
|
|
|
|
|
* libgimp/gimppalettemenu.[ch]
|
|
|
|
|
|
* libgimp/gimppaletteselect.[ch]: added palette select wrapper and
|
|
|
|
|
|
widget (straight copy & string replace of the font select stuff).
|
|
|
|
|
|
Fixes bug #136130.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-enums.h
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c
|
|
|
|
|
|
* plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can
|
|
|
|
|
|
be used in scripts.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/test-sphere.scm: added a palette
|
|
|
|
|
|
parameter to the test script.
|
|
|
|
|
|
|
2004-07-27 08:10:41 -07:00
|
|
|
|
2004-07-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.c (gimp_image_finalize): remove the image
|
|
|
|
|
|
from the image hash table and set its "gimp" pointer to NULL
|
|
|
|
|
|
*after* all layers, channels, vectors and the selection are
|
|
|
|
|
|
finalized; otherwise these items have no chance of removing
|
|
|
|
|
|
themselves from the item hash table (because image->gimp is
|
|
|
|
|
|
already NULL). Spotted by pgimeno and nomis.
|
|
|
|
|
|
(should be backported after it got some testing)
|
|
|
|
|
|
|
2004-07-27 05:41:44 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
|
|
|
|
|
|
|
2004-07-27 05:39:56 -07:00
|
|
|
|
2004-07-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
|
|
|
|
|
|
sure we always set a non-null URI.
|
|
|
|
|
|
|
2004-07-27 05:28:30 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h removed unused help IDs
|
|
|
|
|
|
GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
|
|
|
|
|
|
for these entries are generated from the procedure names.
|
|
|
|
|
|
|
2004-07-27 04:19:33 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp.c (gimp_help): print the help-id and
|
|
|
|
|
|
help-domain to stdout if gimp was started with the --verbose
|
|
|
|
|
|
command-line option.
|
|
|
|
|
|
|
2004-07-26 17:26:14 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
|
2004-07-27 04:19:33 -07:00
|
|
|
|
show extensions in the filters menu. Is this a good idea at all?
|
2004-07-26 17:26:14 -07:00
|
|
|
|
|
2004-07-26 16:11:20 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpbrushmenu.c
|
|
|
|
|
|
* libgimp/gimppatternmenu.c: attempt to make the brush and pattern
|
|
|
|
|
|
selectors look less like buttons (supposed to fix bug #147777).
|
|
|
|
|
|
|
2004-07-26 15:30:35 -07:00
|
|
|
|
2004-07-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events):
|
|
|
|
|
|
also accept the short hexadecimal notation (3 hex digits).
|
|
|
|
|
|
|
2004-07-26 14:21:34 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS):
|
|
|
|
|
|
added new files.
|
|
|
|
|
|
|
2004-07-26 14:09:16 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimptoolview.c
|
2004-07-27 05:41:44 -07:00
|
|
|
|
* app/widgets/widgets-types.h: changed accordingly.
|
2004-07-26 14:09:16 -07:00
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetsmarshal.list
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
|
|
|
|
|
|
renderer moved here from app/widgets.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
|
|
|
|
|
|
new toggle cell renderer.
|
|
|
|
|
|
|
2004-07-26 14:07:15 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
|
|
|
|
|
|
function which clears the whole list of data set by plug-ins.
|
|
|
|
|
|
|
|
|
|
|
|
(procedural_db_free): use it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c
|
|
|
|
|
|
* app/actions/plug-in-commands.[ch]: added action, callback and
|
|
|
|
|
|
confirmation dialog for "Reset all filters to default values".
|
|
|
|
|
|
Somehow addresses bug #81015.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: added a help ID for the new action.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: added it to the "Filters" submenu.
|
|
|
|
|
|
|
2004-07-26 13:26:07 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcellrenderercolor.c
|
|
|
|
|
|
(gimp_cell_renderer_color_get_size): fine-tuning.
|
|
|
|
|
|
|
2004-07-26 12:56:47 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
|
|
|
|
|
|
to GimpParamSpecRGB.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-deserialize.c
|
|
|
|
|
|
* app/config/gimpconfig-dump.c
|
|
|
|
|
|
* app/config/gimpconfig-serialize.c
|
|
|
|
|
|
* app/config/gimpscanner.c
|
|
|
|
|
|
* app/core/gimp-utils.c
|
|
|
|
|
|
* app/core/gimpcontext.c
|
|
|
|
|
|
* app/core/gimpgrid.c
|
|
|
|
|
|
* app/display/gimpdisplayoptions.c
|
|
|
|
|
|
* app/text/gimptext.c
|
|
|
|
|
|
* app/tools/gimpcolortool.c
|
|
|
|
|
|
* app/widgets/gimpaction.c
|
|
|
|
|
|
* app/widgets/gimpcolorbar.c
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-26 12:22:22 -07:00
|
|
|
|
2004-07-26 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: added a de-allocation to the PPM's
|
|
|
|
|
|
allocated by the size map dialog.
|
|
|
|
|
|
|
2004-07-26 12:19:04 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient-load.c: load all linear gradients from an
|
|
|
|
|
|
SVG file, not only the first one.
|
|
|
|
|
|
|
2004-07-26 12:00:22 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatafactory.h: added "gboolean writable" to the
|
|
|
|
|
|
GimpDataFactoryLoaderEntry struct. Return a GList* instead of
|
|
|
|
|
|
GimpData* from GimpDataLoadFunc so it's possible to load more than
|
|
|
|
|
|
one data object from one file.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
|
|
|
|
|
|
changed accordingly: add all items of the returned lists to the
|
|
|
|
|
|
data factory. Make the data object writable only if it's in the
|
|
|
|
|
|
writable path *and* its loader entry says it's a writable format
|
|
|
|
|
|
*and* the returned list contains exactly one element.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c (gimp_real_initialize): declare all loader
|
|
|
|
|
|
entries as writable where we have code to read and write exactly
|
|
|
|
|
|
one object per file; all others are not writable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrush.[ch]
|
|
|
|
|
|
* app/core/gimpbrushgenerated.[ch]
|
|
|
|
|
|
* app/core/gimpbrushpipe.[ch]
|
|
|
|
|
|
* app/core/gimpgradient-load.[ch]
|
|
|
|
|
|
* app/core/gimppalette.[ch]
|
|
|
|
|
|
* app/core/gimppattern.[ch] (all load functions): return a list
|
|
|
|
|
|
containing the loaded object instead of the object itself.
|
|
|
|
|
|
|
2004-07-26 11:52:35 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell
|
|
|
|
|
|
renderer.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorarea.[ch]: exported the function that
|
|
|
|
|
|
renders the color to a buffer for internal use in libgimpwidgets.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer
|
|
|
|
|
|
for the completion popup.
|
|
|
|
|
|
|
2004-07-26 11:17:42 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimpcolor.def
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def: added new symbols.
|
|
|
|
|
|
|
2004-07-26 11:14:48 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimpadaptivesupersample.c
|
|
|
|
|
|
* libgimpcolor/gimpcolorspace.c
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c
|
|
|
|
|
|
* libgimp/gimp.h: include <glib-object.h> instead of <glib.h>.
|
|
|
|
|
|
|
2004-07-26 11:13:35 -07:00
|
|
|
|
2004-07-26 Shlomi Fish <shlomif@iglu.org.il>
|
2004-07-26 11:08:29 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: placed all the orientation map-related
|
|
|
|
|
|
public functions in orientmap.h. Now we're freeing the PPM's that it
|
|
|
|
|
|
is allocating by a call to orientation_map_free_resources().
|
|
|
|
|
|
|
2004-07-26 09:27:43 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h: removed unused typedef
|
|
|
|
|
|
GimpDataObjectLoaderFunc.
|
|
|
|
|
|
|
2004-07-26 08:20:18 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c
|
|
|
|
|
|
* libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names()
|
|
|
|
|
|
that gives access to the list of SVG color keywords.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that
|
|
|
|
|
|
allows to enter colors in hex notation or by using color names.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry.
|
|
|
|
|
|
|
2004-07-26 07:50:51 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
|
|
|
|
|
|
to gimp_edit_selection_tool_start(). Removed enum EditType.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/tools-enums.h: added enum GimpTranslateMode instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpmovetool.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpselectiontool.[ch]: added protected utility
|
|
|
|
|
|
function gimp_selection_tool_start_edit().
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpfreeselecttool.c
|
|
|
|
|
|
* app/tools/gimpfuzzyselecttool.c
|
|
|
|
|
|
* app/tools/gimprectselecttool.c: use the new function instead of
|
|
|
|
|
|
duplicating the same code three times, don't include
|
|
|
|
|
|
"gimpeditselectiontool.h".
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c: don't include
|
|
|
|
|
|
"gimpeditselectiontool.h".
|
|
|
|
|
|
|
2004-07-26 06:15:22 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
|
|
|
|
|
|
image's undo to prevent live-movement from ending up on the undo
|
|
|
|
|
|
stack. Instead, just stop pushing undo steps after the initial
|
|
|
|
|
|
movement. Simplifies edit_select's undo code quite a bit and fixes
|
|
|
|
|
|
bug #148458.
|
|
|
|
|
|
|
2004-07-26 05:07:01 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events):
|
|
|
|
|
|
accept SVG color names in the hex entry. Not very intuitive but
|
|
|
|
|
|
probably a nice experts feature and it can be improved later.
|
|
|
|
|
|
|
2004-07-26 03:44:25 -07:00
|
|
|
|
2004-07-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking
|
|
|
|
|
|
at GIMP_MINOR_VERSION.
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c: don't #include "tools/gimp-tools.h".
|
|
|
|
|
|
|
2004-07-25 17:44:01 -07:00
|
|
|
|
2004-07-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/bmp/bmp.h
|
|
|
|
|
|
* plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that
|
|
|
|
|
|
fixes extra data overflow, nonstandard 16bpp field arrangement
|
|
|
|
|
|
and unrecognized compression (bug #143682).
|
|
|
|
|
|
|
2004-07-25 14:02:31 -07:00
|
|
|
|
2004-07-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/decompose.c: clamp results of LAB decomposition
|
2004-07-25 17:44:01 -07:00
|
|
|
|
so that out-of-gamut conversions do not overflow and get badly
|
|
|
|
|
|
distorted. Fixes bug #147603. Note that it would probably be a
|
|
|
|
|
|
good idea to do similar things for other conversion types.
|
2004-07-25 14:02:31 -07:00
|
|
|
|
|
2004-07-25 11:12:49 -07:00
|
|
|
|
2004-07-25 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: converted checks for initialization of
|
|
|
|
|
|
ppm's done by checking the "col" buffer, to macro calls.
|
|
|
|
|
|
|
2004-07-25 07:29:27 -07:00
|
|
|
|
2004-07-25 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
2004-07-25 17:44:01 -07:00
|
|
|
|
* plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst
|
|
|
|
|
|
crashes if given malicious presets with out of range values, in
|
|
|
|
|
|
the radio buttons group numeric values: "placetype", "orienttype",
|
|
|
|
|
|
etc. ").
|
2004-07-25 07:29:27 -07:00
|
|
|
|
|
|
|
|
|
|
This was done by adding clamps to the relevant values in the preset.
|
|
|
|
|
|
|
2004-07-25 00:53:27 -07:00
|
|
|
|
2004-07-25 Raphaël Quinet <quinet@gamers.org>
|
|
|
|
|
|
|
|
|
|
|
|
* INSTALL: Minor fixes and improvements. Suggest using a
|
|
|
|
|
|
different prefix and setting PKG_CONFIG_LIBDIR if old versions of
|
|
|
|
|
|
GTK+ libs are found and cannot be removed without breaking other
|
|
|
|
|
|
packages.
|
|
|
|
|
|
|
2004-07-23 12:34:47 -07:00
|
|
|
|
2004-07-23 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: created a header "orientation.h"
|
|
|
|
|
|
for the Orientation tab specific declarations.
|
|
|
|
|
|
|
2004-07-23 11:01:12 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code
|
|
|
|
|
|
for grayscale previews.
|
|
|
|
|
|
|
2004-07-23 07:00:38 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient-load.c (svg_parser_end_element): fixed
|
|
|
|
|
|
handling of the last gradient segment and did some code cleanup.
|
|
|
|
|
|
|
2004-07-23 05:19:21 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved
|
|
|
|
|
|
error message.
|
2004-07-23 05:55:58 -07:00
|
|
|
|
(svg_parser_end_element): don't crash on empty gradient definitions.
|
2004-07-23 05:19:21 -07:00
|
|
|
|
|
2004-07-23 04:31:16 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/test-color-parser.c: added more test samples.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the
|
|
|
|
|
|
new tests.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient-load.c: changed SVG parser to handle
|
|
|
|
|
|
gradients that are defined more deeply in the SVG hierarchy. Added
|
|
|
|
|
|
a simplistic CSS style parser to deal with gradient definitions
|
|
|
|
|
|
that use CSS to define the gradient stop properties (closes bug
|
|
|
|
|
|
#148127).
|
|
|
|
|
|
|
2004-07-22 18:08:34 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatafactory.c: some newlines to improve error
|
|
|
|
|
|
messages.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed
|
|
|
|
|
|
error handling.
|
|
|
|
|
|
|
2004-07-22 16:30:52 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/Makefile.am
|
|
|
|
|
|
* libgimpcolor/test-color-parser.c: added a simple unit test
|
|
|
|
|
|
framework for the color parser.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmath/test-md5.c: minor cleanup.
|
|
|
|
|
|
|
2004-07-22 15:29:54 -07:00
|
|
|
|
2004-07-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support
|
|
|
|
|
|
for the "transparent" color name.
|
|
|
|
|
|
|
2004-07-22 15:22:59 -07:00
|
|
|
|
2004-07-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c
|
|
|
|
|
|
* libgimpcolor/gimprgb.h: improved the CSS color parser code,
|
|
|
|
|
|
added new function gimp_rgba_parse_css(), added support for HSL
|
|
|
|
|
|
color values.
|
|
|
|
|
|
|
2004-07-22 12:07:28 -07:00
|
|
|
|
2004-07-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb-parse.c
|
|
|
|
|
|
* libgimpcolor/gimprgb.h: use a signed integer to pass the string
|
|
|
|
|
|
length to the new parser functions. The API explicitely asks for
|
|
|
|
|
|
-1 to be passed...
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c
|
|
|
|
|
|
* app/core/gimpgradient-load.[ch]
|
|
|
|
|
|
* app/core/gimpgradient.h: added preliminary support for loading
|
|
|
|
|
|
simple SVG gradients (see bug #148127). Be careful with this new
|
|
|
|
|
|
feature; editing the loaded gradient will cause the SVG file to be
|
|
|
|
|
|
overwritten! Work in progress...
|
|
|
|
|
|
|
2004-07-22 06:58:29 -07:00
|
|
|
|
2004-07-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/gimpgradient-load.[ch]
|
|
|
|
|
|
* app/core/gimpgradient-save.[ch]
|
|
|
|
|
|
* app/core/gimpgradient.[ch]: moved gradient file handling out of
|
|
|
|
|
|
gimpgradient.c to new files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c
|
|
|
|
|
|
* app/actions/gradients-commands.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name.
|
|
|
|
|
|
|
2004-07-22 05:47:03 -07:00
|
|
|
|
2004-07-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax.
|
|
|
|
|
|
|
2004-07-22 05:42:57 -07:00
|
|
|
|
2004-07-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionview.c: rephrased the text for the dialog
|
|
|
|
|
|
that appears if a new shortcut collides with an existing one.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
|
2004-07-22 05:47:03 -07:00
|
|
|
|
which accepts RGB colors in hexadecimal notation or as SVG color
|
2004-07-22 05:42:57 -07:00
|
|
|
|
keywords.
|
|
|
|
|
|
|
2004-07-22 05:05:36 -07:00
|
|
|
|
2004-07-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_resume):
|
|
|
|
|
|
s/pause/resume/ in the API docs.
|
|
|
|
|
|
|
2004-07-22 04:32:50 -07:00
|
|
|
|
2004-07-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/gimp-remote.c (main): correctly convert relative paths to
|
|
|
|
|
|
URIs. Append the resulting URI only if it's not NULL.
|
|
|
|
|
|
|
2004-07-22 04:18:52 -07:00
|
|
|
|
2004-07-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
|
|
|
|
|
|
"accel-changed" of the accel_group using connect_object(), not
|
|
|
|
|
|
just connect() so we don't crash when it's emitted after the
|
|
|
|
|
|
toolbox is destroyed.
|
|
|
|
|
|
|
2004-07-21 12:25:12 -07:00
|
|
|
|
2004-07-21 Ray Strode <rstrode@redhat.com>
|
2004-07-21 14:14:56 -07:00
|
|
|
|
|
|
|
|
|
|
* gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop
|
|
|
|
|
|
file for new MIME system.
|
2004-07-21 12:25:12 -07:00
|
|
|
|
|
2004-07-21 10:06:18 -07:00
|
|
|
|
2004-07-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gif.c: declared global const variable as static.
|
|
|
|
|
|
Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why).
|
|
|
|
|
|
|
2004-07-21 09:29:29 -07:00
|
|
|
|
2004-07-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c
|
|
|
|
|
|
* plug-ins/common/gif.c
|
|
|
|
|
|
* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
|
|
|
|
|
|
text views. Fixes bug #148025.
|
|
|
|
|
|
|
2004-07-21 09:11:31 -07:00
|
|
|
|
2004-07-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Enabled the various "Clear saved foobar now" buttons in prefs:
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/session.[ch]
|
|
|
|
|
|
* app/menus/menus.[ch]
|
|
|
|
|
|
* app/widgets/gimpdevices.[ch]: implemented the _clear()
|
|
|
|
|
|
functions: unlink() the rc file and set an internal flag that it
|
|
|
|
|
|
has been deleted. Added "gboolean always_save" parameter to the
|
|
|
|
|
|
_save() functions and don't save anything if it is FALSE and the
|
|
|
|
|
|
internal deletion flag has been set.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c
|
|
|
|
|
|
* app/widgets/gimpdevicestatus.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added callbacks for all "Save now"
|
|
|
|
|
|
and "Clear now" buttons and show error messages if clearing fails.
|
|
|
|
|
|
Inform the user that she has to restart GIMP to see the effect of
|
|
|
|
|
|
the clearing.
|
|
|
|
|
|
|
2004-07-21 07:09:36 -07:00
|
|
|
|
2004-07-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list
|
|
|
|
|
|
* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
|
|
|
|
|
|
parameter to the GimpCellRendererAccel::accel_edited() signal.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionview.c: distinguish between deletion of an
|
|
|
|
|
|
accelerator and the user entering an invalid accelerator.
|
|
|
|
|
|
|
2004-07-21 06:48:13 -07:00
|
|
|
|
2004-07-21 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: normalized the identifiers in
|
|
|
|
|
|
placement.c.
|
|
|
|
|
|
|
2004-07-21 05:53:38 -07:00
|
|
|
|
2004-07-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c: changed names of actions which
|
|
|
|
|
|
select brushes, patterns etc. from e.g. "context-brush-first" to
|
|
|
|
|
|
"context-brush-select-first".
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: changed accordingly.
|
|
|
|
|
|
|
2004-07-21 04:28:31 -07:00
|
|
|
|
2004-07-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: remember the keyboard shortcut
|
|
|
|
|
|
dialog and show it only once.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionview.c
|
|
|
|
|
|
* app/widgets/gimpcellrendereraccel.c: minor cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
Seems to work pretty well now and thus fixes bug #142922.
|
|
|
|
|
|
|
2004-07-20 17:39:46 -07:00
|
|
|
|
2004-07-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
|
|
|
|
|
|
which displays an accelerator and allows to edit it (ripped
|
|
|
|
|
|
out of libegg and modified).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionview.c: use the new renderer and connect
|
|
|
|
|
|
to its "accel-edited" signal (its callback is one huge mess that
|
|
|
|
|
|
needs to be cleaned up). Added ugly hack to work around GTK+ API
|
|
|
|
|
|
limitation that seems to prevent implementing a shortcut editor in
|
|
|
|
|
|
a sane way.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c
|
|
|
|
|
|
* app/actions/image-actions.c
|
|
|
|
|
|
* app/actions/tools-actions.c: added ugly hacks here, too.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
|
|
|
|
|
|
editor by Close.
|
|
|
|
|
|
|
2004-07-20 14:20:39 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that
|
|
|
|
|
|
the missing po files have been added (tips/pa.po is still missing
|
|
|
|
|
|
though).
|
|
|
|
|
|
|
2004-07-20 11:50:20 -07:00
|
|
|
|
2004-07-20 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionfactory.[ch]
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
|
|
|
|
|
|
properties to GtkActionGroup and allow to register them in the
|
|
|
|
|
|
GimpActionFactory.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c: register user visible labels and icons
|
|
|
|
|
|
with all action groups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpactionview.[ch]: new widget which shows a
|
|
|
|
|
|
treeview of action groups and their actions & shortcuts.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
|
|
|
|
|
|
utility function.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.[ch]: added
|
|
|
|
|
|
gimp_get_accel_string() utility function.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.[ch]: added
|
|
|
|
|
|
gimp_controllers_get_ui_manager() which will be used for setting
|
|
|
|
|
|
up the controller mapping dialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added a "Configure Keyboard
|
2004-07-21 04:28:31 -07:00
|
|
|
|
Shortcuts" button which pops up a GimpActionView. Work in
|
2004-07-20 11:50:20 -07:00
|
|
|
|
progress...
|
|
|
|
|
|
|
2004-07-20 11:36:07 -07:00
|
|
|
|
2004-07-20 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-actions.c: make sure that the "image-new" and
|
|
|
|
|
|
"image-new-from-image" actions always have the same shortcut.
|
|
|
|
|
|
|
2004-07-20 11:19:47 -07:00
|
|
|
|
2004-07-20 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_main.c
|
|
|
|
|
|
* plug-ins/Lighting/lighting_main.h
|
|
|
|
|
|
* plug-ins/Lighting/lighting_preview.c
|
|
|
|
|
|
* plug-ins/Lighting/lighting_preview.h
|
|
|
|
|
|
* plug-ins/Lighting/lighting_shade.c
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: completely reworked UI for
|
|
|
|
|
|
lighting page. Now supports up to 6 lights (more is trivial).
|
|
|
|
|
|
Added ability to temporarily isolate selected light. Added
|
|
|
|
|
|
light intensity controls. Can interactively position each light
|
|
|
|
|
|
(does not quite work yet for directional lights).
|
|
|
|
|
|
|
2004-07-20 11:13:49 -07:00
|
|
|
|
2004-07-20 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tools-actions.c: added an icon to the
|
|
|
|
|
|
"tools-visibility" action.
|
|
|
|
|
|
|
2004-07-20 09:55:39 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite.c (gimp_composite_init): now that
|
|
|
|
|
|
the output depends on --verbose, enable it for stable releases also.
|
|
|
|
|
|
|
2004-07-20 09:54:22 -07:00
|
|
|
|
2004-07-20 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/presets.c: fixed the incorrect strings
|
|
|
|
|
|
for input and output of the preset's fields. (a relic of an
|
|
|
|
|
|
irresponsible search-and-replace script).
|
2004-07-20 09:55:39 -07:00
|
|
|
|
|
2004-07-20 09:54:22 -07:00
|
|
|
|
* plug-ins/gimpressionist/: normalized the identifiers of
|
|
|
|
|
|
orientmap.c.
|
|
|
|
|
|
|
2004-07-20 08:59:12 -07:00
|
|
|
|
2004-07-20 Helvetix Victorinox <helvetix@gimp.org>
|
|
|
|
|
|
|
2004-07-20 09:33:58 -07:00
|
|
|
|
* app/composite/Makefile.am (regenerate): Updated make-installer.py
|
2004-07-20 09:02:27 -07:00
|
|
|
|
command line to take advantage of the new compile time method of
|
|
|
|
|
|
determining which instruction set to compile.
|
|
|
|
|
|
|
2004-07-20 08:59:12 -07:00
|
|
|
|
* app/composite/gimp-composite.c (gimp_composite_init): Print the
|
|
|
|
|
|
list of active instruction sets if the --verbose command line
|
|
|
|
|
|
switch is ON (via be_verbose)
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-x86.h: Factored code from the mmx,
|
|
|
|
|
|
and sse implementations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/make-installer.py: Raised the number of test
|
|
|
|
|
|
iterations from 1 to 10.
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-3dnow.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-3dnow-test.c
|
|
|
|
|
|
* app/composite/gimp-composite-3dnow-installer.c
|
|
|
|
|
|
* app/composite/gimp-composite-altivec.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-altivec-test.c
|
|
|
|
|
|
* app/composite/gimp-composite-altivec-installer.c
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-altivec-test.c
|
|
|
|
|
|
* app/composite/gimp-composite-altivec-installer.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-sse-test.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse-installer.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse2.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-sse2-test.c
|
|
|
|
|
|
* app/composite/gimp-composite-sse2-installer.c
|
|
|
|
|
|
* app/composite/gimp-composite-vis.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-vis-test.c:
|
|
|
|
|
|
Regenerated sources via make-installer.py
|
|
|
|
|
|
|
2004-07-20 07:33:22 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c
|
|
|
|
|
|
* app/base/base.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite.[ch]: pass "be_verbose" to the base
|
|
|
|
|
|
and composite subsystems.
|
|
|
|
|
|
|
2004-07-20 03:06:46 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* autogen.sh: added some empty lines to improve readability of the
|
|
|
|
|
|
output in case of problems.
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: bumped version number to 2.1.3.
|
|
|
|
|
|
|
2004-07-19 23:33:03 -07:00
|
|
|
|
2004-07-19 Helvetix Victorinox <helvetix@gimp.org>
|
|
|
|
|
|
|
2004-07-20 01:56:33 -07:00
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
(xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx)
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
(xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx)
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
(gimp_composite_difference_rgba8_rgba8_rgba8_mmx)
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
(gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber
|
|
|
|
|
|
register corrections.
|
2004-07-19 23:33:03 -07:00
|
|
|
|
|
2004-07-19 18:09:16 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Made 2.1.2 release.
|
|
|
|
|
|
|
2004-07-19 17:53:19 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/winicon/icoload.c
|
|
|
|
|
|
* plug-ins/winicon/icosave.c: added explicit casts to please the
|
|
|
|
|
|
compiler.
|
|
|
|
|
|
|
2004-07-19 16:44:42 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-07-19 17:28:58 -07:00
|
|
|
|
* plug-ins/gimpressionist/Makefile.am (gimpressionist_sources):
|
|
|
|
|
|
added paper.h.
|
|
|
|
|
|
|
2004-07-19 17:09:58 -07:00
|
|
|
|
* plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back
|
|
|
|
|
|
arcball.h.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_main.c
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_preview.c: no need to include
|
|
|
|
|
|
arcball.h here.
|
|
|
|
|
|
|
2004-07-19 16:44:42 -07:00
|
|
|
|
* plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-examples/Makefile.am: cleanup.
|
|
|
|
|
|
|
2004-07-19 15:06:09 -07:00
|
|
|
|
2004-07-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: fixed some GUI issues:
|
|
|
|
|
|
left-align labels, use stock buttons, added line-breaks to make
|
|
|
|
|
|
the code fit into 80 columns.
|
|
|
|
|
|
|
2004-07-19 14:33:55 -07:00
|
|
|
|
2004-07-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with
|
|
|
|
|
|
the new code: don't include individual glib headers, never ever
|
|
|
|
|
|
use sprintf(), mark user-visible strings for translations, use
|
|
|
|
|
|
default messages, removed trailing whitespace.
|
|
|
|
|
|
|
2004-07-19 12:49:19 -07:00
|
|
|
|
2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: added ability to save and load
|
|
|
|
|
|
presets for lights.
|
|
|
|
|
|
|
2004-07-19 09:19:01 -07:00
|
|
|
|
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/orientation.c: normalized some variables
|
|
|
|
|
|
in the module and fixed some indentation.
|
|
|
|
|
|
|
2004-07-19 08:57:07 -07:00
|
|
|
|
2004-07-19 Helvetix Victorinox <helvetix@gimp.org>
|
|
|
|
|
|
|
2004-07-19 09:33:16 -07:00
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
(gimp_composite_addition_rgba8_rgba8_rgba8_mmx)
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.c
|
|
|
|
|
|
(gimp_composite_burn_rgba8_rgba8_rgba8_mmx)
|
|
|
|
|
|
* app/composite/gimp-composite-x86.h: Correction of clobbered
|
|
|
|
|
|
register lists, as additional progress against bug #147013.
|
2004-07-19 08:57:07 -07:00
|
|
|
|
|
2004-07-19 08:34:40 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list: removed unused VOID:UINT,STRING.
|
|
|
|
|
|
|
2004-07-19 08:25:44 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c
|
|
|
|
|
|
(file_open_location_dialog_show): added the "web" icon left of
|
|
|
|
|
|
label & entry.
|
|
|
|
|
|
|
2004-07-19 07:37:40 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/paint-enums.h: added enum GimpPaintState (with values
|
|
|
|
|
|
that have a name space).
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]
|
|
|
|
|
|
* app/paint/gimpairbrush.c
|
|
|
|
|
|
* app/paint/gimpbrushcore.c
|
|
|
|
|
|
* app/paint/gimpclone.c
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint/gimpdodgeburn.c
|
|
|
|
|
|
* app/paint/gimperaser.c
|
|
|
|
|
|
* app/paint/gimpink.c
|
|
|
|
|
|
* app/paint/gimppaintbrush.c
|
|
|
|
|
|
* app/paint/gimppaintcore-stroke.c
|
|
|
|
|
|
* app/paint/gimpsmudge.c
|
|
|
|
|
|
* app/tools/gimppainttool.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpinktool.c: removed unused #include.
|
|
|
|
|
|
|
2004-07-19 07:25:59 -07:00
|
|
|
|
2004-07-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
|
|
|
|
|
|
moved variable declarations to the scope they are being used in,
|
|
|
|
|
|
removed trailing whitespace, minor cleanups.
|
|
|
|
|
|
|
2004-07-19 07:12:30 -07:00
|
|
|
|
2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel-combine.c: put in two lines accidentally
|
|
|
|
|
|
omitted in previous change, improve doc comment.
|
|
|
|
|
|
|
2004-07-19 06:22:44 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimpwin32-io.h: added copyright header, added
|
|
|
|
|
|
#defines for access(), F_OK, R_OK and X_OK.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdata.c: include the above instead of defining
|
|
|
|
|
|
the workarounds here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/tile-swap.c
|
|
|
|
|
|
* app/config/gimpconfig-dump.c
|
|
|
|
|
|
* libgimpthumb/gimpthumb-utils.c
|
|
|
|
|
|
* libgimpthumb/gimpthumbnail.c: for consistency, #include
|
|
|
|
|
|
gimpwin32-io.h with "" instead of <>.
|
|
|
|
|
|
|
2004-07-19 05:43:40 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
|
|
|
|
|
|
comments not intended for gtk-doc must not start with '/**'.
|
|
|
|
|
|
|
2004-07-19 05:20:27 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.h (struct _PlugIn): removed obsolete
|
|
|
|
|
|
compile-time check for GLIB >= 2.3.5.
|
|
|
|
|
|
|
2004-07-19 05:18:59 -07:00
|
|
|
|
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* ChangeLog: Fixed a copy-and-paste error with the dates of my commits.
|
|
|
|
|
|
* plug-ins/gimpressionist/ppmtool.c: removed a few commented-out
|
|
|
|
|
|
asserts, and the function that was used to implement them.
|
|
|
|
|
|
|
2004-07-19 05:08:37 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: reordered and commented to match
|
|
|
|
|
|
API docs.
|
|
|
|
|
|
|
2004-07-19 04:35:43 -07:00
|
|
|
|
2004-07-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_browse.[ch]: renamed struct member
|
|
|
|
|
|
file_selection to file_chooser.
|
|
|
|
|
|
|
2004-07-19 04:33:59 -07:00
|
|
|
|
2004-07-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/config-types.h: removed GimpConfigInterface typedef,
|
|
|
|
|
|
added comments to typedefs which don't belong here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig.h: added GimpConfigInterface typedef.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h
|
|
|
|
|
|
* app/display/display-types.h: added commented out typedefs for
|
|
|
|
|
|
types that live in config-types.h for obscure reasons.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h: reordered stuff to match the order in the
|
|
|
|
|
|
API docs (makes keeping stuff in sync much easier).
|
|
|
|
|
|
|
2004-07-19 05:18:59 -07:00
|
|
|
|
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
2004-07-19 03:28:23 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors
|
|
|
|
|
|
pairs for ppm_ with just the destructors.
|
|
|
|
|
|
|
2004-07-19 05:18:59 -07:00
|
|
|
|
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
2004-07-19 03:02:33 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/repaint.c: normalized some identifiers of
|
|
|
|
|
|
repaint.c, and corrected some indentation there.
|
|
|
|
|
|
|
2004-07-18 12:31:29 -07:00
|
|
|
|
2004-07-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel-combine.c: improve anti-aliasing for
|
|
|
|
|
|
elliptical selections, as described in bug #147836.
|
|
|
|
|
|
|
2004-07-18 11:24:32 -07:00
|
|
|
|
2004-07-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.h: don't start a comment with
|
|
|
|
|
|
/** unless it's meant to be parsed by gtk-doc.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am:
|
|
|
|
|
|
* app/actions/file-dialog-commands.[ch]: removed, not used any
|
|
|
|
|
|
longer.
|
|
|
|
|
|
|
2004-07-18 02:10:17 -07:00
|
|
|
|
2004-07-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpink-blob.c (blob_make_convex): Check if the
|
|
|
|
|
|
array index is legal before using it, not the other way around.
|
|
|
|
|
|
Fixes bug #144856.
|
|
|
|
|
|
|
2004-07-17 18:45:57 -07:00
|
|
|
|
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/polar.c (dialog_update_preview): Fixed a
|
|
|
|
|
|
write to unallocated memory that was causing crashes in various
|
|
|
|
|
|
spots.
|
|
|
|
|
|
|
2004-07-17 17:30:56 -07:00
|
|
|
|
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/polar.c (polarize_func): moved array
|
|
|
|
|
|
initialization out of variable declaration. Fixes bug #147799.
|
|
|
|
|
|
|
2004-07-17 12:53:05 -07:00
|
|
|
|
2004-07-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: added the removed help IDs back.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
|
|
|
|
|
|
IDs and added gimp_file_proc_view_get_help_id() which returns the
|
|
|
|
|
|
selected item's help ID.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c: added a custom help func which
|
|
|
|
|
|
shows the help for the selected file_proc if the proc_view has the
|
|
|
|
|
|
focus.
|
|
|
|
|
|
|
2004-07-17 06:06:59 -07:00
|
|
|
|
2004-07-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
|
|
|
|
|
|
for "file-open-location".
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c: create the scrolled window with
|
|
|
|
|
|
shadow_type GTK_SHADOW_IN.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
|
|
|
|
|
|
procedures that register a prefix (the URL loader).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: removed help IDs that used to be
|
|
|
|
|
|
used from the file-open and file-save menus.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/xwd.c (query): "X window dump" seems to be more
|
|
|
|
|
|
appropriate than "X window image".
|
|
|
|
|
|
|
2004-07-17 05:19:58 -07:00
|
|
|
|
2004-07-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/file-dialog-actions.[ch]
|
|
|
|
|
|
* app/actions/file-open-actions.[ch]
|
|
|
|
|
|
* app/actions/file-save-actions.[ch]: these aren't needed any
|
|
|
|
|
|
longer.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/Makefile.am
|
|
|
|
|
|
* app/menus/file-dialog-menu.[ch]
|
|
|
|
|
|
* app/menus/file-open-menu.[ch]
|
|
|
|
|
|
* app/menus/file-save-menu.[ch]: these aren't needed any longer.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/file-open-menu.xml
|
|
|
|
|
|
* menus/file-save-menu.xml: these are also not needed any longer.
|
|
|
|
|
|
|
2004-07-17 04:33:03 -07:00
|
|
|
|
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from
|
|
|
|
|
|
Brion Vibber that fixes corruption when saving RLE-encoded
|
|
|
|
|
|
BMPs on big endian hosts. Fixes bug #147759.
|
|
|
|
|
|
|
2004-07-17 02:43:46 -07:00
|
|
|
|
2004-07-17 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: normalized the identifiers of
|
|
|
|
|
|
general.c and general.h. Also, renamed a callback from _store
|
|
|
|
|
|
to simply _callback to avoid confusion with the _store methods.
|
|
|
|
|
|
Some of the member variables of the pcvals struct were changed
|
|
|
|
|
|
as a result.
|
|
|
|
|
|
|
2004-07-16 22:24:08 -07:00
|
|
|
|
2004-07-16 Helvetix Victorinox <helvetix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-mmx.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-sse.[ch]
|
|
|
|
|
|
* app/composite/gimp-composite-sse2.[ch]:
|
|
|
|
|
|
|
|
|
|
|
|
We've had trouble compiling with the Intel compiler which
|
|
|
|
|
|
identifies itself as GCC, but doesn't support the same extended
|
|
|
|
|
|
assembly features/misfeatures as GCC. With the help of the Intel
|
|
|
|
|
|
compiler group, we've determined that the Intel compiler can be
|
|
|
|
|
|
identified at compile time by the definition of the preprocessor
|
|
|
|
|
|
variable __INTEL_COMPILER.
|
|
|
|
|
|
|
|
|
|
|
|
These changes make all of the assembly code currently written to
|
|
|
|
|
|
simply avoid the Intel compiler.
|
|
|
|
|
|
|
|
|
|
|
|
This is an interim solution to get a build working despite the
|
|
|
|
|
|
Intel compiler. A more correct solution has been identified, see
|
|
|
|
|
|
the discussion of bug #147013 for more information.
|
|
|
|
|
|
|
2004-07-16 15:54:53 -07:00
|
|
|
|
2004-07-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/xcf/xcf.c (xcf_init): also register the internal XCF
|
|
|
|
|
|
handlers according to the new scheme.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl
|
|
|
|
|
|
* plug-ins/common/hrz.c: removed the HRZ file plug-in since it
|
|
|
|
|
|
doesn't seem to be very useful.
|
|
|
|
|
|
|
2004-07-16 15:45:03 -07:00
|
|
|
|
2004-07-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
|
|
|
|
|
|
(plug_ins_init_file): use g_slist_prepend() instead of
|
|
|
|
|
|
g_slist_append().
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/url.c (query): ported to the new PDB registration
|
|
|
|
|
|
scheme.
|
|
|
|
|
|
|
2004-07-16 14:47:06 -07:00
|
|
|
|
2004-07-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
|
|
|
|
|
|
by their menu labels.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfileprocview.c: removed the sort function here.
|
|
|
|
|
|
|
2004-07-16 14:24:39 -07:00
|
|
|
|
2004-07-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpfileprocview.[ch]: added new widget that offers
|
|
|
|
|
|
a treeview on file procedures.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.[ch]: replaced the file type option
|
|
|
|
|
|
menu with the new GimpFileProcView widget.
|
|
|
|
|
|
(gimp_file_dialog_set_image): reset the file type to Automatic
|
|
|
|
|
|
(fixes bug #141535).
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/gui/file-open-dialog.[ch]
|
|
|
|
|
|
* app/gui/file-save-dialog.[ch]: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/bz2.c
|
|
|
|
|
|
* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
|
|
|
|
|
|
extension. It's redundant and breaks the code that sets the
|
|
|
|
|
|
extension from the selected file-type.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dicom.c: register a shorter menu label.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gbr.c
|
|
|
|
|
|
* plug-ins/common/gih.c
|
|
|
|
|
|
* plug-ins/common/pat.c
|
|
|
|
|
|
* plug-ins/common/url.c: register stock icons.
|
|
|
|
|
|
|
2004-07-16 12:41:21 -07:00
|
|
|
|
2004-07-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
2004-07-16 14:24:39 -07:00
|
|
|
|
* plug-ins/Lighting/lighting_main.[ch]
|
|
|
|
|
|
* plug-ins/Lighting/lighting_preview.[ch]
|
2004-07-16 12:41:21 -07:00
|
|
|
|
* plug-ins/Lighting/lighting_shade.c
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: Made this plug-in support
|
|
|
|
|
|
multiple light sources; implemented three, architecture now
|
|
|
|
|
|
supports any number. Changed material properties to more intuitve
|
|
|
|
|
|
names; added "metallic" property. Cleaned out some unused,
|
|
|
|
|
|
commented-out code.
|
|
|
|
|
|
|
2004-07-16 07:43:56 -07:00
|
|
|
|
2004-07-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of
|
|
|
|
|
|
"libgimpbase/gimpparasite.h" for getting the GimpParasite type.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/app.pl
|
|
|
|
|
|
* tools/pdbgen/pdb/drawable.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/edit.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/gradients.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/guides.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb: removed redundant #includes.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic.
|
2004-07-16 14:24:39 -07:00
|
|
|
|
Consistently fail if there is no currently queried plugin.
|
2004-07-16 07:43:56 -07:00
|
|
|
|
|
|
|
|
|
|
* app/pdb/*.c: regenerated.
|
|
|
|
|
|
|
2004-07-16 05:41:05 -07:00
|
|
|
|
2004-07-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-transform.c: made gtk-doc even
|
|
|
|
|
|
happier; clarified meaning of the "use_offsets" parameter.
|
|
|
|
|
|
|
2004-07-16 03:07:30 -07:00
|
|
|
|
2004-07-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdata.c:
|
|
|
|
|
|
* app/display/gimpcanvas.c:
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-transform.c: corrected API
|
|
|
|
|
|
documentation, removed trailing whitespace.
|
|
|
|
|
|
|
|
|
|
|
|
Please do always build the documentation if you add or change any
|
|
|
|
|
|
gtk-doc comments.
|
|
|
|
|
|
|
2004-07-15 16:02:52 -07:00
|
|
|
|
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpcanvas.c:
|
|
|
|
|
|
* app/display/gimpdisplayshell-transform.c: added gtk-doc
|
|
|
|
|
|
comments for all public functions that lack them.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c: added a couple of
|
|
|
|
|
|
gtk-doc comments.
|
|
|
|
|
|
|
2004-07-15 12:01:57 -07:00
|
|
|
|
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdata.c: added gtk-doc comments for
|
|
|
|
|
|
public functions.
|
|
|
|
|
|
|
2004-07-15 11:09:48 -07:00
|
|
|
|
2004-07-15 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: normalized the identifiers of
|
|
|
|
|
|
paper.c and paper.h. Made one variable local to the function
|
|
|
|
|
|
instead of module static.
|
|
|
|
|
|
|
2004-07-15 04:58:47 -07:00
|
|
|
|
2004-07-15 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: normalized the ppmtools.c and
|
|
|
|
|
|
ppmtool.h identifiers. Also fixed some (but not all) of the
|
|
|
|
|
|
syntax.
|
|
|
|
|
|
|
2004-07-15 04:10:09 -07:00
|
|
|
|
2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/winicon/icoload.c:
|
|
|
|
|
|
* plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber
|
2004-07-15 04:14:15 -07:00
|
|
|
|
that fixes byte-swapping on big endian hosts. Fixes bug #147610.
|
2004-07-15 04:10:09 -07:00
|
|
|
|
|
2004-07-15 03:39:59 -07:00
|
|
|
|
2004-07-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/helpbrowser/dialog.c
|
|
|
|
|
|
* plug-ins/helpbrowser/uri.c: don't warn if no help pages are
|
|
|
|
|
|
installed and the Home button is clicked.
|
|
|
|
|
|
|
2004-07-15 03:37:03 -07:00
|
|
|
|
2004-07-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/file/file-open.c (file_open_layer): don't crash if no
|
|
|
|
|
|
layer or only one layer is visible. Fixes bug #143804.
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c (app_run): fixed log domain registration.
|
|
|
|
|
|
|
2004-07-15 02:53:17 -07:00
|
|
|
|
2004-07-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpviewable.[ch]: corrected API docs and fixed
|
|
|
|
|
|
function parameter names to silent gtk-doc warnings.
|
|
|
|
|
|
|
2004-07-15 02:29:01 -07:00
|
|
|
|
2004-07-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c (app_run): register a log handler for the
|
|
|
|
|
|
"Gimp-Menus" domain.
|
|
|
|
|
|
|
2004-07-14 23:57:46 -07:00
|
|
|
|
2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mng.c: cleanup.
|
|
|
|
|
|
|
2004-07-14 16:41:41 -07:00
|
|
|
|
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpviewable.c: added gtk-doc comments for public
|
|
|
|
|
|
functions.
|
|
|
|
|
|
|
2004-07-14 16:14:49 -07:00
|
|
|
|
2004-07-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.h: reordered to match the .c file.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.c
|
|
|
|
|
|
* app/vectors/gimpvectors-import.c: fixed API docs.
|
|
|
|
|
|
|
2004-07-14 15:09:51 -07:00
|
|
|
|
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/png.c:
|
|
|
|
|
|
* plug-ins/common/mng.c: Fixed erroneously reported warning
|
|
|
|
|
|
message when saving indexed layers with an alpha channel but
|
|
|
|
|
|
no transparent pixels.
|
|
|
|
|
|
|
2004-07-14 14:27:11 -07:00
|
|
|
|
2004-07-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c (app_run): register a log handler for the
|
|
|
|
|
|
"Gimp-Actions" domain.
|
|
|
|
|
|
|
2004-07-14 13:47:41 -07:00
|
|
|
|
2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* devel-docs/objects.txt: . . . and removed because it is
|
|
|
|
|
|
redundant with devel-docs/app/app.hierarchy.
|
|
|
|
|
|
|
2004-07-14 11:43:13 -07:00
|
|
|
|
2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* devel-docs/objects.txt: added file containing a map of Gimp's
|
|
|
|
|
|
GObject hierarchy .
|
|
|
|
|
|
|
2004-07-14 09:37:13 -07:00
|
|
|
|
2004-07-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.[ch]: massively changed: removed
|
|
|
|
|
|
message_ids, the message mem chunk and all signals. Added new
|
|
|
|
|
|
function gimp_statusbar_replace() which updates a message without
|
|
|
|
|
|
moving it to the top of the stack. Fixes bug #120175.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-title.[ch]: renamed
|
|
|
|
|
|
gimp_display_shell_update_title() to
|
|
|
|
|
|
gimp_display_shell_title_update() and switched from pop()/push()
|
|
|
|
|
|
to replace() so the title message keeps its place in the stack.
|
|
|
|
|
|
Added new function gimp_display_shell_title_init() which push()es
|
|
|
|
|
|
the title message to the stack.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_new): call
|
|
|
|
|
|
gimp_display_shell_title_init() so the "title" message is at the
|
|
|
|
|
|
bottom of the stack.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-14 09:03:58 -07:00
|
|
|
|
2004-07-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-console.[ch]
|
|
|
|
|
|
* plug-ins/script-fu/script-fu.c
|
|
|
|
|
|
* plug-ins/script-fu/siod-wrapper.[ch]
|
|
|
|
|
|
* plug-ins/script-fu/siod/slib.c: applied a patch from Kevin
|
|
|
|
|
|
Cozens that removes an unneeded pipe which was causing problems
|
|
|
|
|
|
on long output from the SIOD interpreter (bug #139200). Also
|
|
|
|
|
|
shortened the welcome message.
|
|
|
|
|
|
|
2004-07-14 06:47:56 -07:00
|
|
|
|
2004-07-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pagecurl/pagecurl.c: GUI polishing.
|
|
|
|
|
|
|
2004-07-14 06:28:01 -07:00
|
|
|
|
2004-07-14 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: Added more underscores to identifiers.
|
2004-07-14 06:47:56 -07:00
|
|
|
|
Fixed some of the style issues (added whitespace before the '(' in
|
|
|
|
|
|
function calls).
|
2004-07-14 06:28:01 -07:00
|
|
|
|
|
2004-07-14 05:18:58 -07:00
|
|
|
|
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mng.c: Now writes a global palette chunk, and
|
|
|
|
|
|
empty palette chunks for the frames that use it. This saves a
|
|
|
|
|
|
bit of diskspace.
|
|
|
|
|
|
|
2004-07-14 05:12:50 -07:00
|
|
|
|
2004-07-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.c: added properties "gimp", "id", "width",
|
|
|
|
|
|
"height" and "base-type". Moved all code from gimp_image_new()
|
|
|
|
|
|
to GObject::constructor().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-convert.c
|
|
|
|
|
|
* app/core/gimpimage-crop.c
|
|
|
|
|
|
* app/core/gimpimage-resize.c
|
|
|
|
|
|
* app/core/gimpimage-rotate.c
|
|
|
|
|
|
* app/core/gimpimage-scale.c
|
|
|
|
|
|
* app/core/gimpimage-undo-push.c: set "width", "height" and
|
|
|
|
|
|
"base-type" with g_object_set() so "notify" is emitted on the
|
|
|
|
|
|
properties.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo.c (gimp_image_undo_pop_stack):
|
|
|
|
|
|
freeze/thaw property notifications around undoing/redoing so they
|
|
|
|
|
|
are not emitted in the middle of the undo operation.
|
|
|
|
|
|
|
2004-07-14 04:52:03 -07:00
|
|
|
|
2004-07-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.c: converted tabs to spaces, cleanup,
|
|
|
|
|
|
reviewed new API docs.
|
|
|
|
|
|
|
2004-07-14 03:57:13 -07:00
|
|
|
|
2004-07-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tiff.c: applied a patch done by Brion Vibber
|
|
|
|
|
|
and Philip Lafleur that fixes loading of CMYK TIFF images on
|
|
|
|
|
|
big-endian hardware (bug #147328).
|
|
|
|
|
|
|
2004-07-14 03:55:31 -07:00
|
|
|
|
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mng.c (respin_cmap): Properly check the return
|
|
|
|
|
|
value of find_unused_ia_color(). The plugin will now save indexed
|
|
|
|
|
|
MNGs correctly; fixes bug #139947. Also converted tabs to spaces.
|
|
|
|
|
|
|
2004-07-14 03:31:59 -07:00
|
|
|
|
2004-07-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Code review & cleanup:
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpguiconfig.[ch]: removed transparency-size,
|
|
|
|
|
|
transparency-type and snap-distance properties...
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpdisplayconfig.[ch]: ...and added them here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/tools/gimpmovetool.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
|
|
|
|
|
|
"max_memsize" parameter instead of looking it up in GimpGuiConfig.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimparea.c
|
|
|
|
|
|
* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
|
|
|
|
|
|
GimpProjectionIdleRender, reordered functions, cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplay.c: removed unused #includes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell-close.c: renamed
|
|
|
|
|
|
shell->warning_dialog to shell->close_dialog, some random
|
|
|
|
|
|
cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
|
|
|
|
|
|
|
2004-07-13 17:32:09 -07:00
|
|
|
|
2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.c: added documentation comments to some
|
|
|
|
|
|
of the functions.
|
|
|
|
|
|
|
2004-07-13 17:15:57 -07:00
|
|
|
|
2004-07-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/Makefile.am
|
|
|
|
|
|
* app/display/gimpdisplayshell-close.[ch]: new files for
|
|
|
|
|
|
gimp_display_shell_close() and its dialog & callback.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: removed from here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/view-actions.c (view_close_view_cmd_callback):
|
|
|
|
|
|
changed accordingly.
|
|
|
|
|
|
|
2004-07-13 16:05:11 -07:00
|
|
|
|
2004-07-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of
|
|
|
|
|
|
a plethora of booleans. Added some macros for readability. Allow
|
|
|
|
|
|
to use a reversed gradient for colorizing the curl.
|
|
|
|
|
|
|
2004-07-13 16:04:05 -07:00
|
|
|
|
2004-07-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/core-types.h
|
|
|
|
|
|
* app/core/gimppickable.[ch]: new interface which has
|
|
|
|
|
|
get_image_type(), get_tiles() and get_color_at() methods.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable.[ch]
|
|
|
|
|
|
* app/core/gimpimagemap.[ch]
|
|
|
|
|
|
* app/core/gimpprojection.[ch]: implement GimpPickableInterface
|
|
|
|
|
|
and removed public get_colot_at() functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-pick-color.[ch]: removed typedef
|
|
|
|
|
|
GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
|
|
|
|
|
|
gimp_pickable_pick_color() instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-contiguous-region.c
|
|
|
|
|
|
* app/core/gimpimage-crop.c
|
|
|
|
|
|
* app/gui/info-window.c
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint/gimpsmudge.c
|
|
|
|
|
|
* app/tools/gimpbycolorselecttool.c
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c: use GimpPickable functions
|
|
|
|
|
|
instead of the various get_color_at() functions. Simplifies code
|
|
|
|
|
|
which has a "sample_merged" boolean. Various cleanups.
|
|
|
|
|
|
|
2004-07-13 14:55:35 -07:00
|
|
|
|
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/presets.c: Added underscores between
|
|
|
|
|
|
words in function names according to the GIMP's (and common
|
|
|
|
|
|
sense) convention.
|
|
|
|
|
|
|
2004-07-13 13:58:02 -07:00
|
|
|
|
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: Moved the global declarations of
|
|
|
|
|
|
img_has_alpha and create_colorpage to more specialized headers.
|
|
|
|
|
|
|
2004-07-13 12:38:59 -07:00
|
|
|
|
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/: Added the paper.h header for the functions
|
|
|
|
|
|
defined in the paper.c module. (thus removing more declarations
|
|
|
|
|
|
from gimpressionist.h)
|
|
|
|
|
|
|
2004-07-13 11:47:53 -07:00
|
|
|
|
2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-dialog.c
|
|
|
|
|
|
* plug-ins/gfig/gfig-preview.[ch}
|
|
|
|
|
|
* plug-ins/gfig/gfig.h: Made Cancel work properly. Moved "show grid",
|
|
|
|
|
|
"snap to grid", and "show image" checkbuttons back onto main
|
|
|
|
|
|
interface. Eliminated GtkPreview and removed undef of
|
|
|
|
|
|
GTK_DISABLE_DEPRECATED from gfig-preview.c. Removed some
|
|
|
|
|
|
unused code.
|
|
|
|
|
|
|
2004-07-13 10:29:15 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gflare/gflare.c (preview_handle_idle): use
|
|
|
|
|
|
gtk_widget_queue_draw_area() instead of the deprecated
|
|
|
|
|
|
gtk_widget_draw() routine.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/orientmap.c
|
|
|
|
|
|
* plug-ins/gimpressionist/paper.c
|
|
|
|
|
|
* plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw()
|
|
|
|
|
|
instead of the deprecated gtk_widget_draw() routine.
|
|
|
|
|
|
|
2004-07-13 10:11:08 -07:00
|
|
|
|
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/preview.c
|
|
|
|
|
|
* plug-ins/gimpressionist/sizemap.c:
|
|
|
|
|
|
eliminated two compile-time warnings.
|
|
|
|
|
|
|
2004-07-13 09:36:29 -07:00
|
|
|
|
2004-07-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Added a GimpProjection object which maintains the idle projection
|
|
|
|
|
|
logic that was in GimpDisplay and takes care of constructing the
|
|
|
|
|
|
projection even without any display open. Makes color picking and
|
|
|
|
|
|
other reads from the projection work without display and fixes the
|
|
|
|
|
|
major bug that we were constructing the projection n times (!)
|
|
|
|
|
|
for n displays.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/gimpimage-projection.[ch]: removed.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h
|
|
|
|
|
|
* app/core/gimpmarshal.list
|
|
|
|
|
|
* app/core/gimparea.[ch]
|
|
|
|
|
|
* app/core/gimpprojection.[ch]
|
|
|
|
|
|
* app/core/gimpprojection-construct.[ch]: new files assembled from
|
|
|
|
|
|
the pieces of gimpdisplay.c and gimpimage-projection.c.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.[ch]: create a GimpProjection.
|
|
|
|
|
|
Removed explicit projection realloc calls because the projection
|
|
|
|
|
|
connects to the relevant GimpImage signals now.
|
|
|
|
|
|
Added gimp_image_coords_in_active_drawable().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/Makefile.am
|
|
|
|
|
|
* app/display/gimpdisplay-area.[ch]: removed.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.[ch]: stripped away the idle render stuff
|
|
|
|
|
|
and just keep a list of update_areas which is painted on flush().
|
|
|
|
|
|
Removed gimp_display_coords_in_active_drawable().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay-foreach.[ch]: removed
|
|
|
|
|
|
gimp_display_finish_draw().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.c
|
|
|
|
|
|
* app/core/gimpimage-contiguous-region.c
|
|
|
|
|
|
* app/core/gimpimage-convert.c
|
|
|
|
|
|
* app/core/gimpimage-crop.c
|
|
|
|
|
|
* app/core/gimpimage-merge.c
|
|
|
|
|
|
* app/core/gimpimage-pick-color.c
|
|
|
|
|
|
* app/core/gimpimage-scale.c
|
|
|
|
|
|
* app/core/gimppalette-import.c
|
|
|
|
|
|
* app/display/gimpdisplay-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-render.c
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/gui/info-window.c
|
|
|
|
|
|
* app/tools/gimpbucketfilltool.c
|
|
|
|
|
|
* app/tools/gimpbycolorselecttool.c
|
|
|
|
|
|
* app/tools/gimpclonetool.c
|
|
|
|
|
|
* app/tools/gimpcolortool.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
* app/tools/gimpfliptool.c
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c
|
|
|
|
|
|
* app/tools/gimppainttool.c
|
|
|
|
|
|
* app/tools/gimpselectiontool.c
|
|
|
|
|
|
* app/tools/gimptransformtool.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-13 08:59:52 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new().
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/Makefile.am
|
|
|
|
|
|
* plug-ins/Lighting/*.xpm: removed XPM files...
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in
|
|
|
|
|
|
* plug-ins/Lighting/images: ... and added them as PNG images here.
|
|
|
|
|
|
These should be redone with antialiased edges.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_stock.[ch]
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: register stock icons and use
|
|
|
|
|
|
those instead of GimpPixmaps.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/MapObject/Makefile.am
|
|
|
|
|
|
* plug-ins/MapObject/*.xpm: removed duplicated XPM files.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_stock.[ch]: register stock icons
|
|
|
|
|
|
reusing the generated header from the Lighting plug-in.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_ui.c: use them.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until
|
|
|
|
|
|
GimpPixmap has been replaced here as well.
|
2004-07-13 09:36:29 -07:00
|
|
|
|
|
2004-07-13 08:10:46 -07:00
|
|
|
|
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
2004-07-13 08:59:52 -07:00
|
|
|
|
* plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist
|
2004-07-13 08:10:46 -07:00
|
|
|
|
will delete global presets if the user running GIMP has priviliges to
|
2004-07-13 08:59:52 -07:00
|
|
|
|
do so). This was done by creating a function to check if a preset is
|
|
|
|
|
|
global, and by making sure the delete button is in-sensitive when
|
|
|
|
|
|
this is the case.
|
2004-07-13 08:10:46 -07:00
|
|
|
|
|
2004-07-13 07:55:16 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorbutton.c
|
|
|
|
|
|
* libgimpwidgets/gimpcolornotebook.c
|
|
|
|
|
|
* libgimpwidgets/gimpcolorscale.c
|
|
|
|
|
|
* libgimpwidgets/gimpcolorscales.c
|
|
|
|
|
|
* libgimpwidgets/gimpcolorselect.c
|
|
|
|
|
|
* libgimpwidgets/gimpcolorselection.c
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c
|
|
|
|
|
|
* libgimpwidgets/gimppickbutton.c
|
|
|
|
|
|
* libgimpwidgets/gimpunitmenu.c: some code review and cosmetics.
|
|
|
|
|
|
|
2004-07-13 06:27:47 -07:00
|
|
|
|
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's
|
|
|
|
|
|
identifiers (= variable names and function name)
|
|
|
|
|
|
|
2004-07-13 04:54:09 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL
|
|
|
|
|
|
string values.
|
|
|
|
|
|
|
2004-07-13 04:14:05 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: override the output_message error
|
|
|
|
|
|
handler in order to propagate warnings to the user interface
|
|
|
|
|
|
(related to bug #145212).
|
|
|
|
|
|
|
2004-07-13 03:09:22 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-utils.[ch]: added new function
|
|
|
|
|
|
gimp_g_value_get_memsize() that attempts to calculate the memory
|
|
|
|
|
|
requirements for a GValue.
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the
|
|
|
|
|
|
new function to obtain a better estimate for the size of the text
|
|
|
|
|
|
undo.
|
|
|
|
|
|
|
2004-07-13 01:59:10 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
|
|
|
|
|
|
a tiny memory leak.
|
|
|
|
|
|
|
2004-07-13 01:30:22 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo.c: resurrected some bit-rotting debug
|
|
|
|
|
|
code. Might become useful one day.
|
|
|
|
|
|
|
2004-07-12 16:51:38 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* autogen.sh: when automake 1.8 is being used, require at least
|
|
|
|
|
|
version 1.8.3. Earlier versions of the automake-1.8 series don't
|
|
|
|
|
|
handle gimp-console correctly.
|
|
|
|
|
|
|
2004-07-12 16:36:45 -07:00
|
|
|
|
2004-07-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-dump.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-title.c
|
|
|
|
|
|
(gimp_display_shell_format_title): applied patch from Dave Neary
|
|
|
|
|
|
which adds %B which expands to (modified) if the image is
|
|
|
|
|
|
dirty. Also added %A which expands to (clean) because we also have
|
|
|
|
|
|
a short indicator for the clean image. Fixes bug #130943.
|
|
|
|
|
|
|
2004-07-12 15:34:37 -07:00
|
|
|
|
2004-07-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: removed hack for gimp-console compilation.
|
|
|
|
|
|
automake seems to handle it correctly all by itself.
|
|
|
|
|
|
|
2004-07-12 14:32:29 -07:00
|
|
|
|
2004-07-12 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c: added
|
|
|
|
|
|
#ifdef G_OS_WIN32
|
|
|
|
|
|
#include <windows.h>
|
|
|
|
|
|
#endif
|
|
|
|
|
|
|
2004-07-12 13:25:05 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbufferview.[ch]: added a preview of the global
|
|
|
|
|
|
buffer.
|
|
|
|
|
|
|
2004-07-12 10:14:02 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: make sure that gimp-console is enabled for
|
|
|
|
|
|
'make dist'. Use it to dump the system gimprc and gimprc man-page.
|
|
|
|
|
|
|
2004-07-12 10:10:34 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextundo.[ch]: removed member "guint time"...
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpundo.[ch]: ...and added it here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptexttool.c (gimp_text_tool_apply): changed
|
|
|
|
|
|
accordingly. Reordered undo compression code to look like other
|
|
|
|
|
|
pieces of code which do undo compression.
|
|
|
|
|
|
|
2004-07-12 09:59:36 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpundo.[ch]
|
|
|
|
|
|
* app/core/gimpitemundo.[ch]
|
|
|
|
|
|
* app/text/gimptextundo.[ch]: removed all _new() functions and
|
|
|
|
|
|
added properties and GObject::constructor() implementations
|
|
|
|
|
|
instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
|
|
|
|
|
|
"GType undo_gtype" parameter and allow to pass name-value pairs as
|
2004-07-12 16:36:45 -07:00
|
|
|
|
"...". Use the new GParameter utility functions to construct the
|
2004-07-12 09:59:36 -07:00
|
|
|
|
appropriate undo step with g_object_newv().
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_image_undo_push_item): removed.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_image_undo_push_undo): removed. Merged its code back into
|
|
|
|
|
|
gimp_image_undo_push(), where it originally came from.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo-push.c
|
|
|
|
|
|
* app/core/gimpundostack.c
|
|
|
|
|
|
* app/paint/gimppaintcore-undo.c
|
|
|
|
|
|
* app/tools/gimptransformtool-undo.c
|
|
|
|
|
|
* app/widgets/gimpundoeditor.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-12 09:57:29 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-dialog.c
|
|
|
|
|
|
* plug-ins/gfig/gfig-preview.c
|
|
|
|
|
|
* plug-ins/gfig/gfig-style.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: some include cleanups. Use
|
|
|
|
|
|
libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely.
|
|
|
|
|
|
Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c.
|
|
|
|
|
|
|
2004-07-12 09:14:22 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/round-corners.scm: applied patch from
|
|
|
|
|
|
Dave Neary that changes the behavior from undo disable/enable to
|
|
|
|
|
|
using an undo group if the script doesn't work on a copy of the
|
|
|
|
|
|
image. Fixes bug #146344.
|
|
|
|
|
|
|
2004-07-12 09:09:01 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: applied patch from Brion Vibber
|
|
|
|
|
|
which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358.
|
|
|
|
|
|
|
2004-07-12 07:43:24 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-modules.c: don't do anything if gimp->no_interface
|
|
|
|
|
|
is TRUE.
|
|
|
|
|
|
|
2004-07-12 07:32:31 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Made the gimp-console binary compile.
|
|
|
|
|
|
Finishes core/GUI separation and fixes bug #71514:
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: removed the crazy-hacker warning for
|
|
|
|
|
|
--enable-gimp-console.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: for gimp-console, copy app_procs.c to
|
|
|
|
|
|
app_procs_console.c and compile it instead of app_procs.c with
|
|
|
|
|
|
-DGIMP_CONSOLE_COMPILATION
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION
|
|
|
|
|
|
to skip GUI stuff for the gimp-console case.
|
|
|
|
|
|
Renamed app_gui_libs_init() to app_libs_init(), renamed
|
|
|
|
|
|
app_gui_abort() to app_abort() and added app_exit() so everything
|
|
|
|
|
|
that needs #ifdefs lives here now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/main.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c (gui_abort): really abort (call exit()).
|
|
|
|
|
|
|
2004-07-12 07:09:33 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* INSTALL: made the suggestion to use binary packages more
|
|
|
|
|
|
prominent, mention --enable-gimp-console.
|
|
|
|
|
|
|
2004-07-12 06:22:28 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/sanity.[ch]: removed the gtk+ sanity check here ...
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c: ... and do it here from gui_libs_init().
|
|
|
|
|
|
|
|
|
|
|
|
* app/main.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-12 05:56:35 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run
|
|
|
|
|
|
our own main-loop like we already used to do when being run
|
|
|
|
|
|
non-interactively.
|
|
|
|
|
|
|
2004-07-12 04:47:54 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdialogfactory.c
|
|
|
|
|
|
(gimp_dialog_factories_set_busy_foreach)
|
|
|
|
|
|
(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
|
|
|
|
|
|
cursor on all windows which have widget->window, not only for
|
|
|
|
|
|
those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
|
|
|
|
|
|
dialogs are hidden while the busy cursor is active and later shown
|
|
|
|
|
|
again.
|
|
|
|
|
|
|
2004-07-12 04:43:00 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY
|
|
|
|
|
|
property. Some minor cleanup.
|
|
|
|
|
|
|
2004-07-12 04:41:19 -07:00
|
|
|
|
2004-07-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/gimp-gui.[ch]: new files defining a GimpGui vtable
|
|
|
|
|
|
struct and contianing all the vtable wrapper functions. Reordered
|
|
|
|
|
|
and renamed some functions for consistency.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.[ch]: removed all the vtable code.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-12 04:12:19 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay-foreach.c
|
2004-07-12 04:28:16 -07:00
|
|
|
|
(gimp_displays_get_dirty_images): remove images from the
|
2004-07-12 04:12:19 -07:00
|
|
|
|
container when they become clean. Should move to the Gimp object.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/quit-dialog.c: some cosmetic changes.
|
|
|
|
|
|
|
2004-07-12 00:41:23 -07:00
|
|
|
|
2004-07-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tiff.c: applied a patch from Brion Vibber that
|
|
|
|
|
|
sets the 'Save color values from transparent pixels' insensitive
|
|
|
|
|
|
when there's no alpha channel.
|
|
|
|
|
|
|
2004-07-11 14:53:17 -07:00
|
|
|
|
2004-07-11 Hans Breuer <hans@breuer.org>
|
|
|
|
|
|
|
|
|
|
|
|
* **/makefile.msc : updated
|
|
|
|
|
|
app/actions/makefile.msc app/menus/makefile.msc : (new files)
|
|
|
|
|
|
app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
|
|
|
|
|
|
app/widgets/gimppropwidgets.c : bumped compiler version check,
|
|
|
|
|
|
msvc6 still can't cast from unsigned __int64 to double
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/debug-actions.c : only use debug_*_callback
|
|
|
|
|
|
and thus debug_action if ENABLE_DEBUG_MENU
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpalette-import.c : added gimpwin32-io.h
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/screenshot.c : make it compile with msvc,
|
|
|
|
|
|
but still no win32 specific implementation ...
|
|
|
|
|
|
|
2004-07-11 12:39:05 -07:00
|
|
|
|
2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-dobject.h: fix commit error that
|
|
|
|
|
|
broke build.
|
|
|
|
|
|
|
2004-07-11 11:39:30 -07:00
|
|
|
|
2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-dialog.c
|
|
|
|
|
|
* plug-ins/gfig/gfig-dobject.[ch]
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: added buttons to select an object, and
|
|
|
|
|
|
raise or lower the selected object; also a few minor cleanups.
|
|
|
|
|
|
|
2004-07-10 20:01:05 -07:00
|
|
|
|
2004-07-11 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
2004-07-12 04:28:16 -07:00
|
|
|
|
* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a
|
2004-07-12 08:30:45 -07:00
|
|
|
|
patch from Robert Ögren, moved here from toolbox_check_device().
|
|
|
|
|
|
Only change devices if the event came from a widget that accepts
|
|
|
|
|
|
extension events. Fixes bug #115774.
|
2004-07-10 20:01:05 -07:00
|
|
|
|
|
2004-07-10 15:25:02 -07:00
|
|
|
|
2004-07-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-utils.[ch] (gimp_parameters_append)
|
|
|
|
|
|
(gimp_parameters_append_valist)
|
|
|
|
|
|
(gimp_parameters_free): new utility functions which create and
|
|
|
|
|
|
destroy GParameter arrays for g_object_newv().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c (gui_pdb_dialog_new): use them.
|
|
|
|
|
|
|
2004-07-10 13:29:11 -07:00
|
|
|
|
2004-07-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Removed any remaining GUI dependency from the PDB wrappers:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.[ch]: added vtable entries for the display and
|
|
|
|
|
|
help stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp.[ch]: renamed gimp_help() to
|
|
|
|
|
|
gimp_help_show().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c: implement the new display and help vtable
|
|
|
|
|
|
entries.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb.pl
|
|
|
|
|
|
* tools/pdbgen/pdb/display.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
|
|
|
|
|
|
object instead of using stuff from display/ and widgets/.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/app.pl: removed bad hacks which enabled including
|
|
|
|
|
|
stuff from gui/, display/ and widgets/.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: link widgets-enums.o, display-enums.o and
|
|
|
|
|
|
gimpdisplayoptions.o into the gimp-console binary because they are
|
|
|
|
|
|
needed for the config system and don't depend on any GUI stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/display_cmds.c
|
|
|
|
|
|
* app/pdb/help_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-07-10 03:08:19 -07:00
|
|
|
|
2004-07-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap.
|
|
|
|
|
|
|
2004-07-09 15:28:27 -07:00
|
|
|
|
2004-07-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay-foreach.[ch]: added new function
|
|
|
|
|
|
gimp_displays_get_dirty_images().
|
|
|
|
|
|
|
2004-07-10 03:08:19 -07:00
|
|
|
|
* app/gui/quit-dialog.c: show a container treeview of all dirty
|
2004-07-09 15:28:27 -07:00
|
|
|
|
images in the quit dialog. Still work in progress...
|
|
|
|
|
|
|
2004-07-09 15:09:40 -07:00
|
|
|
|
2004-07-09 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
2004-07-09 15:28:27 -07:00
|
|
|
|
|
2004-07-09 15:09:40 -07:00
|
|
|
|
* gimp/plug-ins/gfig/gfig-circle.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-dialog.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-dobject.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-ellipse.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-poly.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-preview.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-star.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-style.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig-style.h
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig.c
|
|
|
|
|
|
* gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for
|
|
|
|
|
|
fillable objects; other miscellaneous cleanups and minor fixes.
|
|
|
|
|
|
|
2004-07-09 13:38:35 -07:00
|
|
|
|
2004-07-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c: removed the quit dialog code here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/quit-dialog.[ch]: added new files that hold the old code
|
|
|
|
|
|
for now.
|
|
|
|
|
|
|
2004-07-09 12:26:34 -07:00
|
|
|
|
2004-07-09 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/procedural_db.c: #include <glib-object.h> instead of
|
|
|
|
|
|
<gtk/gtk.h>.
|
|
|
|
|
|
|
2004-07-09 12:14:59 -07:00
|
|
|
|
2004-07-09 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/brush-select.[ch]
|
|
|
|
|
|
* app/gui/font-select.[ch]
|
|
|
|
|
|
* app/gui/gradient-select.[ch]
|
|
|
|
|
|
* app/gui/palette-select.[ch]
|
|
|
|
|
|
* app/gui/pattern-select.[ch]: removed...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimppdbdialog.[ch]
|
|
|
|
|
|
* app/widgets/gimpdataselect.[ch]
|
|
|
|
|
|
* app/widgets/gimpbrushselect.[ch]
|
|
|
|
|
|
* app/widgets/gimpgradientselect.[ch]
|
|
|
|
|
|
* app/widgets/gimppaletteselect.[ch]
|
|
|
|
|
|
* app/widgets/gimppatternselect.[ch]
|
|
|
|
|
|
* app/widgets/gimpfontselect.[ch]: ...and added here as a
|
|
|
|
|
|
hierarchy of widgets.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.h: removed typdef
|
|
|
|
|
|
GimpDataEditFunc, it's in widgets-types.h now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/convert-dialog.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.[ch]: added vtable entries for creating, closing
|
|
|
|
|
|
and setting PDB dialogs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c: implement the vtable entries using the new
|
|
|
|
|
|
widgets.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/brush_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/font_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/palette_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
|
|
|
|
|
|
the Gimp object to create / manage the selection dialogs. The
|
|
|
|
|
|
generated files don't depend on GUI stuff any longer.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/brush_select_cmds.c
|
|
|
|
|
|
* app/pdb/font_select_cmds.c
|
|
|
|
|
|
* app/pdb/gradient_select_cmds.c
|
|
|
|
|
|
* app/pdb/palette_select_cmds.c
|
|
|
|
|
|
* app/pdb/pattern_select_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-07-09 11:43:27 -07:00
|
|
|
|
2004-07-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-save-dialog.c (file_save_overwrite): improved text
|
|
|
|
|
|
of the dialog.
|
|
|
|
|
|
|
2004-07-08 15:56:29 -07:00
|
|
|
|
2004-07-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document
|
|
|
|
|
|
that "help-func" and "help-id" properties have been added for 2.2.
|
|
|
|
|
|
|
2004-07-08 15:45:36 -07:00
|
|
|
|
2004-07-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c
|
|
|
|
|
|
(gimp_histogram_editor_menu_update): reverted my last change.
|
|
|
|
|
|
(gimp_histogram_editor_item_visible): fix the problem here instead.
|
|
|
|
|
|
|
2004-07-08 14:57:05 -07:00
|
|
|
|
2004-07-08 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpdialog.c: removed "role" property because
|
|
|
|
|
|
GtkWindow has an equivalent property now. Added "help-func" and
|
|
|
|
|
|
"help-id" construct properties.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptexteditor.c
|
|
|
|
|
|
* app/widgets/gimptooldialog.c
|
|
|
|
|
|
* app/widgets/gimpviewabledialog.c: removed calls to
|
|
|
|
|
|
gimp_help_connect() and pass help_func and help_id to
|
|
|
|
|
|
g_object_new().
|
|
|
|
|
|
|
2004-07-08 14:41:39 -07:00
|
|
|
|
2004-07-08 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in
|
|
|
|
|
|
API docs.
|
|
|
|
|
|
|
2004-07-08 10:47:17 -07:00
|
|
|
|
2004-07-08 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/Presets: converted the newlines in the
|
|
|
|
|
|
descriptions to whitespaces, so they'll simply wrap (in accordance
|
|
|
|
|
|
with making the description label wrappable).
|
|
|
|
|
|
|
2004-07-08 09:16:18 -07:00
|
|
|
|
2004-07-08 Shlomi Fish <shlomif@iglu.org.il>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most
|
|
|
|
|
|
remaining non-static global variables static, and created functions
|
|
|
|
|
|
that manipulate them. Created new headers. Renamed some variables and
|
|
|
|
|
|
functions to make their names more menanigful.
|
|
|
|
|
|
|
2004-07-08 06:23:27 -07:00
|
|
|
|
2004-07-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c
|
|
|
|
|
|
(gimp_histogram_editor_menu_update): set the active item of the
|
|
|
|
|
|
combo-box after changing the visibility filter.
|
|
|
|
|
|
|
2004-07-08 06:17:06 -07:00
|
|
|
|
2004-07-08 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
|
|
|
|
|
|
same fix as below.
|
|
|
|
|
|
|
2004-07-08 05:50:15 -07:00
|
|
|
|
2004-07-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
|
|
|
|
|
|
block gimp_prop_enum_combo_box_callback() before changing the
|
|
|
|
|
|
combo-box.
|
|
|
|
|
|
|
2004-07-08 05:04:15 -07:00
|
|
|
|
2004-07-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.c: only write aux-info for properties
|
|
|
|
|
|
that have been changed from their default values.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c: some code cleanup.
|
|
|
|
|
|
|
2004-07-08 04:27:48 -07:00
|
|
|
|
2004-07-08 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
|
|
|
|
|
|
parameter to gimp_selection_data_set_pixbuf() which selects the
|
|
|
|
|
|
format in which to encode the pixbuf (was defaulting to "png"
|
|
|
|
|
|
before).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpclipboard.c: when copying, offer all formats which
|
|
|
|
|
|
are savable with GdkPixbuf. Added a GimpClipboard struct which is
|
|
|
|
|
|
attached to the Gimp and which stores all the persistent data
|
|
|
|
|
|
needed by the clipboard. Renamed some private functions.
|
|
|
|
|
|
|
|
|
|
|
|
(unfortunately this change breaks pasting to AbiWord:
|
|
|
|
|
|
http://bugzilla.abisource.com/show_bug.cgi?id=7068)
|
|
|
|
|
|
|
2004-07-07 17:09:41 -07:00
|
|
|
|
2004-07-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
* app/config/gimpconfig-deserialize.c
|
|
|
|
|
|
* app/config/gimpconfig-serialize.c: removed redundant casts.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
|
|
|
|
|
|
get and set aux-info based on object properties.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c: use the new functions to save
|
|
|
|
|
|
a histogram's channel and scale in the sessionrc.
|
|
|
|
|
|
|
2004-07-07 11:09:14 -07:00
|
|
|
|
2004-07-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
|
|
|
|
|
|
that PNG is the preferred format and GIF and JPEG come last.
|
|
|
|
|
|
|
2004-07-07 10:52:16 -07:00
|
|
|
|
2004-07-07 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/*.[ch]: Use single centralized functions to
|
|
|
|
|
|
create, load, and save objects, instead of separate functions
|
|
|
|
|
|
for each type of object. A few other miscellaneous fixes.
|
|
|
|
|
|
|
2004-07-07 09:02:23 -07:00
|
|
|
|
2004-07-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
|
|
|
|
|
|
GdkPixbuf supported format (makes pasting from OpenOffice
|
|
|
|
|
|
work). Cleaned up a bit to perpare pasting of SVG data.
|
|
|
|
|
|
|
2004-07-07 08:07:17 -07:00
|
|
|
|
2004-07-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha
|
|
|
|
|
|
channel if the src tile-manager doesn't have one. Warn on
|
|
|
|
|
|
unsupported type conversions instead of silently doing the wrong
|
|
|
|
|
|
thing. Fixes bug #145482.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbuffer.c: cosmetics.
|
|
|
|
|
|
|
2004-07-07 07:38:23 -07:00
|
|
|
|
2004-07-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/clipboard.[ch]: removed...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpclipboard.[ch]: ...and added here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-commands.c
|
|
|
|
|
|
* app/gui/gui.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-07 06:58:51 -07:00
|
|
|
|
2004-07-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Made the undo system robust against the currently pushed undo
|
|
|
|
|
|
being too large according to prefs settings. Fixes bug #145379.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo)
|
|
|
|
|
|
(gimp_image_undo_group_end): emit "undo-event" *before* calling
|
|
|
|
|
|
gimp_image_undo_free_space() so the undo history doesn't try to
|
|
|
|
|
|
remove an item that has never been added.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_image_undo_push_undo): added boolean return value indicating
|
|
|
|
|
|
if the undo could be pushed (FALSE means the undo was to large
|
|
|
|
|
|
and was discarded right away).
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_image_undo_push_item): return NULL if the above returned
|
|
|
|
|
|
FALSE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
|
|
|
|
|
|
changed accordingly.
|
|
|
|
|
|
|
2004-07-07 05:33:58 -07:00
|
|
|
|
2004-07-07 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings
|
|
|
|
|
|
happened, cause that likely means corruption and libexif doesn't
|
|
|
|
|
|
handle that very happily. Addresses bug #145212. Perhaps the error and
|
|
|
|
|
|
warning messages should be propagated to the user in the GUI somehow,
|
|
|
|
|
|
currently they are not.
|
|
|
|
|
|
|
2004-07-07 02:43:35 -07:00
|
|
|
|
2004-07-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c (edit_actions): added "..." to "Clear
|
|
|
|
|
|
undo history" because it has a confirmation dialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-commands.c: cleanup: moved static functions to
|
|
|
|
|
|
the end of the file and prototyped them.
|
|
|
|
|
|
|
2004-07-06 18:59:33 -07:00
|
|
|
|
2004-07-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
|
|
|
|
|
|
fixed a drawing bug I introduced earlier today.
|
|
|
|
|
|
|
2004-07-06 18:15:41 -07:00
|
|
|
|
2004-07-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/view-actions.c
|
|
|
|
|
|
* app/actions/view-commands.[ch]: added actions and callbacks for
|
|
|
|
|
|
scrolling the view. Not used in menus but useful for controllers.
|
|
|
|
|
|
|
2004-07-06 15:58:33 -07:00
|
|
|
|
2004-07-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
(gimp_edit_selection_tool_key_press): adapt the arrow key velocity
|
|
|
|
|
|
to the display scale factor. Please test and complain if you
|
|
|
|
|
|
dislike this behaviour.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/images/Makefile.am
|
|
|
|
|
|
* themes/Default/images/stock-color-pick-from-screen-16.png: new
|
|
|
|
|
|
icon drawn by Jimmac.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpstock.[ch]: register the new icon.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppickbutton.c: use it for the screen color
|
|
|
|
|
|
picker instead of reusing the color picker tool icon.
|
|
|
|
|
|
|
2004-07-06 12:32:55 -07:00
|
|
|
|
2004-07-06 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/*.[ch]: a bunch of code clean-up and
|
|
|
|
|
|
debugging. Created "classes" for the objects, and
|
|
|
|
|
|
attached functions to classes rather than objects.
|
|
|
|
|
|
|
2004-07-06 09:33:30 -07:00
|
|
|
|
2004-07-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
|
|
|
|
|
|
bug #145401.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
|
|
|
|
|
|
it to the PDB.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/gimphistogram.c: implemented histogram functions for
|
|
|
|
|
|
the RGB mode.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/levels.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c
|
|
|
|
|
|
* app/widgets/gimpcolorbar.c
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c: handle the new enum value.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
|
|
|
|
|
|
draw a histogram that shows the RGB channels simultaneously
|
|
|
|
|
|
|
2004-07-06 09:05:32 -07:00
|
|
|
|
2004-07-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmodule/gimpmodule.c: comply with C99 aliasing rules.
|
|
|
|
|
|
|
2004-07-06 08:05:47 -07:00
|
|
|
|
2004-07-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
|
|
|
|
|
|
(gimp_button_menu_position): call gtk_menu_set_monitor() only
|
|
|
|
|
|
for GTK+ < 2.4.4 and added a #warning about it.
|
|
|
|
|
|
|
2004-07-06 07:17:17 -07:00
|
|
|
|
2004-07-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist: applied patch from Shlomi Fish that
|
|
|
|
|
|
fixes confusion of filenames and user-visible object names (bug
|
|
|
|
|
|
#132621). Also removed function remove_trailing_whitespace() that
|
|
|
|
|
|
used to duplicate functionality from GLib and updated
|
|
|
|
|
|
preset_create_filename().
|
|
|
|
|
|
|
2004-07-06 06:18:42 -07:00
|
|
|
|
2004-07-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreviewrenderer.c
|
|
|
|
|
|
(gimp_preview_renderer_set_viewable): queue an idle update when
|
|
|
|
|
|
setting the viewable to NULL so the view gets cleared correctly.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_preview_renderer_idle_update): call
|
|
|
|
|
|
gimp_preview_renderer_update() even if renderer->viewable is NULL
|
|
|
|
|
|
so clearing the viewable gets propagated to the GUI.
|
|
|
|
|
|
|
|
|
|
|
|
Moved clearing the viewable and removing the idle from
|
|
|
|
|
|
GObject::finalize() to GObject::dispose() because calling
|
|
|
|
|
|
set_viewable() with a NULL viewable triggers typechecking casts
|
|
|
|
|
|
and queuing idle functions, which is not nice in finalize().
|
|
|
|
|
|
|
2004-07-06 05:54:45 -07:00
|
|
|
|
2004-07-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back
|
|
|
|
|
|
$(LCMS_LIBS) that I had accidentally removed.
|
|
|
|
|
|
|
2004-07-06 03:54:46 -07:00
|
|
|
|
2004-07-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
|
|
|
|
|
|
return the proper type.
|
|
|
|
|
|
|
2004-07-05 15:50:38 -07:00
|
|
|
|
2004-07-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c: connect to
|
|
|
|
|
|
"editing-canceled" of the name cell renderer and restore the
|
|
|
|
|
|
original text in the callback. Doesn't work reliably until GTK+
|
|
|
|
|
|
bug #145463 is fixed.
|
|
|
|
|
|
|
2004-07-05 15:28:09 -07:00
|
|
|
|
2004-07-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a
|
|
|
|
|
|
compiler warning.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dog.c: removed some redundant casts and other
|
|
|
|
|
|
trivial cleanups.
|
|
|
|
|
|
|
2004-07-05 15:12:54 -07:00
|
|
|
|
2004-07-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.h: removed #define
|
|
|
|
|
|
GIMP_CONTROLLER_PARAM_SERIALIZE.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmodule/gimpmoduletypes.h: added
|
|
|
|
|
|
GIMP_MODULE_PARAM_SERIALIZE instead.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c
|
|
|
|
|
|
* modules/controller_midi.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/cdisplay_colorblind.c
|
|
|
|
|
|
* modules/cdisplay_gamma.c
|
|
|
|
|
|
* modules/cdisplay_highcontrast.c
|
|
|
|
|
|
* modules/cdisplay_proof.c: made the new properties serializable.
|
|
|
|
|
|
|
2004-07-05 14:39:54 -07:00
|
|
|
|
2004-07-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/Makefile.am (enum_headers): don't scan
|
|
|
|
|
|
app/paint-funcs/paint-funcs-types.h for enums.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h: reordered opaque typedefs to somehow
|
|
|
|
|
|
match the categories in the comments.
|
|
|
|
|
|
|
2004-07-05 13:55:05 -07:00
|
|
|
|
2004-07-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h: removed enum SizeType.
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/text-enums.h: added it as enum GimpSizeType and added
|
|
|
|
|
|
comment that it's for backward compatibility only.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/Makefile.am
|
|
|
|
|
|
* tools/pdbgen/pdb/text_tool.pdb: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpenums.h
|
|
|
|
|
|
* plug-ins/pygimp/gimpenums.py
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-constants.c
|
|
|
|
|
|
* tools/pdbgen/enums.pl: regenerated (pdbgen insisted on
|
|
|
|
|
|
reordering the enums).
|
|
|
|
|
|
|
2004-07-05 11:48:43 -07:00
|
|
|
|
2004-07-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-types.h: #define MIN and MAX values for
|
|
|
|
|
|
GimpCoords.pressure, .tilt and .wheel.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
(gimp_display_shell_get_event_coords)
|
|
|
|
|
|
(gimp_display_shell_get_device_coords): use the #defines instead
|
|
|
|
|
|
of hardcoded magic values when CLAMP()ing event or device values.
|
|
|
|
|
|
|
2004-07-05 11:36:24 -07:00
|
|
|
|
2004-07-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/Makefile.am: link all modules with libgimpmodule.
|
|
|
|
|
|
|
2004-07-05 11:18:32 -07:00
|
|
|
|
2004-07-05 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dog.c: improved defaults. use gimp_invert()
|
|
|
|
|
|
instead of rolling own. Use nasty hack to get previews to
|
|
|
|
|
|
work with grayscale images. Accept grayscale images.
|
|
|
|
|
|
|
2004-07-05 11:10:05 -07:00
|
|
|
|
2004-07-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the
|
|
|
|
|
|
basename parameter and use the object name instead. Convert it to
|
|
|
|
|
|
the filesystem encoding.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatafactory.c: changed accordingly.
|
|
|
|
|
|
|
2004-07-05 09:50:46 -07:00
|
|
|
|
2004-07-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist: applied patch from Shlomi Fish that
|
|
|
|
|
|
fixes a number of bugs in the gimpressionst plug-in (bug #145309).
|
|
|
|
|
|
|
|
|
|
|
|
Also added some const qualifiers, cleaned up includes and removed
|
|
|
|
|
|
degtorad() and radtodeg() functions that used to duplicate
|
|
|
|
|
|
functionality from libgimpmath.
|
|
|
|
|
|
|
2004-07-05 07:57:22 -07:00
|
|
|
|
2004-07-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
(gimp_template_view_tree_name_edited): removed unused local variables.
|
|
|
|
|
|
|
2004-07-05 06:28:34 -07:00
|
|
|
|
2004-07-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an
|
|
|
|
|
|
object. Removed trailing whitespace.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration.
|
|
|
|
|
|
|
2004-07-05 05:54:58 -07:00
|
|
|
|
2004-07-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
|
|
|
|
|
|
return TRUE if initialization was successful. Makes the
|
|
|
|
|
|
tool->drawable pointer being set correctly by the calling code and
|
|
|
|
|
|
fixes bugs where colorize was leaving the drawable in a modified
|
|
|
|
|
|
but non-undoable state when cancelling or changing images.
|
|
|
|
|
|
|
2004-07-05 04:26:30 -07:00
|
|
|
|
2004-07-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/cdisplay_proof.c: use object properties for the
|
|
|
|
|
|
configurable values.
|
|
|
|
|
|
|
2004-07-05 04:18:34 -07:00
|
|
|
|
2004-07-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.[ch]: added signal "color-changed" and emit
|
|
|
|
|
|
it in gimp_channel_set_color() and gimp_channel_set_opacity().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-qmask.[ch]: added new functions
|
|
|
|
|
|
gimp_image_set,get_qmask_color().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.[ch]: install a "color-changed" handler on
|
|
|
|
|
|
gimage->channels and update gimage->qmask_color when the qmask's
|
|
|
|
|
|
color changes. Fixes bug #145361.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/qmask-commands.c: use the new qmask color API.
|
|
|
|
|
|
|
2004-07-04 14:27:09 -07:00
|
|
|
|
2004-07-04 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dialogs-commands.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/tools/gimppainttool.c
|
|
|
|
|
|
* app/widgets/gimpdeviceinfo.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_selection.c
|
|
|
|
|
|
* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
|
|
|
|
|
|
CVS compile with gcc 2.95 again. Mostly double semicolons and
|
|
|
|
|
|
variable declarations after other stuff. Spotted by Martin
|
|
|
|
|
|
Renold.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradients_cmds.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
(there is one issue left, see his patch at
|
|
|
|
|
|
http://old.homeip.net/martin/gcc-2.95.diff, I did not
|
|
|
|
|
|
copy the #define va_copy __va_copy, since I don't know
|
|
|
|
|
|
what happens here.)
|
|
|
|
|
|
|
2004-07-04 13:50:25 -07:00
|
|
|
|
2004-07-04 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-dialog.[ch]:
|
|
|
|
|
|
* plug-ins/gfig/gfig-style.[ch]:
|
|
|
|
|
|
* plug-ins/gfig/notes.txt: New files.
|
|
|
|
|
|
* plug-ins/gfig/*.[ch]: Complete reworking of the gfig plug-in.
|
|
|
|
|
|
See 'notes.txt' for a summary of what has changed, and how to use
|
|
|
|
|
|
it now. Plenty of bugs have been introduced, which will take a
|
|
|
|
|
|
while to straighten out.
|
|
|
|
|
|
|
2004-07-04 11:12:22 -07:00
|
|
|
|
2004-07-04 Tor Lillqvist <tml@iki.fi>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop
|
|
|
|
|
|
a couple of unused variables.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmodule/gimpmodule.def: Add gimp_module_register_enum.
|
|
|
|
|
|
|
2004-07-04 09:29:28 -07:00
|
|
|
|
2004-07-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(),
|
|
|
|
|
|
a function to register an enum type for a GTypeModule.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/cdisplay_colorblind.c: use an object property for the
|
|
|
|
|
|
color deficiency enum.
|
|
|
|
|
|
|
2004-07-04 06:40:24 -07:00
|
|
|
|
2004-07-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c: don't attempt to store a
|
|
|
|
|
|
pointer to the last used filename in the plug-in parameter
|
|
|
|
|
|
struct. Fixes bug #145380.
|
|
|
|
|
|
|
2004-07-03 17:21:03 -07:00
|
|
|
|
2004-07-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/cdisplay_gamma.c
|
|
|
|
|
|
* modules/cdisplay_highcontrast.c: added object properties for
|
|
|
|
|
|
configurable values.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolordisplayeditor.c
|
|
|
|
|
|
* libgimpwidgets/gimpcolordisplaystack.c
|
|
|
|
|
|
* modules/cdisplay_colorblind.c
|
|
|
|
|
|
* modules/cdisplay_proof.c: cosmetic changes.
|
|
|
|
|
|
|
2004-07-03 13:27:28 -07:00
|
|
|
|
2004-07-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpcontext.[ch]: added context->serialize_props mask
|
|
|
|
|
|
which enables specifying exactly which properties will be
|
|
|
|
|
|
serialized. Also fixes a bug that prevented undefined properties
|
|
|
|
|
|
from being serialized, breaking tool_options and device status
|
|
|
|
|
|
serialization.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
|
|
|
|
|
|
properties in the tool_info->context_props mask serializable, also
|
|
|
|
|
|
configure/initialize tool_info->tool_options.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp-tools.c (gimp_tools_register): removed
|
|
|
|
|
|
tool_options initialization that is now done in
|
|
|
|
|
|
gimp_tool_info_new().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdeviceinfo.c: make only the properties in
|
|
|
|
|
|
GIMP_DEVICE_INFO_CONTEXT_MASK serializable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdevicestatus.c: add the device table to its
|
|
|
|
|
|
parent container again. Fixes "missing" devices.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptooloptions.c
|
|
|
|
|
|
* app/widgets/gimpdevices.c: cleanup / code review.
|
|
|
|
|
|
|
2004-07-03 06:07:30 -07:00
|
|
|
|
2004-07-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
|
|
|
|
|
|
the color tool is enabled, skip cursor hiding entirely.
|
|
|
|
|
|
|
2004-07-03 03:16:48 -07:00
|
|
|
|
2004-07-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't
|
|
|
|
|
|
any longer needed.
|
|
|
|
|
|
|
2004-07-02 14:56:30 -07:00
|
|
|
|
2004-07-02 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformoptions.[ch]:
|
|
|
|
|
|
* app/tools/gimptransformtool.c:
|
|
|
|
|
|
* app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
|
|
|
|
|
|
a combobox with options "Outline", "Grid", "Image", and
|
2004-07-02 18:05:54 -07:00
|
|
|
|
"Image + Grid". Addresses bug #108172.
|
2004-07-02 14:56:30 -07:00
|
|
|
|
|
2004-07-02 07:40:48 -07:00
|
|
|
|
2004-07-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c: don't let the Paste menu items
|
|
|
|
|
|
sensitivity depend on the availability of clipboard data because
|
|
|
|
|
|
we aren't notified when the GDK clipboard changes.
|
|
|
|
|
|
|
2004-07-02 07:08:15 -07:00
|
|
|
|
2004-07-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/clipboard.[ch]: new files implementing a clipboard for
|
|
|
|
|
|
image data based on GDK_SELECTION_CLIPBOARD (bug #133247).
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c
|
|
|
|
|
|
* app/actions/edit-commands.c: use the new clipboard API.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c: initialize and shutdown the clipboard.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbuffer.c: cosmetics.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c
|
|
|
|
|
|
* app/menus/menus.c: added sanity checks to exit functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.[ch]: let
|
|
|
|
|
|
gimp_display_shell_drop_svg() take a guchar * buffer.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
|
|
|
|
|
|
fixed the implementation.
|
|
|
|
|
|
|
2004-07-02 06:31:25 -07:00
|
|
|
|
2004-07-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/Makefile.am
|
|
|
|
|
|
* plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish
|
|
|
|
|
|
that massively cleans up gimppressionist (touching all files and
|
|
|
|
|
|
addding some new ones) and adds a simple PDB interface for
|
|
|
|
|
|
selecting one of the previously created presets.
|
|
|
|
|
|
Fixes bugs #145191, #144913 and #144922.
|
|
|
|
|
|
|
2004-07-01 15:01:29 -07:00
|
|
|
|
2004-07-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: bumped version number to 2.1.2.
|
|
|
|
|
|
|
2004-07-01 13:22:43 -07:00
|
|
|
|
2004-07-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/align_layers.c: there seems to be no reason why
|
|
|
|
|
|
this plug-in should not work on INDEXED* images, added it to the
|
|
|
|
|
|
registered image types
|
|
|
|
|
|
|
2004-07-01 13:09:08 -07:00
|
|
|
|
2004-07-01 Roman Joost <roman@bromeco.de>
|
|
|
|
|
|
|
2004-07-01 14:37:17 -07:00
|
|
|
|
* plug-ins/script-fu/scripts/blend-anim.scm
|
|
|
|
|
|
* plug-ins/script-fu/scripts/glossy.scm
|
|
|
|
|
|
* plug-ins/script-fu/scripts/test-sphere.scm: fixed typos
|
2004-07-02 14:56:30 -07:00
|
|
|
|
|
2004-07-01 08:46:25 -07:00
|
|
|
|
2004-07-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
|
|
|
|
|
|
gimp_selection_data_[get|set]_pixbuf().
|
|
|
|
|
|
|
2004-07-01 03:42:00 -07:00
|
|
|
|
2004-07-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
|
|
|
|
|
|
and set the FG/BG depending on where the color was dropped. Also
|
|
|
|
|
|
set the drag status accordingly so the cursor indicates whether
|
|
|
|
|
|
dropping will have an effect or not. Fixes bug #145219.
|
|
|
|
|
|
|
2004-06-30 18:39:56 -07:00
|
|
|
|
2004-07-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptemplate.c: do like Liam taught us and use the
|
|
|
|
|
|
golden ratio as default for new images.
|
|
|
|
|
|
|
2004-06-30 17:12:29 -07:00
|
|
|
|
2004-06-30 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
|
|
|
|
|
|
Chain up if the color tool is enabled. This fixes the problem of
|
|
|
|
|
|
the color picker cursor not appearing when using a paint tool
|
|
|
|
|
|
in color picking mode while "Show Paint Tool Cursor" is off.
|
|
|
|
|
|
|
2004-06-30 13:28:30 -07:00
|
|
|
|
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawable.c: moved call to
|
|
|
|
|
|
_gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to
|
|
|
|
|
|
gimp_drawable_flush(), to resolve problem described in bug
|
|
|
|
|
|
#145051.
|
|
|
|
|
|
|
2004-06-30 09:55:43 -07:00
|
|
|
|
2004-06-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext
|
|
|
|
|
|
parameter and use it to start plug-ins.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c (gimp_real_restore): pass the user context.
|
|
|
|
|
|
Restores script-fu's access to the global FG, FG, brush, ...
|
|
|
|
|
|
|
2004-06-30 09:05:24 -07:00
|
|
|
|
2004-06-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.c
|
|
|
|
|
|
* app/display/display-enums.c
|
|
|
|
|
|
* app/paint/paint-enums.c
|
|
|
|
|
|
* app/text/text-enums.c
|
|
|
|
|
|
* app/widgets/widgets-enums.c: regenerated.
|
|
|
|
|
|
|
2004-06-30 09:01:05 -07:00
|
|
|
|
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.c: revert previous change that was
|
|
|
|
|
|
intended to fix bug #141971.
|
|
|
|
|
|
|
2004-06-30 08:47:32 -07:00
|
|
|
|
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/*/*-enums.h: did HIG-compliant capitalization in the right
|
|
|
|
|
|
place, instead of the auto-generated *-enums.c files.
|
|
|
|
|
|
|
2004-06-30 07:47:23 -07:00
|
|
|
|
2004-06-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.[ch]
|
|
|
|
|
|
* app/widgets/gimpselectiondata.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
|
|
|
|
|
|
to "uri_list" in all function names, parameters and typedefs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimptoolbox-dnd.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-30 07:07:48 -07:00
|
|
|
|
2004-06-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/maze/maze_face.c: made the dialog look a little less
|
|
|
|
|
|
clumsy.
|
|
|
|
|
|
|
2004-06-30 05:31:08 -07:00
|
|
|
|
2004-06-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/drawable.pdb
|
|
|
|
|
|
* libgimp/gimppixbuf.c: raised the maximum size for thumbnails
|
|
|
|
|
|
from 256 to 512 pixels.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/drawable_cmds.c
|
|
|
|
|
|
* libgimp/gimpdrawable_pdb.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig-preview.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: redone Bill's fix using
|
|
|
|
|
|
gimp_image_get_thumbnail(). A lot simpler, renders the alpha
|
|
|
|
|
|
checkerboard and also works for grayscale images.
|
|
|
|
|
|
|
2004-06-30 05:10:08 -07:00
|
|
|
|
2004-06-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Fixed a 1.2 -> 2.0 regression that was forgotten:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
|
|
|
|
|
|
which can be one of { NEW, UPDATE }.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
|
|
|
|
|
|
gimp_palette_editor_update_color() to
|
|
|
|
|
|
gimp_palette_editor_pick_color() and restored the functionality of
|
|
|
|
|
|
creating/updating colors via this API
|
|
|
|
|
|
|
|
|
|
|
|
Changed button_press handler to only edit the color on double
|
|
|
|
|
|
click if it's really a double click on the same color.
|
|
|
|
|
|
Fixes bug #141381.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
|
|
|
|
|
|
"add-to-palette" and a GUI for it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list
|
|
|
|
|
|
* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
|
|
|
|
|
|
parameter to the "color_picked" signal. Pass NEW on button_press
|
|
|
|
|
|
and UPDATE on motion.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
|
|
|
|
|
|
* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
|
|
|
|
|
|
* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
|
|
|
|
|
|
changed accordingly
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
|
|
|
|
|
|
If "add-to-palette" is TRUE, get the palette editor and call
|
|
|
|
|
|
gimp_palette_editor_pick_color().
|
|
|
|
|
|
|
2004-06-30 04:57:17 -07:00
|
|
|
|
2004-06-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpselectiondata.[ch]: renamed the SVG related
|
|
|
|
|
|
functions so that they deal with an anonymous data stream that
|
|
|
|
|
|
could as well be a PNG image.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.[ch]
|
|
|
|
|
|
* app/vectors/gimpvectors-import.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.c: use gsize for the length of
|
|
|
|
|
|
the buffer.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.[ch]
|
|
|
|
|
|
* app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
|
|
|
|
|
|
used yet.
|
|
|
|
|
|
|
2004-06-30 04:09:44 -07:00
|
|
|
|
2004-06-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimppalette.[ch] (gimp_palette_add_entry): take
|
|
|
|
|
|
const GimpRGB* instead of just GimpRGB*.
|
|
|
|
|
|
Converted tabs to spaces.
|
|
|
|
|
|
|
2004-06-29 16:18:18 -07:00
|
|
|
|
2004-06-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
|
|
|
|
|
|
changed return value from gchar* to const gchar*. Renamed
|
|
|
|
|
|
parameters to be consistent with other SVG functions.
|
|
|
|
|
|
|
|
|
|
|
|
* widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* widgets/gimpdnd.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-29 15:45:58 -07:00
|
|
|
|
2004-06-30 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpstroke.[ch]
|
|
|
|
|
|
* tools/pdbgen/pdb/paths.pdb: Applied a modified patch from
|
|
|
|
|
|
Geert Jordaens that implements the gimp-path-get-point-at-dist
|
|
|
|
|
|
PDB function (fixes bug #138754).
|
|
|
|
|
|
|
2004-07-03 03:16:48 -07:00
|
|
|
|
* app/pdb/paths_cmds.c: regenerated.
|
2004-06-29 15:45:58 -07:00
|
|
|
|
|
2004-06-29 15:35:04 -07:00
|
|
|
|
2004-06-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
|
|
|
|
|
|
do like GtkAccelLabel does and turn underscores in accels into
|
|
|
|
|
|
spaces so e.g. "Page_Up" becomes "Page Up".
|
|
|
|
|
|
|
2004-06-29 06:34:16 -07:00
|
|
|
|
2004-06-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c: reordered drop destinations
|
|
|
|
|
|
so vectors are preferred over SVG.
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpvectors-import.[ch]: added "gint position"
|
|
|
|
|
|
parameter to all import functions so the imported vectors can be
|
|
|
|
|
|
added at any position in the vectors stack.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/vectors-commands.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.c
|
|
|
|
|
|
* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
|
|
|
|
|
|
position).
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/paths_cmds.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
|
|
|
|
|
|
to the paths dialog.
|
|
|
|
|
|
|
2004-06-29 06:28:26 -07:00
|
|
|
|
2004-06-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
|
|
|
|
|
|
after dropping, it's owned by GtkSelectionData.
|
|
|
|
|
|
|
2004-06-29 06:20:30 -07:00
|
|
|
|
2004-06-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
|
|
|
|
|
|
gtk_target_list_add_table() because the latter prepends the
|
|
|
|
|
|
targets to the internal list which screws the order (== priority)
|
|
|
|
|
|
of DND targets.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpselectiondata.c: added some more checks for
|
|
|
|
|
|
failed drops (selection_data->length < 0).
|
|
|
|
|
|
|
2004-06-28 20:06:12 -07:00
|
|
|
|
2004-06-29 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: The preview's row buffer was
|
|
|
|
|
|
accidentally made way too large.
|
|
|
|
|
|
|
2004-06-28 16:30:57 -07:00
|
|
|
|
2004-06-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.[ch]: added new function
|
|
|
|
|
|
gimp_get_mod_string() which takes a GdkModifierType and returns
|
|
|
|
|
|
correctly formated strings for all shift,control,alt combinations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpbucketfilloptions.c
|
|
|
|
|
|
* app/tools/gimpcolorpickeroptions.c
|
|
|
|
|
|
* app/tools/gimpconvolvetool.c
|
|
|
|
|
|
* app/tools/gimpcropoptions.c
|
|
|
|
|
|
* app/tools/gimpdodgeburntool.c
|
|
|
|
|
|
* app/tools/gimperasertool.c
|
|
|
|
|
|
* app/tools/gimpflipoptions.c
|
|
|
|
|
|
* app/tools/gimpmagnifyoptions.c
|
|
|
|
|
|
* app/tools/gimpmoveoptions.c
|
|
|
|
|
|
* app/tools/gimptransformoptions.c
|
|
|
|
|
|
* app/tools/gimpvectoroptions.c
|
|
|
|
|
|
* app/widgets/gimpchanneltreeview.c
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.c
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.c: use the new function instead
|
|
|
|
|
|
of gimp_get_mod_name_shift(),control(),alt(),separator(). This
|
|
|
|
|
|
kindof addresses the issue of configurable modifier keys but is
|
|
|
|
|
|
actually indended to ease translation of format strings ("%s" is
|
|
|
|
|
|
easier to get right than "%s%s%s").
|
|
|
|
|
|
|
2004-06-28 15:07:12 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Allow all sorts of things to be dropped on or in between the
|
|
|
|
|
|
items of a GimpContainerTreeView:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.[ch]: added more parameters to
|
|
|
|
|
|
GimpContainerTreeView::drop_possible() to specify where ecactly
|
|
|
|
|
|
the drop should take place (between or into items) and to support
|
|
|
|
|
|
dropping all sorts of things.
|
|
|
|
|
|
|
|
|
|
|
|
Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
|
|
|
|
|
|
::drop_files() and ::drop_svg(), which cover all possible drop
|
|
|
|
|
|
types.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
|
|
|
|
|
|
Dispatch all kinds of drops to the resp. virtual functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c: allow to drop URIs, colors
|
|
|
|
|
|
and patterns to the layers dialog. Fixes bugs #119506 and #139246.
|
|
|
|
|
|
|
2004-06-28 14:42:19 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/file/file-open.[ch] (file_open_layer): new utility function
|
|
|
|
|
|
which opens an image, flattens it if needed and returns the only
|
|
|
|
|
|
layer, converted for a passed destination image.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.c
|
|
|
|
|
|
(gimp_display_shell_drop_files): use the new function.
|
|
|
|
|
|
|
2004-06-28 13:39:54 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpselectiondata.[ch]: new files containing the
|
|
|
|
|
|
code which encodes/decodes all sorts of stuff to/from its
|
|
|
|
|
|
GtkSelectionData representation. Used to live in gimpdnd.c
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.c: use the new functions (unclutters the
|
|
|
|
|
|
file quite a bit), converted tabs to spaces.
|
|
|
|
|
|
|
2004-06-28 10:06:38 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c:
|
|
|
|
|
|
#include "libgimpwidgets/gimpwidgets.h"
|
|
|
|
|
|
|
2004-06-28 07:24:56 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Fixed bug #141930 while keeping bug #132322 fixed:
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/curves.c (curves_lut_func)
|
|
|
|
|
|
* app/base/levels.c (levels_lut_func): changed meaning of channel
|
|
|
|
|
|
slots for GRAYA images: just as for GRAY images, expect the value
|
|
|
|
|
|
channel in slot 0 and the alpha channel in slot 1, so it matches
|
|
|
|
|
|
the meaning of slots of GimpHistogram (before this change, only
|
|
|
|
|
|
GRAY images had their value in slot 0 and GRAYA images had it in
|
|
|
|
|
|
slot 1, whereas the histogram had the value channel in slot 0,
|
|
|
|
|
|
which was breaking auto levels for GRAYA images).
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c
|
|
|
|
|
|
* tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
|
|
|
|
|
|
and GRAYA images accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c (curves_update)
|
|
|
|
|
|
* app/tools/gimplevelstool.c (levels_update): call
|
|
|
|
|
|
gimp_color_bar_set_buffers() with the right buffers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/color_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-06-28 06:18:00 -07:00
|
|
|
|
2004-06-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c (gui_initialize_after_callback): select the
|
|
|
|
|
|
standard tool.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/tool_manager.c: cosmetics.
|
|
|
|
|
|
|
2004-06-28 04:45:14 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimplevelstool.c: reverted fix for bug #141930. These
|
|
|
|
|
|
hacks are there because the enum used in levels doesn't match
|
|
|
|
|
|
the enum used by the combo box and the histogram widget.
|
|
|
|
|
|
|
2004-06-28 04:36:00 -07:00
|
|
|
|
2004-06-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
|
|
|
|
|
|
removed again (tools must not draw outside GimpDrawTool::draw()).
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
|
|
|
|
|
|
because the draw function would not be called if the draw tool was
|
|
|
|
|
|
inactive. Simplified check for whether or not to draw the src
|
|
|
|
|
|
location.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c (gimp_paint_tool_button_release):
|
|
|
|
|
|
pause/resume the draw tool across all button_release actions so
|
|
|
|
|
|
tools (clone) have a chance to draw different things depending on
|
|
|
|
|
|
gimp_tool_control_is_active(tool->control). Fixes bug #145022.
|
|
|
|
|
|
|
2004-06-28 03:13:33 -07:00
|
|
|
|
2004-06-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c (action_select_object): added missing
|
|
|
|
|
|
return value.
|
|
|
|
|
|
|
2004-06-28 02:28:49 -07:00
|
|
|
|
2004-06-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dog.c: applied HIG rules to the GUI and slightly
|
2004-06-28 03:13:33 -07:00
|
|
|
|
rearranged it to get a more compact layout. Applied GIMP coding
|
|
|
|
|
|
style.
|
2004-06-28 02:28:49 -07:00
|
|
|
|
|
2004-06-28 01:58:56 -07:00
|
|
|
|
2004-06-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawable.c: removed wrong note about using
|
|
|
|
|
|
_gimp_tile_cache_flush_drawable() from the API docs.
|
|
|
|
|
|
|
2004-06-28 01:47:51 -07:00
|
|
|
|
2004-06-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dog.c (dog): ifdef'ed out calls to
|
|
|
|
|
|
_gimp_tile_cache_flush_drawable() since it can't be used from a
|
|
|
|
|
|
plug-in. Removed trailing whitespace and redundant includes.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again.
|
|
|
|
|
|
|
2004-06-27 16:00:46 -07:00
|
|
|
|
2004-06-28 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpvectortool.c: fixed drawing code to properly
|
|
|
|
|
|
update after deleting nodes via BackSpace/Delete.
|
|
|
|
|
|
|
2004-06-27 10:30:55 -07:00
|
|
|
|
2004-06-27 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimplevelstool.c: removed two small chunks of code.
|
|
|
|
|
|
Fixes bug #141930. Possibly unfixes bug #132322.
|
|
|
|
|
|
|
2004-06-27 09:02:01 -07:00
|
|
|
|
2004-06-27 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because
|
2004-06-27 10:30:55 -07:00
|
|
|
|
it is used in a plug-in. See bug #145051.
|
2004-06-27 09:02:01 -07:00
|
|
|
|
|
2004-06-26 20:17:57 -07:00
|
|
|
|
2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: Preview now works correctly with
|
|
|
|
|
|
RGBA and grayscale-alpha images. Fixes bug #144971.
|
|
|
|
|
|
|
2004-06-26 16:45:13 -07:00
|
|
|
|
2004-06-26 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpclonetool.c: added button_release callback
|
|
|
|
|
|
to fix bug #145022.
|
|
|
|
|
|
|
2004-06-26 12:08:08 -07:00
|
|
|
|
2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source
|
|
|
|
|
|
is grayscale or grayscale-alpha. Partial fix for bug #144971.
|
|
|
|
|
|
|
2004-06-26 07:18:25 -07:00
|
|
|
|
2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: speed up preview by allocating tile
|
|
|
|
|
|
cache before creating dialog. Should fix bug #144972.
|
|
|
|
|
|
|
2004-06-25 18:38:22 -07:00
|
|
|
|
2004-06-25 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/zealouscrop.c: Moved Zealous Crop from
|
|
|
|
|
|
<Image>/Layer/Crop to <Image>/Image/Crop because it affects the
|
|
|
|
|
|
entire image.
|
|
|
|
|
|
|
2004-06-25 13:19:54 -07:00
|
|
|
|
2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/dog.c: added Difference of Gaussians edge
|
|
|
|
|
|
detect plug-in.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl:
|
|
|
|
|
|
* plug-ins/common/Makefile.am: added dog and regenerated
|
|
|
|
|
|
Makefile.
|
|
|
|
|
|
|
2004-06-25 06:50:45 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET
|
|
|
|
|
|
actions which set a generated brush's properties directly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-commands.c: adjust the range of possible
|
|
|
|
|
|
brush radius and aspect_ratio values to be actually usable.
|
|
|
|
|
|
|
2004-06-25 06:41:24 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.[ch]: reordered parameters and
|
|
|
|
|
|
members to be consistent with other places where generated
|
|
|
|
|
|
brushes are used. Check for errors when loading a brush and
|
|
|
|
|
|
utf8-validate its name. Cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrush.c
|
|
|
|
|
|
* app/core/gimpbrushpipe.c: cleanup.
|
|
|
|
|
|
|
2004-06-25 03:24:35 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c (prefs_dialog_new): work around
|
|
|
|
|
|
GTK+ bug #143270 (set the cursor on the selected model path
|
|
|
|
|
|
instead of selecting the iter in the selection). Fixes random
|
|
|
|
|
|
theme switching when selecting the "Theme" page.
|
|
|
|
|
|
|
2004-06-24 17:58:43 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.c: added properties for all brush
|
|
|
|
|
|
parameters.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c: listen to property changes of the
|
|
|
|
|
|
edited brush and update the scales accordingly.
|
|
|
|
|
|
|
2004-06-24 16:44:37 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: more work on the controller page,
|
|
|
|
|
|
made integer controller properties editable.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_midi.c: allow to specify the MIDI channel to
|
|
|
|
|
|
generate events from. Default to -1 (all channels).
|
|
|
|
|
|
|
2004-06-24 15:51:55 -07:00
|
|
|
|
2004-06-24 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig.[ch]:
|
|
|
|
|
|
* plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the
|
|
|
|
|
|
image as background for its preview, if the image is RGB and "Show
|
|
|
|
|
|
image" is checked in the Options tab. (Next best thing to
|
|
|
|
|
|
previewing in the image.)
|
|
|
|
|
|
|
2004-06-24 15:35:00 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.[ch]: added a boolean property
|
|
|
|
|
|
"debug-events" and honor it when printing debugging output.
|
|
|
|
|
|
Should add an event console window so the user doesn't need to
|
|
|
|
|
|
have a terminal to inspect input module output.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/prefereces-dialog.c: HIGified some forgotten labels.
|
|
|
|
|
|
Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors".
|
|
|
|
|
|
Replaced some forgotten "Dir" with "Folder".
|
|
|
|
|
|
Made more GimpControllerInfo and GimpController properties
|
|
|
|
|
|
editable and cleaned up the controller page.
|
|
|
|
|
|
|
2004-06-24 15:23:05 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpgrideditor.c: HIGified capitalization.
|
|
|
|
|
|
|
2004-06-24 15:19:25 -07:00
|
|
|
|
2004-06-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c
|
|
|
|
|
|
* modules/controller_midi.c: remember the source ID returned by
|
|
|
|
|
|
g_io_add_watch() and remove it when changing the device, so the
|
|
|
|
|
|
file descritor gets actually closed. Minor cleanups.
|
|
|
|
|
|
|
2004-06-24 08:29:19 -07:00
|
|
|
|
2004-06-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerwheel.[ch]: renamed function
|
|
|
|
|
|
gimp_controller_wheel_scrolled() to
|
|
|
|
|
|
gimp_controller_wheel_scroll().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
(gimp_display_shell_canvas_tool_events): changed accordingly.
|
|
|
|
|
|
|
2004-06-24 05:12:46 -07:00
|
|
|
|
2004-06-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: fix typo in wheel controller mapping.
|
|
|
|
|
|
|
2004-06-24 03:16:08 -07:00
|
|
|
|
2004-06-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptool.[ch]
|
|
|
|
|
|
* app/tools/tool_manager.[ch]: added boolean return value to
|
|
|
|
|
|
GimpTool::key_press() which indicates if the event was handled.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.[ch]
|
|
|
|
|
|
* app/tools/gimptransformtool.c
|
|
|
|
|
|
* app/tools/gimpvectortool.c: return TRUE if the key event was handled.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c: removed key_press() implementation.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
|
|
|
|
|
|
which takes GdkEventKey and emits controller events for all
|
|
|
|
|
|
combinations of modifiers and cursor keys.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.[ch]: added new function
|
|
|
|
|
|
gimp_controllers_get_keyboard().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c: if a key event was not
|
|
|
|
|
|
handled by the active tool, dispatch it to the keyboard controller.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: add a keyboard controller which is configured
|
|
|
|
|
|
to do the same as the removed gimp_paint_tool_key_press().
|
|
|
|
|
|
|
2004-06-23 19:00:32 -07:00
|
|
|
|
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawable.c: added some documentation for
|
|
|
|
|
|
a few important functions with no API docs.
|
|
|
|
|
|
|
2004-06-23 17:51:19 -07:00
|
|
|
|
2004-06-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Made 2.1.1 release.
|
|
|
|
|
|
|
2004-06-23 17:15:06 -07:00
|
|
|
|
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.c: make "Revert" only ask for
|
|
|
|
|
|
confirmation if image is dirty. Fixes bug #141971.
|
|
|
|
|
|
|
2004-06-23 15:44:04 -07:00
|
|
|
|
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/*.c:
|
|
|
|
|
|
* app/widgets/*.c:
|
|
|
|
|
|
* etc/templaterc: HIGify capitalization. Should finish bug #123699
|
|
|
|
|
|
except for everything I missed or got wrong.
|
|
|
|
|
|
|
2004-06-23 15:34:33 -07:00
|
|
|
|
2004-06-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: commented out the linux_input controller
|
|
|
|
|
|
configuration.
|
|
|
|
|
|
|
2004-06-23 13:29:46 -07:00
|
|
|
|
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/*.c: HIGify capitalization for dialogs. More
|
|
|
|
|
|
progress on bug #123699.
|
|
|
|
|
|
|
2004-06-23 08:20:37 -07:00
|
|
|
|
2004-06-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_midi.c: added utility function midi_event()
|
|
|
|
|
|
which assembles a GimpControllerEventValue and emits it.
|
|
|
|
|
|
|
2004-06-23 07:39:48 -07:00
|
|
|
|
2004-06-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumaction.[ch]
|
|
|
|
|
|
* app/widgets/gimppluginaction.[ch]
|
|
|
|
|
|
* app/widgets/gimpstringaction.[ch]: added parameters to the
|
|
|
|
|
|
gimp_*_action_selected() function so the "selected" signal can be
|
|
|
|
|
|
emitted with value != action->value. Changed GtkAction::activate()
|
|
|
|
|
|
implementations accordingly (pass action->value).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: call gimp_enum_action_selected()
|
|
|
|
|
|
and pass the value of the GimpControllerEventValue instead of
|
|
|
|
|
|
temporarily replacing action->value and calling
|
|
|
|
|
|
gtk_action_activate().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
|
|
|
|
|
|
|
2004-06-23 05:19:28 -07:00
|
|
|
|
2004-06-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
|
|
|
|
|
|
G_SIGNAL_RUN_LAST so we can connect before and after the default
|
|
|
|
|
|
implementation. Moved the brush setting and outline invalidation
|
|
|
|
|
|
stuff to its default implementation. Also remember the outline's
|
|
|
|
|
|
width and height. Call gimp_brush_core_set_brush() from
|
|
|
|
|
|
gimp_brush_core_invalidate_cache() so "set-brush" is emitted
|
|
|
|
|
|
whenever a generated brush becomes dirty.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
|
|
|
|
|
|
pause/resume but rather stop/start the draw_tool. Fixes straight
|
|
|
|
|
|
line preview aretefacts.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_paint_tool_oper_update): set the brush_core's brush before
|
|
|
|
|
|
starting the draw_tool.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_paint_tool_draw): never free the brush_core's cached brush
|
|
|
|
|
|
outline because the brush_core does that by itself now.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_paint_tool_set_brush)
|
|
|
|
|
|
(gimp_paint_tool_set_brush_after): new callbacks which pause and
|
|
|
|
|
|
resume the draw_tool. Fixes brush outline artefacts when modifying
|
|
|
|
|
|
the current brush e.g. by using the mouse wheel.
|
|
|
|
|
|
|
2004-06-22 17:23:25 -07:00
|
|
|
|
2004-06-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-commands.h: removed enum GimpContextSelectType.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions-types.h: added enum GimpActionSelectType.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.[ch]: added utility functions
|
|
|
|
|
|
action_select_value() and action_select_object().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c
|
|
|
|
|
|
* app/actions/context-commands.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/layers-actions.c
|
|
|
|
|
|
* app/actions/layers-commands.[ch]: merged the layer select
|
|
|
|
|
|
callbacks into one using the GimpActionSelectType functions. Added
|
|
|
|
|
|
actions and callbacks for modifying the active layer's opacity.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus-types.h: #incude "actions/action-types.h".
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-types.h: #incude "menus/menus-types.h".
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: allow to enable/disable input
|
|
|
|
|
|
controllers.
|
|
|
|
|
|
|
2004-06-22 14:09:26 -07:00
|
|
|
|
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c: try again to revert.
|
|
|
|
|
|
|
2004-06-22 11:46:03 -07:00
|
|
|
|
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c: reverted.
|
|
|
|
|
|
|
2004-06-22 11:20:03 -07:00
|
|
|
|
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts: HIG-ified capitalization on
|
|
|
|
|
|
all. Finishes this for everything in plug-ins. Bug #123699 is
|
|
|
|
|
|
now mostly fixed.
|
|
|
|
|
|
|
2004-06-22 11:11:08 -07:00
|
|
|
|
2004-06-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite-regression.c: define timersub()
|
|
|
|
|
|
macro in case it's undefined. Patch by Tim Mooney, fixes 'make
|
|
|
|
|
|
check' on Tru64 (bug #144780).
|
|
|
|
|
|
|
2004-06-22 10:17:16 -07:00
|
|
|
|
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c: added Store/Recall buttons for
|
|
|
|
|
|
one-click saving and loading of curves. Should create stock
|
|
|
|
|
|
labels for them. Hopefully resolves bug #75558.
|
|
|
|
|
|
|
2004-06-22 09:31:27 -07:00
|
|
|
|
2004-06-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/view-actions.c
|
|
|
|
|
|
* app/actions/view-commands.[ch]: added actions & callbacks to
|
|
|
|
|
|
configure the canvas padding color.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h
|
|
|
|
|
|
* menus/image-menu.xml.in: added the actions' help IDs and menu entries.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/display-enums.h: added /*< skip >*/'ed enum value
|
|
|
|
|
|
GIMP_CANVAS_PADDING_MODE_RESET.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-appearance.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: removed the canvas padding
|
|
|
|
|
|
button and its popup menu (fixes bug #142996). Instead, added a
|
|
|
|
|
|
toggle button which allows to zoom the image when the window is
|
|
|
|
|
|
resized (as known from sodipodi, except it doesn't work as nice
|
|
|
|
|
|
yet :-) improvements to the algorithm are welcome).
|
|
|
|
|
|
Cleaned up the GimpDisplayShell struct a bit and renamed some
|
|
|
|
|
|
of its members.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpstock.[ch]
|
|
|
|
|
|
* themes/Default/images/Makefile.am
|
|
|
|
|
|
* themes/Default/images/stock-zoom-follow-window-12.png: added new
|
|
|
|
|
|
icon for the new display toggle button.
|
|
|
|
|
|
|
2004-06-22 08:31:14 -07:00
|
|
|
|
2004-06-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
|
|
|
|
|
|
unconditionally now that we draw the brush outline while
|
|
|
|
|
|
painting. Fixes brush outline artefacts on button_press and
|
|
|
|
|
|
button_release. Spotted by sjburges.
|
|
|
|
|
|
|
2004-06-22 08:11:35 -07:00
|
|
|
|
2004-06-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
|
|
|
|
|
|
the filename if the image is unnamed.
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in
|
|
|
|
|
|
* app/sanity.c: depend on gtk+ >= 2.4.1.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
|
|
|
|
|
|
to gimp_thumb_box_take_uris() since the function takes ownership
|
|
|
|
|
|
of the list,
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c: changed accordingly. Removed code
|
|
|
|
|
|
that worked around a problem in gtk+ < 2.4.1.
|
|
|
|
|
|
|
2004-06-22 02:28:35 -07:00
|
|
|
|
2004-06-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use
|
|
|
|
|
|
gimp_rgb_distance() for flat color areas. Fixes bug #144786.
|
|
|
|
|
|
|
2004-06-22 01:54:27 -07:00
|
|
|
|
2004-06-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a
|
|
|
|
|
|
generated file, need to do the documentation change here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/fileops_cmds.c
|
|
|
|
|
|
* libgimp/gimpfileops_pdb.c: regenerated.
|
|
|
|
|
|
|
2004-06-21 19:21:13 -07:00
|
|
|
|
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformoptions.c: use radio buttons
|
|
|
|
|
|
for constraint options. Makes all options visible,
|
|
|
|
|
|
should resolve bug #68106.
|
|
|
|
|
|
|
2004-06-21 17:12:52 -07:00
|
|
|
|
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-save-dialog.c: to reduce clutter, hide overwrite
|
|
|
|
|
|
query dialog after user has responded.
|
|
|
|
|
|
|
2004-06-21 13:42:55 -07:00
|
|
|
|
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/noisify.c: changed handling of alpha
|
|
|
|
|
|
channel in an attempt to deal with bug #72853.
|
|
|
|
|
|
Changed menu entry from "Noisify" to "Scatter RGB".
|
|
|
|
|
|
|
2004-06-21 12:36:26 -07:00
|
|
|
|
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/fileops_cmds.c: fixed incorrect documentation for
|
|
|
|
|
|
gimp_file_load, which was the root cause of bug #118811.
|
|
|
|
|
|
|
2004-06-21 12:15:08 -07:00
|
|
|
|
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins: finish implementing HIG capitalization in dialogs.
|
|
|
|
|
|
Scripts remain to be done. More progress on bug #123699.
|
|
|
|
|
|
|
2004-06-21 09:17:16 -07:00
|
|
|
|
2004-06-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed
|
|
|
|
|
|
value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
|
|
|
|
|
|
of GDK to do that (it was GDK that was broken, not some of the X
|
|
|
|
|
|
servers).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the
|
|
|
|
|
|
cursor's pixels for GTK+ < 2.4.4.
|
|
|
|
|
|
|
2004-06-21 06:35:09 -07:00
|
|
|
|
2004-06-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c (gui_exit_callback): improved message in quit
|
|
|
|
|
|
dialog just in case that we don't manage to redo this dialog
|
|
|
|
|
|
before 2.2.
|
|
|
|
|
|
|
2004-06-21 06:18:50 -07:00
|
|
|
|
2004-06-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.[ch]
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def: added new utility function
|
|
|
|
|
|
gimp_label_set_attributes().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/gui/resolution-calibrate-dialog.c
|
|
|
|
|
|
* app/widgets/gimpviewabledialog.c
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c: use the new function.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c: display the name in italic.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: display the file size in italic.
|
|
|
|
|
|
|
2004-06-20 17:48:44 -07:00
|
|
|
|
2004-06-20 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/url.c: if url does not end in a recognized
|
2004-06-21 12:15:08 -07:00
|
|
|
|
extension, open it as an unnamed image. Fixes bug #118811.
|
2004-06-20 17:48:44 -07:00
|
|
|
|
|
2004-06-20 15:04:10 -07:00
|
|
|
|
2004-06-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrambox.[ch]: removed the label between the
|
|
|
|
|
|
spinbuttons, it looks silly. Converted tabs to spaces, removed
|
|
|
|
|
|
trailing whitespace.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c
|
|
|
|
|
|
* app/tools/gimpthresholdtool.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-20 15:47:33 -07:00
|
|
|
|
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins: changed dialogs to follow HIG capitalization style
|
|
|
|
|
|
wherever they didn't. Scripts remain to be done. Partially
|
|
|
|
|
|
fixes bug #123699.
|
|
|
|
|
|
|
2004-06-20 13:51:23 -07:00
|
|
|
|
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrambox.[ch]:
|
|
|
|
|
|
* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
|
|
|
|
|
|
so that it uses a two-triangle-slider scale of the sort used in the
|
|
|
|
|
|
levels tool. Almost all of the changes are actually in the
|
|
|
|
|
|
histogram-box widget code, which is only used by the threshold
|
|
|
|
|
|
tool. Fixes bug #137521.
|
|
|
|
|
|
|
2004-06-20 06:45:41 -07:00
|
|
|
|
2004-06-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: removed redundant hboxes and other
|
|
|
|
|
|
layout cleanups.
|
|
|
|
|
|
|
2004-06-20 05:09:03 -07:00
|
|
|
|
2004-06-20 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-scale.[ch]:
|
|
|
|
|
|
* app/display/gimpnavigationview.[ch]:
|
|
|
|
|
|
* app/actions/view-actions.c:
|
|
|
|
|
|
* app/actions/view-commands.[ch]:
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h:
|
|
|
|
|
|
* menus/image-menu.xml.in: Changed "Zoom to Fit Window" command
|
|
|
|
|
|
to "Fit Image in Window" and added another command, "Fit Image
|
|
|
|
|
|
to Window", that zooms according to the opposite dimension. Fixes
|
|
|
|
|
|
bug #144597.
|
|
|
|
|
|
|
|
|
|
|
|
2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org>
|
2004-06-19 14:02:34 -07:00
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def: added missing
|
|
|
|
|
|
gimp_controller_* entries
|
|
|
|
|
|
|
2004-06-20 05:09:03 -07:00
|
|
|
|
2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org>
|
2004-06-19 13:57:17 -07:00
|
|
|
|
|
|
|
|
|
|
* modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK
|
|
|
|
|
|
|
2004-06-20 05:09:03 -07:00
|
|
|
|
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
2004-06-19 13:31:41 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: more changes to save dialog. Moved
|
|
|
|
|
|
comment field to Advanced area. Don't set restart marker
|
|
|
|
|
|
frequency stuff insensitive. Changed range for quality
|
|
|
|
|
|
scale from 0-1 to 0-100 to follow the jpeg spec (but left
|
|
|
|
|
|
allowable range for pdb at 0-1 to avoid breaking anything).
|
|
|
|
|
|
|
2004-06-20 05:09:03 -07:00
|
|
|
|
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
2004-06-19 11:40:51 -07:00
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
|
|
|
|
|
|
worked incorrectly for two of the control points.
|
|
|
|
|
|
|
2004-06-19 11:34:14 -07:00
|
|
|
|
2004-06-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_midi.c (midi_read_event): simplified
|
|
|
|
|
|
swallowing of SysEx messages and unwanted data bytes. Reordered
|
|
|
|
|
|
and commented stuff to be more readable.
|
|
|
|
|
|
|
2004-06-19 10:37:14 -07:00
|
|
|
|
2004-06-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/Makefile.am
|
|
|
|
|
|
* modules/controller_midi.c: new controller for MIDI input. Maps
|
|
|
|
|
|
all note on and note off events and all MIDI controllers to
|
|
|
|
|
|
GimpContollerEvents. Should parse any MIDI stream. Code based on
|
|
|
|
|
|
blinkenmedia stuff from Daniel Mack.
|
|
|
|
|
|
|
2004-06-19 06:31:58 -07:00
|
|
|
|
2004-06-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Applied a patch from Geert Jordaens that implements the
|
|
|
|
|
|
GtkStatusbar functionality in GimpStatusbar so that we can redo it
|
|
|
|
|
|
in order to fix bug #120175:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list: added VOID: UINT, STRING.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.[ch]: copied GtkStatusbar code.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-19 04:06:57 -07:00
|
|
|
|
2004-06-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose_utils.c (create_brush): use
|
|
|
|
|
|
G_SQRT2; some coding style cleanups.
|
|
|
|
|
|
|
2004-06-19 03:44:54 -07:00
|
|
|
|
2004-06-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved
|
|
|
|
|
|
array initialization out of variable declaration (bug #144632).
|
|
|
|
|
|
|
2004-06-19 02:20:36 -07:00
|
|
|
|
2004-06-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use
|
|
|
|
|
|
G_SQRT2 to make circlemagic a constant value so we can initialize
|
|
|
|
|
|
the array on declaration. Fixes bug #144632.
|
|
|
|
|
|
|
2004-06-19 01:58:14 -07:00
|
|
|
|
2004-06-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* devel-docs/parasites.txt: document "exif-data" parasite.
|
|
|
|
|
|
|
2004-06-18 19:17:58 -07:00
|
|
|
|
2004-06-18 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/film.c: Don't use deprecated gimp_text functions,
|
|
|
|
|
|
clean up font name string handling a bit, default is now "Monospace"
|
|
|
|
|
|
instead of "Courier".
|
|
|
|
|
|
|
2004-06-18 17:31:08 -07:00
|
|
|
|
2004-06-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
|
|
|
|
|
|
start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble.
|
|
|
|
|
|
Assume the double value is in a [0.0..1.0] range and temporarily
|
|
|
|
|
|
change the value of the called GimpEnumAction to a range of
|
|
|
|
|
|
[0..1000] when invoking it. All still very hackish...
|
|
|
|
|
|
|
2004-06-18 17:05:48 -07:00
|
|
|
|
2004-06-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event):
|
|
|
|
|
|
more debugging output.
|
|
|
|
|
|
|
2004-06-18 16:07:23 -07:00
|
|
|
|
2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpscaletool.c: changed algorithm for scaling when
|
|
|
|
|
|
aspect ratio is constrained, to fix strange behavior described
|
|
|
|
|
|
in bug # 68106.
|
|
|
|
|
|
|
2004-06-18 15:38:45 -07:00
|
|
|
|
2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: redid save dialog along lines suggested
|
|
|
|
|
|
in bug # 138929
|
|
|
|
|
|
|
|
|
|
|
|
Only create an exif data parasite on loading file if the file actually
|
|
|
|
|
|
contains exif data.
|
|
|
|
|
|
|
|
|
|
|
|
Call exif data parasite "exif-data" instead of "jpeg-exif-data",
|
|
|
|
|
|
because it should be interchangeable with TIFF exif data.
|
|
|
|
|
|
|
2004-06-18 05:58:39 -07:00
|
|
|
|
2004-06-18 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c
|
|
|
|
|
|
* app/actions/context-commands.[ch]: added tons of new actions to
|
|
|
|
|
|
modify the current FG/BG color's RGB components.
|
|
|
|
|
|
|
|
|
|
|
|
Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set
|
|
|
|
|
|
values, not only increase/decrease them.
|
|
|
|
|
|
|
|
|
|
|
|
Changed context_select_value() utility function to interpret
|
|
|
|
|
|
GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings
|
|
|
|
|
|
in a range from 0 to 1000. Yes, that's a hack...
|
|
|
|
|
|
|
2004-06-18 03:47:07 -07:00
|
|
|
|
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: reverted my fix to bug #144570.
|
|
|
|
|
|
|
2004-06-18 02:48:44 -07:00
|
|
|
|
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.
|
|
|
|
|
|
|
2004-06-17 22:47:44 -07:00
|
|
|
|
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
|
|
|
|
|
|
If transforming a path, use the path bounds rather than the mask
|
|
|
|
|
|
bounds. Fixes bug #144570.
|
|
|
|
|
|
|
2004-06-17 09:32:30 -07:00
|
|
|
|
2004-06-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.c: use it.
|
|
|
|
|
|
|
2004-06-17 09:25:36 -07:00
|
|
|
|
2004-06-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpcontainer.c (gimp_container_deserialize): add newly
|
|
|
|
|
|
created children to the container *after* deserializing them so
|
|
|
|
|
|
GimpContainer::add() callbacks get the already deserialized
|
|
|
|
|
|
object.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: connect to "add" and "remove" of
|
|
|
|
|
|
the controller list and remember / clear the wheel controller when
|
|
|
|
|
|
it appears / disappears.
|
|
|
|
|
|
|
2004-06-17 07:33:29 -07:00
|
|
|
|
2004-06-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* autogen.sh: check for xsltproc and mention that the intltool
|
|
|
|
|
|
version mismatch is harmless.
|
|
|
|
|
|
|
2004-06-17 07:08:29 -07:00
|
|
|
|
2004-06-17 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation.
|
|
|
|
|
|
Addresses bug #144267.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/paths_cmds.c
|
|
|
|
|
|
* libgimp/gimppaths_pdb.c: regenerated.
|
|
|
|
|
|
|
2004-06-17 07:07:05 -07:00
|
|
|
|
2004-06-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.[ch]: removed "enabled"
|
2004-06-17 07:33:29 -07:00
|
|
|
|
property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name"
|
2004-06-17 07:07:05 -07:00
|
|
|
|
property because it's the hardware-determined name of this
|
|
|
|
|
|
controller instance.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerwheel.c
|
|
|
|
|
|
* modules/controller_linux_input.c: set the name.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here
|
|
|
|
|
|
instead. Don't dispatch events if the controller is
|
|
|
|
|
|
disabled. Made everything work (not crash) with info->mapping
|
|
|
|
|
|
being NULL.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: updated again with the changed format.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.[ch]: added
|
|
|
|
|
|
gimp_controllers_get_list() which returns the container of
|
|
|
|
|
|
controllers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added controller configuration
|
|
|
|
|
|
(can't change anything yet, just view the current settings).
|
|
|
|
|
|
Resurrected the "Input Devices" page and removed the "Session"
|
|
|
|
|
|
page by moving its widgets to other pages. Pack the various
|
|
|
|
|
|
"Save now"/"Clear now" buttons vertically, not horizontally.
|
|
|
|
|
|
Fixes bug #139069.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/images/preferences/Makefile.am
|
|
|
|
|
|
* themes/Default/images/preferences/controllers.png
|
|
|
|
|
|
* themes/Default/images/preferences/theme.png: new icons for new
|
|
|
|
|
|
prefs pages. Someone needs to make them nice...
|
|
|
|
|
|
|
2004-06-17 05:19:02 -07:00
|
|
|
|
2004-06-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar
|
|
|
|
|
|
visible by default, hide it if options->show_menubar is FALSE.
|
|
|
|
|
|
Fixes bug #143243.
|
|
|
|
|
|
|
2004-06-17 03:01:58 -07:00
|
|
|
|
2004-06-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: bumped version to 2.1.1. Allow to disable the
|
|
|
|
|
|
build of the linux_input controller module.
|
|
|
|
|
|
|
2004-06-16 23:42:07 -07:00
|
|
|
|
2004-06-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
2004-06-17 03:01:58 -07:00
|
|
|
|
* app/core/gimpdrawable-transform.c
|
|
|
|
|
|
(gimp_drawable_transform_tiles_affine): Make transforms (most
|
|
|
|
|
|
notably perspective transforms) conform exactly to specified
|
|
|
|
|
|
edges. Includes a patch by David Gowers. Fixes bug #144352.
|
2004-06-16 23:42:07 -07:00
|
|
|
|
|
2004-06-16 16:37:38 -07:00
|
|
|
|
2004-06-16 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP}
|
|
|
|
|
|
usage in #ifdefs, since pre-2.6 kernels do not have them.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c (linux_input_read_event): n_bytes
|
|
|
|
|
|
should be a gsize.
|
|
|
|
|
|
|
2004-06-16 13:12:47 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c
|
|
|
|
|
|
* app/actions/context-commands.[ch]: added actions & callback
|
|
|
|
|
|
to select the first/last/prev/next tool.
|
|
|
|
|
|
|
2004-06-16 12:59:34 -07:00
|
|
|
|
2004-06-16 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: removed BTN_MISC,
|
|
|
|
|
|
since it is the same as BTN_0 in the input.h header file.
|
|
|
|
|
|
|
2004-06-16 12:51:33 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name)
|
|
|
|
|
|
(gimp_controller_get_event_blurb): always return a non-NULL
|
|
|
|
|
|
string (return "<invalid event id>" as fallback).
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: reenabled button event
|
|
|
|
|
|
dispatching.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
|
|
|
|
|
|
|
2004-06-16 11:55:01 -07:00
|
|
|
|
2004-06-16 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: break out of the
|
|
|
|
|
|
loop after we handled the first matching rel_event.
|
|
|
|
|
|
|
2004-06-16 11:14:44 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.[ch]: added #define
|
|
|
|
|
|
GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: made "device-name"
|
|
|
|
|
|
serializable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-params.h: added macro
|
|
|
|
|
|
GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled
|
|
|
|
|
|
by custom (de)serialize_property() implementations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-deserialize.c
|
|
|
|
|
|
* app/config/gimpconfig-serialize.c: made object (de)serialization
|
|
|
|
|
|
work for object properties which are *not* GIMP_PARAM_AGGREGATE.
|
|
|
|
|
|
Write/parse the exact type of the object to create to enable this.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list: new marshaller for GimpControllerInfo.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface
|
|
|
|
|
|
and add "controller" and "mapping" properties. Add "event-mapped"
|
|
|
|
|
|
signal which carries the action_name.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: removed all deserialization code
|
|
|
|
|
|
and simply (de)serialize the controller container. Install a
|
|
|
|
|
|
container handler for "event-mapped" and do the action_name ->
|
|
|
|
|
|
action mapping in the callback.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: regenerated with new syntax. Delete your old one!
|
|
|
|
|
|
|
2004-06-16 10:22:19 -07:00
|
|
|
|
2004-06-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerwheel.c
|
|
|
|
|
|
(gimp_controller_wheel_get_event_name): don't use gettext() here.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: added more button events, set
|
|
|
|
|
|
the device name, some cleanup.
|
|
|
|
|
|
|
2004-06-16 09:17:02 -07:00
|
|
|
|
2004-06-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl: changed dependencies for blur.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/blur.c: no need to include libgimpui.h any longer.
|
|
|
|
|
|
|
2004-06-16 09:01:07 -07:00
|
|
|
|
2004-06-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/blur.c: removed randomize and repeat options;
|
|
|
|
|
|
made to run without popping a dialog. (bug #142318)
|
|
|
|
|
|
|
2004-06-16 05:07:34 -07:00
|
|
|
|
2004-06-16 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c: enable dial-events for
|
|
|
|
|
|
e.g. the powermate. Fixed typo.
|
|
|
|
|
|
|
2004-06-16 05:05:28 -07:00
|
|
|
|
2004-06-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: added missing menu entries (bug #144449).
|
|
|
|
|
|
|
2004-06-16 04:53:37 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.[ch]: added
|
|
|
|
|
|
GimpController::get_event_blurb() which returns the strings that
|
|
|
|
|
|
were returned by get_event_name(). The latter returns
|
|
|
|
|
|
untranslatable event identifiers now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerwheel.c
|
|
|
|
|
|
* modules/controller_linux_input.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.c
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: changed the event mapping from
|
|
|
|
|
|
event-id -> action-name to event-name -> action-name.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: changed accordingly (finally readable now).
|
|
|
|
|
|
|
2004-06-16 04:11:32 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontrollerinfo.[ch]: made an object out of
|
|
|
|
|
|
the GimpControllerInfo struct.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-15 19:57:55 -07:00
|
|
|
|
2004-06-16 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: fix typo
|
|
|
|
|
|
|
2004-06-15 19:39:15 -07:00
|
|
|
|
2004-06-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* modules/controller_linux_input.c
|
|
|
|
|
|
* etc/controllerrc: preliminary wheel event support.
|
|
|
|
|
|
|
2004-06-15 19:23:42 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: better debugging output.
|
|
|
|
|
|
|
2004-06-15 19:20:34 -07:00
|
|
|
|
2004-06-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: bug fix.
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: check for linux/input.h.
|
|
|
|
|
|
|
|
|
|
|
|
* modules/Makefile.am
|
|
|
|
|
|
* modules/controller_linux_input.c: added a prototype controller
|
|
|
|
|
|
module using the linux input event interface.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: added example config for linux input device.
|
|
|
|
|
|
|
2004-06-15 18:59:50 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: load the controller's
|
|
|
|
|
|
properties from the controllerrc file.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: set the wheel's properties.
|
|
|
|
|
|
|
2004-06-15 18:22:57 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* etc/controllerrc: use the 10% actions for opacity.
|
|
|
|
|
|
|
2004-06-15 18:16:52 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.c: ref the actions when putting
|
|
|
|
|
|
them in the mapping table.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/context-actions.c: added actions to change the
|
|
|
|
|
|
opacity in 10% steps.
|
|
|
|
|
|
|
2004-06-15 17:52:28 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.[ch]: added a "name" property.
|
|
|
|
|
|
Dispatch events only if the controller is enabled.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollerwheel.c: added controller events for
|
|
|
|
|
|
all possible modifier combinations.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/Makefile.am
|
|
|
|
|
|
* etc/controllerrc: default controllerrc which maps all unused
|
|
|
|
|
|
wheel+modifier combinations to more-or-less usefull stuff.
|
|
|
|
|
|
|
2004-06-15 15:59:26 -07:00
|
|
|
|
2004-06-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Started to fix bug #106920 in a more genreral way:
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetsmarshal.list
|
|
|
|
|
|
* libgimpwidgets/gimpcontroller.[ch]: new abstract base class
|
|
|
|
|
|
which provides an API for pluggable input controller modules
|
|
|
|
|
|
(mouse wheel, usb/midi stuff etc.).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
|
|
|
|
|
|
which maps wheel mouse scroll events to controller events.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontrollers.[ch]: manager for controllers.
|
|
|
|
|
|
reads $(gimpdir)/controllerrc and keeps a mapping of controller
|
|
|
|
|
|
events to GtkActions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c: initialize and shut down the controller stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
(gimp_display_shell_canvas_tool_events): if a wheel controller
|
|
|
|
|
|
exists, dispatch GdkEventScroll to it first and return if it was
|
|
|
|
|
|
handled.
|
|
|
|
|
|
|
2004-06-15 14:44:19 -07:00
|
|
|
|
2004-06-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API
|
|
|
|
|
|
gimp_text() and gimp_text_get_extents().
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/text_tool_cmds.c
|
|
|
|
|
|
* libgimp/gimptexttool_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
2004-06-15 14:08:14 -07:00
|
|
|
|
2004-06-15 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdbgen.pl
|
|
|
|
|
|
* tools/pdbgen/lib.pl: some simplistic code to add a $deprecated
|
|
|
|
|
|
flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED
|
|
|
|
|
|
guards in lib headers.
|
|
|
|
|
|
|
2004-06-15 08:42:50 -07:00
|
|
|
|
2004-06-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/context-actions.[ch]
|
|
|
|
|
|
* app/actions/context-commands.[ch]: added new action group to
|
|
|
|
|
|
modify all GimpContext properties. So far there are actions to
|
|
|
|
|
|
cycle through the lists of brushes, patterns etc., to change the
|
|
|
|
|
|
opacity, to swap and default colors and to edit generated brushes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c: register the new "context" action group.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tools-actions.c
|
|
|
|
|
|
* app/actions/tools-commands.[ch]: removed "tools-default-colors"
|
|
|
|
|
|
and "tools-swap-colors" actions and callbacks because they are
|
|
|
|
|
|
in the "context" action group now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.c: add the "context" group to the <Image> and
|
|
|
|
|
|
<Dock> UI managers.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: changed accordingly. Added a temporary
|
|
|
|
|
|
"Context" menu to test and debug the new actions.
|
|
|
|
|
|
|
2004-06-15 08:30:36 -07:00
|
|
|
|
2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c (crop_selection_callback): Force
|
|
|
|
|
|
aspect ratio to match selection when 'From Selection' is clicked.
|
|
|
|
|
|
Fixes bug #144361. Also converted tabs to spaces.
|
|
|
|
|
|
|
2004-06-15 04:22:05 -07:00
|
|
|
|
2004-06-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mng.c (respin_cmap): applied the fix for empty
|
|
|
|
|
|
colormaps (bug #143009) here as well.
|
|
|
|
|
|
|
2004-06-15 01:18:13 -07:00
|
|
|
|
2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
2004-06-15 04:22:05 -07:00
|
|
|
|
* app/core/gimpdrawable-transform.c
|
|
|
|
|
|
(gimp_drawable_transform_tiles_affine): Don't round texture
|
|
|
|
|
|
coordinates when not using interpolation. Fixes bug #144352 for
|
|
|
|
|
|
the nearest neighbor case only.
|
2004-06-15 01:18:13 -07:00
|
|
|
|
|
2004-06-14 10:41:53 -07:00
|
|
|
|
2004-06-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpinkoptions.c: replaced some arbitrary values with
|
|
|
|
|
|
larger but still arbitrary values (default and limit for ink size).
|
|
|
|
|
|
|
2004-06-14 08:26:29 -07:00
|
|
|
|
2004-06-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
|
|
|
|
|
|
POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
|
|
|
|
|
|
"gboolean traces_on_window" from GimpPaintCoreClass.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpclone.[ch]
|
|
|
|
|
|
* app/paint/gimpink.c
|
|
|
|
|
|
* app/tools/gimpclonetool.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c: ditto. Show the brush outline
|
|
|
|
|
|
while painting. Fixes bug #118348.
|
|
|
|
|
|
|
2004-06-14 08:13:37 -07:00
|
|
|
|
2004-06-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
|
|
|
|
|
|
instead of GIMP_IS_DISPLAY(draw_tool->gdisp).
|
|
|
|
|
|
|
2004-06-14 07:38:59 -07:00
|
|
|
|
2004-06-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
|
|
|
|
|
|
do the workaround for "" accelerators only if the GTK+ version
|
|
|
|
|
|
is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3.
|
|
|
|
|
|
|
2004-06-14 06:38:31 -07:00
|
|
|
|
2004-06-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.c: declared
|
|
|
|
|
|
gimp_drawable_transform_cubic() as inline function. Makes
|
|
|
|
|
|
sample_cubic() run about 10% faster and causes a 7% speedup on
|
|
|
|
|
|
cubic transformations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.c (border_region): avoid an
|
|
|
|
|
|
unnecessary memory allocation.
|
|
|
|
|
|
|
2004-06-14 06:21:29 -07:00
|
|
|
|
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: Disable preview in corrective
|
|
|
|
|
|
mode, and notify preview when switching transform type and
|
|
|
|
|
|
direction.
|
|
|
|
|
|
|
2004-06-14 05:52:33 -07:00
|
|
|
|
2004-06-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: added new virtual function
|
|
|
|
|
|
GimpPaintCore::post_paint() and call it after calling
|
|
|
|
|
|
GimpPaintCore::paint().
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
|
|
|
|
|
|
to brush_core->main_brush and reset brush_core->brush
|
|
|
|
|
|
to brush_core->main_brush in GimpPaintCore::post_paint().
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.c
|
|
|
|
|
|
* app/paint/gimppaintcore-stroke.c
|
|
|
|
|
|
* app/tools/gimppainttool.c: removed all code which restores
|
|
|
|
|
|
the brush_core's old brush after painting since post_paint()
|
|
|
|
|
|
does this automatically now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpclone.[ch]: moved static variables to the
|
|
|
|
|
|
GimpClone struct.
|
|
|
|
|
|
|
2004-06-14 05:18:30 -07:00
|
|
|
|
2004-06-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs-generic.h (color_pixels): some code
|
|
|
|
|
|
cleanup I did while attempting to optimize this code further.
|
|
|
|
|
|
|
2004-06-14 04:58:49 -07:00
|
|
|
|
2004-06-14 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-run.c: let extensions run synchronously when
|
|
|
|
|
|
called via PDB. Fixes bug #140112.
|
|
|
|
|
|
|
2004-06-14 04:45:45 -07:00
|
|
|
|
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: Preview is now only used for
|
|
|
|
|
|
layer transformations.
|
|
|
|
|
|
|
2004-06-14 03:48:00 -07:00
|
|
|
|
2004-06-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpperspectivetool.c
|
|
|
|
|
|
* app/tools/gimprotatetool.c
|
|
|
|
|
|
* app/tools/gimpscaletool.c
|
|
|
|
|
|
* app/tools/gimpsheartool.c: removed calls to
|
|
|
|
|
|
gimp_transform_tool_expose_preview() from all
|
|
|
|
|
|
GimpTransformTool::motion() implementations...
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: ...and call it after calling
|
|
|
|
|
|
tr_tool_class->preview().
|
|
|
|
|
|
|
2004-06-14 03:19:39 -07:00
|
|
|
|
2004-06-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: remember the last used
|
|
|
|
|
|
GimpCursorFormat so changing the format in prefs applies
|
|
|
|
|
|
instantly, and not after the next tool change.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-cursor.[ch]
|
|
|
|
|
|
* app/tools/gimptool.[ch]
|
|
|
|
|
|
* app/tools/gimptoolcontrol.[ch]
|
|
|
|
|
|
* app/tools/gimpclonetool.c
|
|
|
|
|
|
* app/tools/gimpcolortool.c
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c
|
|
|
|
|
|
* app/tools/gimpmovetool.c
|
|
|
|
|
|
* app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g
|
|
|
|
|
|
|
2004-06-14 02:06:28 -07:00
|
|
|
|
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
|
|
|
|
|
|
wasn't being turned off before performing a transformation. Also
|
|
|
|
|
|
converted tabs to spaces.
|
|
|
|
|
|
|
2004-06-13 22:13:21 -07:00
|
|
|
|
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-preview.c: Transformation previews now
|
|
|
|
|
|
use the selection mask if it is present.
|
|
|
|
|
|
|
2004-06-13 19:34:46 -07:00
|
|
|
|
2004-06-13 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Make sure PangoFT2 is using a recent enough fontconfig
|
|
|
|
|
|
since many people have broken and confused setups.
|
|
|
|
|
|
|
2004-06-13 18:01:39 -07:00
|
|
|
|
2004-06-13 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated
|
|
|
|
|
|
output doesn't warn about uninitialize variable use, and whitespace
|
|
|
|
|
|
cosmetic cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradient_edit_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-06-13 17:52:38 -07:00
|
|
|
|
2004-06-13 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/cpu-accel.c: Reorged, to address bug #142907 and
|
|
|
|
|
|
bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel()
|
|
|
|
|
|
keys on that. Both PPC and X86 implementations check for __GNUC__.
|
|
|
|
|
|
X86 stuff is only used with USE_MMX is defined. The SSE OS check
|
|
|
|
|
|
is now checked in arch_accel(), not cpu_accel(). Finally, the
|
|
|
|
|
|
arch x86_64 checks now are EM64T aware (which didn't matter in
|
|
|
|
|
|
practice).
|
|
|
|
|
|
|
2004-06-13 08:22:51 -07:00
|
|
|
|
2004-06-13 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds()
|
|
|
|
|
|
for texture coordinates instead of the drawable's width and height.
|
|
|
|
|
|
|
2004-06-13 06:19:19 -07:00
|
|
|
|
2004-06-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.c (shapeburst_region): don't call
|
|
|
|
|
|
tile_ewidth() three times from the inner loop.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/tile-manager.c (tile_manager_get): don't call
|
|
|
|
|
|
tile_size() twice on the same tile.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/tile-private.h: added tile_size_inline(), an inline
|
|
|
|
|
|
version of the tile_size() function.
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/tile-cache.c
|
|
|
|
|
|
* app/base/tile-manager.c
|
|
|
|
|
|
* app/base/tile-swap.c
|
|
|
|
|
|
* app/base/tile.c: use tile_size_inline() from inside the tile
|
|
|
|
|
|
subsystem.
|
|
|
|
|
|
|
2004-06-13 05:48:40 -07:00
|
|
|
|
2004-06-13 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
|
|
|
|
|
|
Shouldn't change anything.
|
|
|
|
|
|
|
2004-06-13 04:27:36 -07:00
|
|
|
|
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/tool-zoom.png:
|
|
|
|
|
|
* cursors/cursor-zoom.png: minor fsckup
|
|
|
|
|
|
|
2004-06-13 04:17:43 -07:00
|
|
|
|
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/gimp-tool-cursors.xcf
|
|
|
|
|
|
* cursors/tool-burn.png: the burn tool doesn't really have an
|
|
|
|
|
|
inverted handle
|
|
|
|
|
|
|
2004-06-13 03:52:42 -07:00
|
|
|
|
2004-06-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added
|
|
|
|
|
|
progress callback.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-blend.c: show a progress while calculating
|
|
|
|
|
|
the Shapeburst. Not perfect but better than not showing any
|
|
|
|
|
|
progress at all.
|
|
|
|
|
|
|
2004-06-12 19:08:54 -07:00
|
|
|
|
2004-06-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
|
|
|
|
|
|
which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
|
|
|
|
|
|
work around broken X servers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpguiconfig.[ch]
|
|
|
|
|
|
* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added a GUI for the new option.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.[ch]: added cursor_format parameter
|
|
|
|
|
|
to gimp_cursor_new() and _set().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-cursor.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
|
|
|
|
|
|
|
2004-06-12 18:57:26 -07:00
|
|
|
|
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-blend.c: added missing semicolon.
|
|
|
|
|
|
|
2004-06-12 18:37:29 -07:00
|
|
|
|
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
|
|
|
|
|
|
caused perfect-but-slow pointer tracking to be used in tools that
|
|
|
|
|
|
don't request exact mode.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/Makefile.am:
|
|
|
|
|
|
* app/display/gimpdisplayshell-appearance.[ch]:
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c:
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]:
|
|
|
|
|
|
* app/display/gimpdisplayshell-preview.[ch]: added
|
|
|
|
|
|
* app/tools/gimpperspectivetool.c:
|
|
|
|
|
|
* app/tools/gimprotatetool.c:
|
|
|
|
|
|
* app/tools/gimpscaletool.c:
|
|
|
|
|
|
* app/tools/gimpsheartool.c:
|
|
|
|
|
|
* app/tools/gimptransformoptions.[ch]:
|
|
|
|
|
|
* app/tools/gimptransformtool.[ch]: Implemented live transformation
|
|
|
|
|
|
previews, available through tool options. Fixes bug #108172.
|
|
|
|
|
|
|
2004-06-12 18:17:57 -07:00
|
|
|
|
2004-06-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-blend.c (gradient_render_pixel): inline
|
|
|
|
|
|
the repeat functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient.c: inline the curve functions.
|
|
|
|
|
|
|
2004-06-12 17:32:59 -07:00
|
|
|
|
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/gimp-tool-cursors.xcf
|
|
|
|
|
|
* cursors/tool-zoom.png: make more transparent
|
|
|
|
|
|
|
2004-06-12 16:55:03 -07:00
|
|
|
|
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/gimp-tool-cursors.xcf
|
|
|
|
|
|
* cursors/tool-blur.png
|
|
|
|
|
|
* cursors/tool-bucket-fill.png
|
|
|
|
|
|
* cursors/tool-dodge.png
|
|
|
|
|
|
* cursors/tool-eraser.png
|
|
|
|
|
|
* cursors/tool-hand.png: fix a few problems hidden by low opacity
|
|
|
|
|
|
|
2004-06-12 16:01:25 -07:00
|
|
|
|
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* cursor/*png: updated the cursors
|
|
|
|
|
|
|
2004-06-12 15:41:22 -07:00
|
|
|
|
2004-06-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/gimp-tool-cursors.xcf: added nice new antialiased
|
|
|
|
|
|
cursor layers made by Jimmac.
|
|
|
|
|
|
|
2004-06-12 15:28:13 -07:00
|
|
|
|
2004-06-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimppalette.c (gimp_palette_load): don't use the rather
|
|
|
|
|
|
inefficient gimp_palette_add_entry() when loading a palette.
|
|
|
|
|
|
|
2004-06-12 15:13:31 -07:00
|
|
|
|
2004-06-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdata.[ch]: added "gint freeze_count" and
|
|
|
|
|
|
gimp_data_freeze()/thaw() functions. Emit "dirty" only if
|
|
|
|
|
|
freeze_count either is 0 or drops to 0.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpbrushgenerated.[ch]
|
|
|
|
|
|
* app/core/gimpgradient.[ch]: removed freeze/thaw stuff that
|
|
|
|
|
|
was duplicated in these two subclasses and use the new
|
|
|
|
|
|
GimpData API instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-12 13:26:16 -07:00
|
|
|
|
2004-06-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy
|
|
|
|
|
|
the first row onto itself.
|
|
|
|
|
|
|
2004-06-12 13:10:40 -07:00
|
|
|
|
2004-06-12 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: Make Enter/Return apply the
|
|
|
|
|
|
transformation, Backspace/Delete resets the transformation.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c: Simplify the key_press callback.
|
|
|
|
|
|
|
2004-06-12 12:29:50 -07:00
|
|
|
|
2004-06-12 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c: Make the Enter/Return key do
|
|
|
|
|
|
the crop action.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
* app/tools/gimpvectortool.c: Make the _key_press functions
|
|
|
|
|
|
safe for non-arrow keys.
|
|
|
|
|
|
|
2004-06-12 12:23:45 -07:00
|
|
|
|
2004-06-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/composite/gimp-composite.[ch]: just some cleanup.
|
|
|
|
|
|
|
2004-06-12 11:50:44 -07:00
|
|
|
|
2004-06-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
(gimp_display_shell_events): ported some forgotten #if 0'ed
|
|
|
|
|
|
GtkItemFactory stuff to GtkUIManager.
|
|
|
|
|
|
|
2004-06-12 11:41:52 -07:00
|
|
|
|
2004-06-12 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptool.[ch]: renamed the "arrow_key" member
|
|
|
|
|
|
to "key_press", since it is now no longer about just the arrow
|
|
|
|
|
|
keys.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.h
|
|
|
|
|
|
* app/tools/gimpmovetool.c
|
|
|
|
|
|
* app/tools/gimppainttool.c
|
|
|
|
|
|
* app/tools/gimpselectiontool.c
|
|
|
|
|
|
* app/tools/gimptexttool.c
|
|
|
|
|
|
* app/tools/gimpvectortool.c
|
|
|
|
|
|
* app/tools/tool_manager.c: Changed accordingly.
|
|
|
|
|
|
|
2004-06-12 11:31:49 -07:00
|
|
|
|
2004-06-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_init): add
|
|
|
|
|
|
the file DND destination before all others so the DND code will
|
|
|
|
|
|
implicitly use its destination properties. Works around Konqueror
|
|
|
|
|
|
offering only file MOVE, not COPY and fixes bug #144168.
|
|
|
|
|
|
|
2004-06-12 11:23:16 -07:00
|
|
|
|
2004-06-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sample_colorize.c: reindented, some minor cleanup.
|
|
|
|
|
|
|
2004-06-12 11:03:48 -07:00
|
|
|
|
2004-06-12 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/tool_manager.[ch]: renamed
|
|
|
|
|
|
tool_manager_arrow_key_active to tool_manager_key_press_active.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c: Also dispatch
|
2004-06-12 11:08:30 -07:00
|
|
|
|
GDK_Return/KP_Enter/BackSpace/Delete to the tools, the
|
|
|
|
|
|
"arrow_key" member of GimpTool probably should be renamed.
|
2004-06-12 11:03:48 -07:00
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpvectortool.c: Use Enter/Return to convert the
|
|
|
|
|
|
current path to a selection, use Backspace/Delete to delete the
|
|
|
|
|
|
currently active anchors in a path.
|
|
|
|
|
|
|
2004-06-13 05:10:01 -07:00
|
|
|
|
Implemented on Jimmacs request - thanks to him and Iva for being
|
|
|
|
|
|
a great host :)
|
2004-06-12 11:03:48 -07:00
|
|
|
|
|
2004-06-12 10:30:28 -07:00
|
|
|
|
2004-06-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init):
|
|
|
|
|
|
set the initially selected channel on the histogram combobox.
|
|
|
|
|
|
Fixes bug #144225.
|
|
|
|
|
|
|
2004-06-12 05:44:24 -07:00
|
|
|
|
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
|
|
|
|
|
|
variables to "pressure-hardness".
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpairbrush.c:
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c: changed accordingly.
|
|
|
|
|
|
|
2004-06-10 09:02:30 -07:00
|
|
|
|
2004-06-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpcolorarea.c: replaced destroy() by
|
|
|
|
|
|
finalize(), converted tabs to spaces, cleanup.
|
|
|
|
|
|
|
2004-06-10 09:00:53 -07:00
|
|
|
|
2004-06-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the
|
|
|
|
|
|
filename label if it's too long instead of cutting it off.
|
|
|
|
|
|
|
2004-06-10 07:43:08 -07:00
|
|
|
|
2004-06-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.h (enum GimpCursorModifier):
|
|
|
|
|
|
s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.c: changed accordingly. Renamed struct
|
|
|
|
|
|
GimpBitmapCursor to GimpCursor. More cleanup.
|
|
|
|
|
|
|
2004-06-10 07:25:04 -07:00
|
|
|
|
2004-06-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-actions.c
|
|
|
|
|
|
* app/actions/image-commands.[ch]
|
|
|
|
|
|
* app/actions/layers-actions.c
|
|
|
|
|
|
* app/actions/layers-commands.[ch]: made the
|
|
|
|
|
|
"image-convert-rgb/grayscale/indexed" and the
|
|
|
|
|
|
"layers-mask-apply/delete" actions GimpEnumActions and merged
|
|
|
|
|
|
their callbacks.
|
|
|
|
|
|
|
2004-06-10 04:24:36 -07:00
|
|
|
|
2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: restored the 'Show Paint Tool
|
2004-06-10 07:25:04 -07:00
|
|
|
|
Cursor' option that was removed during clean-up.
|
2004-06-10 04:24:36 -07:00
|
|
|
|
|
2004-06-09 19:53:19 -07:00
|
|
|
|
2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask):
|
|
|
|
|
|
avoided some redundant calculations.
|
|
|
|
|
|
|
2004-06-09 16:51:06 -07:00
|
|
|
|
2004-06-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/user-install-dialog.c: removed the monitor calibration
|
|
|
|
|
|
from the user installation process. It's not a vital setting and
|
|
|
|
|
|
can be done from the Preferences dialog later.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/resolution-calibrate-dialog.[ch]: simplified the
|
|
|
|
|
|
resolution calibration dialog by removing the hacks that were
|
|
|
|
|
|
needed for drawing it in the user-installation style.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: changed accordingly. Also removed
|
|
|
|
|
|
the separator from the Display page.
|
|
|
|
|
|
|
2004-06-09 15:37:49 -07:00
|
|
|
|
2004-06-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.[ch]: added an API to
|
|
|
|
|
|
expand/collapse the "Advanced Options" frame.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: applied a patch done by William
|
|
|
|
|
|
Skaggs that cleans up and reorganizes the Preferences dialog
|
|
|
|
|
|
(bug #144060).
|
|
|
|
|
|
|
2004-06-09 05:44:13 -07:00
|
|
|
|
2004-06-09 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to
|
|
|
|
|
|
gimp_coords_length_squared.
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.c: Changed accordingly
|
|
|
|
|
|
|
2004-06-09 05:14:55 -07:00
|
|
|
|
2004-06-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-06-09 05:23:00 -07:00
|
|
|
|
* app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to
|
2004-06-09 05:14:55 -07:00
|
|
|
|
request GIMP_MOTION_MODE_EXACT here since the parent class does
|
|
|
|
|
|
that already.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
|
|
|
|
|
|
color picker feature for the ink tool.
|
|
|
|
|
|
|
2004-06-08 16:07:45 -07:00
|
|
|
|
2004-06-09 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-06-08 17:31:04 -07:00
|
|
|
|
* menus/image-menu.xml.in: added "Selection Editor" to the
|
|
|
|
|
|
Selection menu. Still hoping for the great menu reorganization
|
|
|
|
|
|
though...
|
|
|
|
|
|
|
2004-06-08 16:07:45 -07:00
|
|
|
|
* app/actions/select-actions.c (select_actions_update): "Save to
|
|
|
|
|
|
Channel" makes sense without a selection also, so don't set it
|
|
|
|
|
|
insensitive.
|
|
|
|
|
|
|
2004-06-07 11:47:59 -07:00
|
|
|
|
2004-06-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/glob.c: the glob(3) function is not available on
|
|
|
|
|
|
Win32 and also isn't necessarily UTF-8 safe. Started to add an
|
|
|
|
|
|
alternative implementation. Right now there's just some code taken
|
|
|
|
|
|
from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in
|
|
|
|
|
|
does nothing useful. I will add some stripped-down glob code based
|
|
|
|
|
|
on the code in glibc later.
|
|
|
|
|
|
|
2004-06-07 08:13:54 -07:00
|
|
|
|
2004-06-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayer.c (gimp_layer_set_tiles): don't set
|
|
|
|
|
|
layer->mask's offsets. It is wrong because GimpDrawable::set_tiles()
|
|
|
|
|
|
is a lowlevel function which is used by stuff like scale and
|
|
|
|
|
|
resize which keep the mask in sync explicitely and don't expect it
|
|
|
|
|
|
to be moved in the middle of chaining up. Fixes bug #143860.
|
|
|
|
|
|
|
2004-06-07 07:04:50 -07:00
|
|
|
|
2004-06-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/view-actions.c
|
|
|
|
|
|
* app/actions/view-commands.[ch]: added separate callback for
|
|
|
|
|
|
"view-zoom-other" and connect GtkAction::activate manually so
|
|
|
|
|
|
"Other..." can be selected even if it's the active item in the
|
|
|
|
|
|
zoom radio group. Fixes bug #143850.
|
|
|
|
|
|
|
2004-06-07 04:24:28 -07:00
|
|
|
|
2004-06-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tileit.c (tileit_dialog): fixed a typo.
|
|
|
|
|
|
|
2004-06-07 03:45:05 -07:00
|
|
|
|
2004-06-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus
|
|
|
|
|
|
by the translated menu path stripped from underscores.
|
|
|
|
|
|
|
2004-06-06 08:42:57 -07:00
|
|
|
|
2004-06-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug
|
|
|
|
|
|
I introduced yesterday.
|
|
|
|
|
|
|
2004-06-06 04:07:08 -07:00
|
|
|
|
2004-06-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss.c (query): register the menu entry the new
|
|
|
|
|
|
way and install a mnemonic for Gaussian Blur.
|
|
|
|
|
|
|
2004-06-05 12:22:46 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/curve_bend.c: applied a patch from Henrik Brix
|
|
|
|
|
|
Andersen that tells the user that Curve Bend cannot operate on
|
|
|
|
|
|
layers with masks instead of silently applying the mask
|
|
|
|
|
|
(bug #134748).
|
|
|
|
|
|
|
2004-06-05 12:13:36 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl
|
|
|
|
|
|
* plug-ins/common/Makefile.am
|
|
|
|
|
|
* plug-ins/common/gauss_iir.c
|
|
|
|
|
|
* plug-ins/common/gauss_rle.c: removed the two gaussian blur
|
|
|
|
|
|
plug-ins...
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss.c: and added a merged version done by
|
|
|
|
|
|
William Skaggs. Fixes bug #134088.
|
|
|
|
|
|
|
2004-06-05 11:46:05 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that
|
|
|
|
|
|
makes the plug-in handle images with more than 4 channels. At the
|
|
|
|
|
|
moment the extra information is discarded (bug #143673).
|
|
|
|
|
|
|
2004-06-05 10:13:21 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/unsharp.c: applied a modified patch from Geert
|
|
|
|
|
|
Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes
|
|
|
|
|
|
bug #140974.
|
|
|
|
|
|
|
2004-06-05 09:21:41 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.c
|
|
|
|
|
|
* app/paint-funcs/paint-funcs-generic.h
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip
|
|
|
|
|
|
Lafleur that changes the way that paint is applied during a paint
|
|
|
|
|
|
stroke. Fixes bug #124225.
|
|
|
|
|
|
|
2004-06-05 07:35:43 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl
|
|
|
|
|
|
* plug-ins/common/glob.c: added a simple glob plug-in based on
|
|
|
|
|
|
some old code by George Hartz. This plug-in is very useful when
|
|
|
|
|
|
you need to do batch processing, especially from Script-Fu.
|
|
|
|
|
|
Fixes bug #143661.
|
|
|
|
|
|
|
2004-06-05 04:14:38 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c: applied a patch from David
|
|
|
|
|
|
Gowers that makes the gradient editor display the perceptual
|
|
|
|
|
|
intensity of the color under the cursor (bug #135037).
|
|
|
|
|
|
|
2004-06-05 03:52:47 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/snoise.c: applied a modifed patch from Yeti that
|
|
|
|
|
|
adds a preview to the Solid Noise plug-in (bug #142587).
|
|
|
|
|
|
|
2004-06-05 03:27:47 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tiff.c: save the proper value for type of alpha
|
|
|
|
|
|
channel. Fixes bug #143522; patch by Philip Lafleur.
|
|
|
|
|
|
|
2004-06-05 00:22:04 -07:00
|
|
|
|
2004-06-05 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c (prefs_dialog_new): update call
|
|
|
|
|
|
to prefs_spin_button_add for num-processors too.
|
|
|
|
|
|
|
2004-06-04 18:51:49 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c (script_fu_interface):
|
|
|
|
|
|
left align toggle buttons.
|
|
|
|
|
|
|
2004-06-04 16:42:05 -07:00
|
|
|
|
2004-06-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextlayer-transform.[ch]: updated the (still unused)
|
2004-06-04 18:52:17 -07:00
|
|
|
|
text transformation code.
|
2004-06-04 16:42:05 -07:00
|
|
|
|
|
|
|
|
|
|
* app/text/gimptext-bitmap.c: removed a redundant transformation.
|
|
|
|
|
|
|
2004-06-04 16:08:29 -07:00
|
|
|
|
2004-06-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/Makefile.am
|
|
|
|
|
|
* cursors/cursor-none.png
|
|
|
|
|
|
* cursors/xbm/cursor-none.xbm: new empty cursor images.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpdisplayconfig.[ch]
|
|
|
|
|
|
* app/config/gimprc-blurbs.h
|
|
|
|
|
|
* app/widgets/widgets-enums.h
|
|
|
|
|
|
* app/widgets/gimpcursor.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-cursor.c
|
|
|
|
|
|
* app/tools/gimppainttool.[ch]
|
|
|
|
|
|
* app/tools/gimpinktool.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c: applied patches from Philip
|
|
|
|
|
|
Lafleur which implement hiding the cursor completely for paint
|
|
|
|
|
|
tools. Changed the name of the config option from
|
|
|
|
|
|
"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
|
|
|
|
|
|
to TRUE because this needs the brush outline being visible while
|
|
|
|
|
|
painting to be really usable. Fixes bug #132163.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.h: renamed all GimpCursorType and
|
|
|
|
|
|
GimpToolCursorType enum values to GIMP_CURSOR_* and
|
|
|
|
|
|
GIMP_TOOL_CURSOR_*.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-cursor.c
|
|
|
|
|
|
* app/tools/gimp*tool.c; changed accordingly.
|
|
|
|
|
|
|
2004-06-04 12:03:49 -07:00
|
|
|
|
2004-06-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.c: changed create_cursor_foo() utility
|
|
|
|
|
|
functions to get_cursor_foo() and use them as accessors instead of
|
|
|
|
|
|
using cursor->member. Use gdk_pixbuf_copy() instead of compositing
|
|
|
|
|
|
the initial image onto an empty pixbuf.
|
|
|
|
|
|
|
2004-06-04 11:17:50 -07:00
|
|
|
|
2004-06-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptexteditor.c (gimp_text_editor_new): set the
|
|
|
|
|
|
focus on the text area.
|
|
|
|
|
|
|
2004-06-04 10:51:32 -07:00
|
|
|
|
2004-06-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
|
|
|
|
|
|
move a text layer using the cursor keys.
|
|
|
|
|
|
|
2004-06-04 05:10:13 -07:00
|
|
|
|
2004-06-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/*.xbm: removed...
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/xbm/*.xbm: ...and added here instead. Renamed them
|
|
|
|
|
|
all to match the PNG file names.
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/Makefile.am: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widget/gimpcursor.c: ditto. Merged the two cursor creating
|
|
|
|
|
|
functions again because they duplicated too much code.
|
|
|
|
|
|
|
2004-06-04 04:47:15 -07:00
|
|
|
|
2004-06-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/plug-in-menus.c (plug_in_menus_setup): populate the
|
|
|
|
|
|
tree with collation keys and use strcmp() instead of
|
|
|
|
|
|
g_utf8_collate() as the tree's sort function.
|
|
|
|
|
|
|
2004-06-04 02:47:06 -07:00
|
|
|
|
2004-06-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE):
|
|
|
|
|
|
applied a patch by Philip Lafleur that changes the default to
|
|
|
|
|
|
FALSE. Fixes bug #143626.
|
|
|
|
|
|
|
2004-06-03 09:36:52 -07:00
|
|
|
|
2004-06-03 Michael Natterer <mitch@gimpmp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use
|
|
|
|
|
|
gtk_widget_size_request() instead of _get_child_requisition()
|
|
|
|
|
|
because we need to know the size of the toolbox' areas
|
|
|
|
|
|
even if they are invisible. Fixes SIGFPE spotted by Jimmac.
|
|
|
|
|
|
|
2004-06-03 07:03:54 -07:00
|
|
|
|
2004-06-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor
|
|
|
|
|
|
and cursor_modifier components slightly transparent.
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/cursor-mouse.png: was the wrong image.
|
|
|
|
|
|
|
2004-06-03 05:36:02 -07:00
|
|
|
|
2004-06-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/Makefile.am
|
|
|
|
|
|
* cursors/*.png: added PNG version of all cursors.
|
|
|
|
|
|
|
|
|
|
|
|
* cursors/gimp-tool-cursors.xcf: reordered and renamed all layers
|
|
|
|
|
|
to match the new PNG filenames.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcursor.[ch]: create cursors with alpha and color
|
|
|
|
|
|
if the GdkDisplay supports it. Fall back to the old stuff
|
|
|
|
|
|
otherwise.
|
|
|
|
|
|
|
2004-06-03 05:01:17 -07:00
|
|
|
|
2004-06-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is
|
|
|
|
|
|
set, use that as the pattern name.
|
|
|
|
|
|
|
2004-06-03 04:34:51 -07:00
|
|
|
|
2004-06-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
|
|
|
|
|
|
removed commented-out message.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimppattern.[ch]: fixed handling of errors and PNG
|
|
|
|
|
|
comments in new pattern loader. Renamed functions for consistency
|
|
|
|
|
|
with other data loaders.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c: changed accordingly.
|
|
|
|
|
|
|
Add support for GdkPixbuf patterns, so now all of png, jpex, pnm, xbm,
2004-06-03 Dave Neary <bolsh@gimp.org>
* app/core/gimp.c:
* app/core/gimpdatafactory.c:
* app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns,
so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga,
xpm and tiff can be used for patterns.
2004-06-03 04:03:53 -07:00
|
|
|
|
2004-06-03 Dave Neary <bolsh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c:
|
|
|
|
|
|
* app/core/gimpdatafactory.c:
|
|
|
|
|
|
* app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns,
|
|
|
|
|
|
so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga,
|
|
|
|
|
|
xpm and tiff can be used for patterns.
|
|
|
|
|
|
|
2004-06-03 02:47:05 -07:00
|
|
|
|
2004-06-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/vectors-actions.c: added alternative actions
|
|
|
|
|
|
"vectors-selection-from-vectors" and
|
|
|
|
|
|
"vectors-selection-to-vectors-short" with different labels suited
|
|
|
|
|
|
for the "Select" menu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-actions.c: removed "select-from-vectors"
|
|
|
|
|
|
and "select-to-vectors" (to vectors was crashing anyway).
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-commands.[ch]: removed
|
|
|
|
|
|
select_from_vectors_cmd_callback(). Fixes code dupliction.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in
|
|
|
|
|
|
* menus/selection-editor-menu.xml: changed accordingly.
|
|
|
|
|
|
|
2004-06-02 15:50:15 -07:00
|
|
|
|
2004-06-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c (control_motion): use the newly
|
|
|
|
|
|
added GimpGradient API to set the segment's handles instead of
|
|
|
|
|
|
setting the values directly. Dirties the gradient correctly and
|
|
|
|
|
|
makes the preview update instantly again. Fixes bug #143605.
|
|
|
|
|
|
|
2004-06-02 15:08:34 -07:00
|
|
|
|
2004-06-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c
|
|
|
|
|
|
(file_open_location_completion): check for NULL pointer before
|
|
|
|
|
|
passing it to g_utf8_normalize(). Just a workaround for a problem
|
|
|
|
|
|
in GimpContainerView.
|
|
|
|
|
|
|
2004-06-02 14:29:13 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* INSTALL: more updates.
|
|
|
|
|
|
|
2004-06-02 11:57:57 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Made 2.1.0 development release.
|
|
|
|
|
|
|
2004-06-02 10:56:02 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-scale.c
|
|
|
|
|
|
* app/gui/info-window.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/gui/resize-dialog.c
|
|
|
|
|
|
* app/tools/gimpcolorbalancetool.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimphuesaturationtool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c
|
|
|
|
|
|
* app/tools/gimpthresholdtool.c
|
|
|
|
|
|
* app/widgets/gimpdockable.c
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimphistogrambox.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
|
|
|
|
|
|
consistency and better HIG compliance.
|
|
|
|
|
|
|
2004-06-02 10:45:56 -07:00
|
|
|
|
2004-06-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb: set_blending_function() and
|
|
|
|
|
|
set_coloring_type() work on segment ranges, renamed them
|
|
|
|
|
|
accordingly. Spotted by Shlomi Fish.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradient_edit_cmds.c
|
|
|
|
|
|
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
2004-06-02 10:35:55 -07:00
|
|
|
|
2004-06-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.[ch]: removed utility funtion
|
|
|
|
|
|
gimp_dnd_open_files().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox-dnd.c: added gimp_toolbox_drop_files()
|
|
|
|
|
|
instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_files):
|
|
|
|
|
|
show the error message if opening a dropped file fails.
|
|
|
|
|
|
|
2004-06-02 10:13:26 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpthumb/gimpthumbnail.c: plugged a small memory leak.
|
|
|
|
|
|
|
2004-06-02 09:56:00 -07:00
|
|
|
|
2004-06-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.h: removed enum GimpDndType...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.h: ...and added it here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.c: added more g_return_if_fail(). Allow
|
|
|
|
|
|
all gimp_dnd_foo_dest_add() functions to be called without
|
|
|
|
|
|
callback (just add the target if callback is NULL).
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_dnd_open_files): removed the checks for validity of the
|
|
|
|
|
|
passed filenames/uris...
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_dnd_set_file_data): ...and added it here so all callbacks
|
|
|
|
|
|
get an already sanitized list of strings.
|
|
|
|
|
|
|
2004-06-02 07:00:39 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am (EXTRA_DIST)
|
|
|
|
|
|
* app/menus/Makefile.am (EXTRA_DIST): removed makefile.msc until
|
|
|
|
|
|
they have been added.
|
|
|
|
|
|
|
2004-06-02 05:49:16 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerview.c: create the hash table when
|
|
|
|
|
|
inserting items; removes redundant create/destroy cycles and plugs
|
|
|
|
|
|
a memory leak.
|
|
|
|
|
|
|
2004-06-02 04:09:31 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* INSTALL: updated for gimp-2.1. Suggest to use gimp-print
|
2004-06-02 04:11:29 -07:00
|
|
|
|
version 4.2.7-pre1 in case of problems (see bug #138273).
|
2004-06-02 04:09:31 -07:00
|
|
|
|
|
2004-06-01 16:49:50 -07:00
|
|
|
|
2004-06-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.c
|
|
|
|
|
|
(gimp_display_shell_drop_files): copy the merged layer, not the
|
|
|
|
|
|
first one. Preserve the type of the layer to make e.g. dropping an
|
|
|
|
|
|
XCF with a single text layer work.
|
|
|
|
|
|
|
2004-06-01 16:25:53 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* NEWS
|
|
|
|
|
|
* README: updated.
|
|
|
|
|
|
|
2004-06-01 16:14:28 -07:00
|
|
|
|
2004-06-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_init): accept
|
|
|
|
|
|
file/uri drops.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-dnd.[ch]
|
|
|
|
|
|
(gimp_display_shell_drop_files): open any kind of image and turn
|
|
|
|
|
|
it into a single layer which is added to the image (suggested by
|
|
|
|
|
|
Antenne Springborn).
|
|
|
|
|
|
|
2004-06-01 15:50:37 -07:00
|
|
|
|
2004-06-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/gradients.pdb: mark new API as new using $since.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpgradientedit_pdb.c
|
|
|
|
|
|
* libgimp/gimpgradients_pdb.c: regenerated.
|
|
|
|
|
|
|
2004-06-01 15:16:54 -07:00
|
|
|
|
2004-06-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb: forgot two more s/int32/enum/.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradient_edit_cmds.c
|
|
|
|
|
|
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
2004-06-01 15:04:20 -07:00
|
|
|
|
2004-06-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb
|
|
|
|
|
|
* app/pdb/image_cmds.c
|
|
|
|
|
|
* app/core/gimpimage.[ch]: reverted changes I did to the image
|
|
|
|
|
|
unit earlier. As in 2.0, it will continue to not accept pixels.
|
|
|
|
|
|
This makes the PDB API and the XCF format compatible again and
|
|
|
|
|
|
fixes bug #142961 (and to some extent bug #137704).
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/gimpimage-unit.[ch]: removed these files. The
|
|
|
|
|
|
convenience accessors defined here aren't commonly used any
|
|
|
|
|
|
longer.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: added a unit parameter to
|
|
|
|
|
|
gimp_display_new(). Made "unit" and "scale" properties of
|
|
|
|
|
|
GimpDisplayShell.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/images-commands.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/select-commands.c
|
|
|
|
|
|
* app/actions/view-commands.c
|
|
|
|
|
|
* app/core/gimp-edit.c
|
|
|
|
|
|
* app/core/gimp.[ch]
|
|
|
|
|
|
* app/core/gimptemplate.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-scale.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-title.c
|
|
|
|
|
|
* app/display/gimpstatusbar.c
|
|
|
|
|
|
* app/file/file-open.c
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/gui/info-window.c
|
|
|
|
|
|
* app/gui/offset-dialog.c
|
|
|
|
|
|
* app/gui/resize-dialog.[ch]
|
|
|
|
|
|
* app/pdb/display_cmds.c
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c
|
|
|
|
|
|
* app/tools/gimppainttool.c
|
|
|
|
|
|
* app/tools/gimprectselecttool.c
|
|
|
|
|
|
* app/tools/gimprotatetool.c
|
|
|
|
|
|
* app/tools/gimpscaletool.c
|
|
|
|
|
|
* app/vectors/gimpvectors-export.c
|
|
|
|
|
|
* app/widgets/gimptoolbox-dnd.c
|
|
|
|
|
|
* tools/pdbgen/pdb/display.pdb: changed accordingly. Use the
|
|
|
|
|
|
display unit where the image unit was used before.
|
|
|
|
|
|
|
2004-06-01 14:58:08 -07:00
|
|
|
|
2004-06-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb: use enums instead of
|
|
|
|
|
|
integers, cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradient_edit_cmds.c
|
|
|
|
|
|
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
2004-06-01 14:37:36 -07:00
|
|
|
|
2004-06-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatafactory.[ch]: added new function
|
|
|
|
|
|
gimp_data_factory_data_delete().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/data-commands.c (data_delete_callback): use it.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/gradients.pdb: applied (slightly modified)
|
|
|
|
|
|
patch from Shlomi Fish which adds PDB wrappers to create, delete,
|
2004-06-01 15:08:19 -07:00
|
|
|
|
duplicate and rename gradients. Fixes bug #143528.
|
2004-06-01 14:37:36 -07:00
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradients_cmds.c
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* libgimp/gimpgradients_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
2004-06-01 11:49:50 -07:00
|
|
|
|
2004-06-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.h: renamed the values of the
|
|
|
|
|
|
GimpGradientSegment* enums from GIMP_GRAD_* to
|
|
|
|
|
|
GIMP_GRADIENT_SEGMENT_* because they are exported now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-gradients.c
|
|
|
|
|
|
* app/core/gimpgradient.c
|
|
|
|
|
|
* app/actions/gradient-editor-actions.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpenums.h
|
|
|
|
|
|
* plug-ins/pygimp/gimpenums.py
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-constants.c
|
|
|
|
|
|
* tools/pdbgen/enums.pl: regenerated.
|
|
|
|
|
|
|
2004-06-01 10:15:56 -07:00
|
|
|
|
2004-06-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tiff.c: don't call gtk_entry_set_text() with a
|
|
|
|
|
|
NULL text.
|
|
|
|
|
|
|
2004-06-01 08:14:45 -07:00
|
|
|
|
2004-06-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c: some cleanup in the tree view
|
|
|
|
|
|
DND code.
|
|
|
|
|
|
|
2004-06-01 05:31:44 -07:00
|
|
|
|
2004-06-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.c (gimp_session_info_restore): added
|
|
|
|
|
|
a horrible hack that sets the paned's position after the first
|
|
|
|
|
|
"size-allocate" after "map". Makes position remembering work for
|
|
|
|
|
|
the toolbox and fixes bug #142697.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.[ch]: added new function
|
|
|
|
|
|
gimp_dockable_set_tab_style()
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dockable-commands.c (dockable_tab_style_cmd_callback)
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.c (gimp_session_info_restore):
|
|
|
|
|
|
use gimp_dockable_set_tab_style().
|
|
|
|
|
|
|
2004-06-01 05:25:48 -07:00
|
|
|
|
2004-06-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c (toolbox_area_notify): removed
|
|
|
|
|
|
unused variable.
|
|
|
|
|
|
|
2004-06-01 03:45:15 -07:00
|
|
|
|
2004-06-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/autocrop.c (query): register as "Autocrop Image"
|
|
|
|
|
|
and "Autocrop Layer".
|
|
|
|
|
|
|
2004-06-01 01:41:28 -07:00
|
|
|
|
2004-06-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.c (image_new_cmd_callback):
|
|
|
|
|
|
initialize the dialog by calling file_new_dialog_set(). Fixes bug
|
|
|
|
|
|
#143477.
|
|
|
|
|
|
|
2004-05-31 13:44:18 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerentry.[ch]: export the column enum.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-location-dialog.c: use a GimpContainerEntry
|
|
|
|
|
|
on the documents list. Use a custom match function that matches
|
|
|
|
|
|
without the leading protocol part.
|
|
|
|
|
|
|
2004-05-31 13:30:52 -07:00
|
|
|
|
2004-05-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which
|
|
|
|
|
|
shows the active image.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpguiconfig.[ch]
|
|
|
|
|
|
* app/config/gimprc-blurbs.h: added config options to control the
|
|
|
|
|
|
visibility of the toolbox' color, indicator and image areas.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.[ch]: added the image area and honor the
|
|
|
|
|
|
new config options. Put the various areas into their own wrap box.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox-dnd.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: added a help ID for the image area.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox-indicator-area.c: made the previews
|
|
|
|
|
|
a bit larger, cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for
|
|
|
|
|
|
the new config options.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/images/preferences/Makefile.am
|
|
|
|
|
|
* themes/Default/images/preferences/toolbox.png: a (wrong) icon
|
|
|
|
|
|
for the "Toolbox" prefs page. Needs to be replaced.
|
|
|
|
|
|
|
2004-05-31 10:53:25 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontainerentry.[ch]: added new widget
|
|
|
|
|
|
GimpContainerEntry, a GtkEntry with completion that implements the
|
|
|
|
|
|
GimpContainerView interface.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
|
|
|
|
|
|
GimpContainerEntry to select the font.
|
|
|
|
|
|
|
2004-05-31 07:40:10 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* app/actions/file-actions.c
|
|
|
|
|
|
* app/actions/file-commands.[ch]
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/file-open-location-dialog.[ch]
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h
|
|
|
|
|
|
* menus/image-menu.xml.in
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: added a rudimentary "Open Location"
|
|
|
|
|
|
dialog.
|
|
|
|
|
|
|
2004-05-31 04:42:40 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mblur.c (mblur_zoom): push pixels outwards not
|
|
|
|
|
|
to the center as suggested by Chad Daelhousen (bug #142968).
|
|
|
|
|
|
|
2004-05-31 04:33:09 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mblur.c: applied patch from William Skaggs that
|
|
|
|
|
|
adds the possibility to choose the center of radial and zoom
|
|
|
|
|
|
motion blurs (bug #113711).
|
|
|
|
|
|
|
2004-05-31 03:36:06 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.[ch]
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c: reverted last change and applied
|
|
|
|
|
|
new patch instead (bug #72878).
|
|
|
|
|
|
|
2004-05-31 00:45:50 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.[ch]
|
|
|
|
|
|
* app/tools/gimpiscissorstool.c: applied a patch from Philip
|
|
|
|
|
|
Lafleur that fixes RGBA resampling in Convolve tool (bug #72878).
|
|
|
|
|
|
|
2004-05-30 15:38:58 -07:00
|
|
|
|
2004-05-31 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_cmd_gimp_guides.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_edit_area_info.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_preferences.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_settings.c: need to include gimpwidgets.h.
|
|
|
|
|
|
|
2004-05-30 15:04:16 -07:00
|
|
|
|
2004-05-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.h
|
|
|
|
|
|
* app/core/gimpgradient.[ch]
|
|
|
|
|
|
* app/pdb/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* tools/pdbgen/Makefile.am
|
|
|
|
|
|
* tools/pdbgen/groups.pl
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi
|
|
|
|
|
|
Fish that adds lots of gradient edit functions to
|
|
|
|
|
|
gimpgradient.[ch] and makes them available through the PDB.
|
|
|
|
|
|
Fixes bug #129675 and bug #129678.
|
|
|
|
|
|
|
|
|
|
|
|
Did some cleanups / enhancments to the patch:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpgradient.[ch]: changed the naming scheme of the new
|
|
|
|
|
|
functions and changed old functions to match the new scheme.
|
|
|
|
|
|
Introduce a "freeze_count" and public freeze()/thaw() API which
|
|
|
|
|
|
enables subsequent gradient changes without "dirty" being emitted
|
|
|
|
|
|
all the time. Added GimpGradient parameters to all functions
|
|
|
|
|
|
which modify the gradient.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c: use the new freeze/thaw
|
|
|
|
|
|
stuff to keep the gradient from updating when not in
|
|
|
|
|
|
"Instant Update" mode.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/gradient-editor-commands.c: removed all gradient
|
|
|
|
|
|
editing code and call the new core functions.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all
|
|
|
|
|
|
added functions. Generate libgimp wrappers for them..
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/gradient_edit_cmds.c
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* libgimp/gimp_pdb.h
|
|
|
|
|
|
* libgimp/gimpenums.h
|
|
|
|
|
|
* libgimp/gimpgradientedit_pdb.[ch]
|
|
|
|
|
|
* plug-ins/pygimp/gimpenums.py
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-constants.c
|
|
|
|
|
|
* tools/pdbgen/enums.pl: (re)generated.
|
|
|
|
|
|
|
2004-05-29 04:29:37 -07:00
|
|
|
|
2004-05-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/autocrop.c: applied patch from Philip Lafleur
|
|
|
|
|
|
that makes Autocrop register a new procedure that autocrops a
|
|
|
|
|
|
single layer as requested in bug #142618.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/layer.pdb
|
|
|
|
|
|
* app/pdb/layer_cmds.c
|
|
|
|
|
|
* libgimp/gimplayer_pdb.c: fixed documentation for gimp_resize_layer.
|
|
|
|
|
|
Patch provided by Philip Lafleur (bug #142618).
|
|
|
|
|
|
|
2004-05-28 15:35:54 -07:00
|
|
|
|
2004-05-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c
|
|
|
|
|
|
(gimp_template_editor_constructor): add the spinbuttons to the
|
2004-05-29 04:29:37 -07:00
|
|
|
|
size entry in the correct order. Fixes bug #143347.
|
2004-05-28 15:35:54 -07:00
|
|
|
|
|
2004-05-28 07:54:39 -07:00
|
|
|
|
2004-05-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.c (gimp_dnd_open_files): if the dropped
|
|
|
|
|
|
stuff is a local filename (no file URI), convert it to an
|
|
|
|
|
|
URI instead of forwarding it unmodified.
|
|
|
|
|
|
|
2004-05-28 07:51:48 -07:00
|
|
|
|
2004-05-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppreview.c (gimp_preview_button_press_event):
|
|
|
|
|
|
don't invoke the popup preview if there is no viewable.
|
|
|
|
|
|
|
2004-05-28 07:08:23 -07:00
|
|
|
|
2004-05-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c: same workaround for tooltips on
|
|
|
|
|
|
combo boxes.
|
|
|
|
|
|
|
2004-05-28 06:43:11 -07:00
|
|
|
|
2004-05-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_ui.c
|
|
|
|
|
|
* plug-ins/common/warp.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: tooltips can't be set on a GtkComboBox so
|
|
|
|
|
|
we need to pack it into a GtkEventBox when a tooltip is needed.
|
|
|
|
|
|
|
2004-05-28 05:46:54 -07:00
|
|
|
|
2004-05-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimpfont.c (gimp_font_get_popup_size)
|
|
|
|
|
|
(gimp_font_get_new_preview): take both logical and ink rectangle
|
|
|
|
|
|
into account to avoid clipping away parts of the font preview.
|
|
|
|
|
|
Fixes bug #142277.
|
|
|
|
|
|
|
2004-05-28 03:49:56 -07:00
|
|
|
|
2004-05-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerview.[ch]: added "preview-size" and
|
|
|
|
|
|
"preview-border-width" properties. Cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.c
|
|
|
|
|
|
* app/widgets/gimpcontainercombobox.c: implement them.
|
|
|
|
|
|
|
2004-05-28 02:52:15 -07:00
|
|
|
|
2004-05-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.[ch]: removed "reorderable"
|
|
|
|
|
|
from gimp_container_foo_view_new().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.[ch]: removed "reorderable" from
|
|
|
|
|
|
gimp_container_editor_construct(). Automatically set the view to
|
|
|
|
|
|
reorderable if the viewed container has no sort_func.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimpimageview.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimptoolview.c
|
|
|
|
|
|
* app/widgets/gimpundoeditor.c: removed reoderable stuff because
|
|
|
|
|
|
GimpContainerEditor does this generically now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpfontview.c: set reorderable to FALSE because
|
|
|
|
|
|
they should not be reodered even if they don't have a sort_func.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/font-select.c: removed reorderable stuff. Some cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/brush-select.c
|
|
|
|
|
|
* app/gui/gradient-select.c
|
|
|
|
|
|
* app/gui/palette-select.c
|
|
|
|
|
|
* app/gui/pattern-select.c: same cleanups as in font-select.c
|
|
|
|
|
|
|
2004-05-28 02:34:13 -07:00
|
|
|
|
2004-05-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.c
|
|
|
|
|
|
* app/paint/gimpdodgeburn.c
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]
|
|
|
|
|
|
* app/tools/gimpairbrushtool.c
|
|
|
|
|
|
* app/tools/gimpclonetool.c
|
|
|
|
|
|
* app/tools/gimpconvolvetool.c
|
|
|
|
|
|
* app/tools/gimpdodgeburntool.c
|
|
|
|
|
|
* app/tools/gimpinktool.c
|
|
|
|
|
|
* app/tools/gimppaintbrushtool.c
|
|
|
|
|
|
* app/tools/gimppenciltool.c
|
|
|
|
|
|
* app/tools/gimpsmudgetool.c: code review / cleanup.
|
|
|
|
|
|
|
2004-05-27 18:12:12 -07:00
|
|
|
|
2004-05-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/CML_explorer.c
|
|
|
|
|
|
* plug-ins/maze/maze_face.c: added size groups.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sinus.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-27 17:12:01 -07:00
|
|
|
|
2004-05-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-05-27 17:21:37 -07:00
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: tuned dialog layout for
|
|
|
|
|
|
consistency.
|
|
|
|
|
|
|
2004-05-27 17:12:01 -07:00
|
|
|
|
* plug-ins/common/warp.c: added size groups to nicely align the
|
|
|
|
|
|
widgets.
|
|
|
|
|
|
|
2004-05-27 14:19:26 -07:00
|
|
|
|
2004-05-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimp-paint.c (gimp_paint_init): register ink between
|
|
|
|
|
|
airbrush and clone so the stroke dialog's menu of paint functions
|
|
|
|
|
|
has the same order as the default toolbox order.
|
|
|
|
|
|
|
2004-05-27 13:48:49 -07:00
|
|
|
|
2004-05-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags
|
|
|
|
|
|
and member GimpPaintCore::flags. Added "gboolean traces_on_window"
|
|
|
|
|
|
to GimpPaintCoreClass (defaults to FALSE).
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpclone.c: set traces_on_window = TRUE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.[ch]: added
|
|
|
|
|
|
"gboolean handles_changing_brush" to GimpBrushCoreClass (defaults
|
|
|
|
|
|
to FALSE).
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpclone.c
|
|
|
|
|
|
* app/paint/gimpdodgeburn.c
|
|
|
|
|
|
* app/paint/gimperaser.c
|
|
|
|
|
|
* app/paint/gimppaintbrush.c
|
|
|
|
|
|
* app/paint/gimppaintcore.c: set handles_changing_brush = TRUE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-27 12:00:49 -07:00
|
|
|
|
2004-05-27 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c: code clean-up. Improved speed a lot
|
|
|
|
|
|
(500 percent for 1000 x 1000 RGB image) by replacing O(n^2) algorithm
|
|
|
|
|
|
with O(n) version.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gif.c
|
|
|
|
|
|
* plug-ins/common/gih.c
|
|
|
|
|
|
* plug-ins/common/glasstile.c
|
|
|
|
|
|
* plug-ins/common/gqbist.c
|
|
|
|
|
|
* plug-ins/common/gradmap.c
|
|
|
|
|
|
* plug-ins/common/gtm.c
|
|
|
|
|
|
* plug-ins/common/guillotine.c: Use HIG capitalization style plus
|
|
|
|
|
|
minor code clean-up.
|
|
|
|
|
|
|
2004-05-27 08:23:56 -07:00
|
|
|
|
2004-05-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/png.c (respin_cmap): handle an empty colormap.
|
|
|
|
|
|
Fixes bug #143009.
|
|
|
|
|
|
|
2004-05-27 08:12:31 -07:00
|
|
|
|
2004-05-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimppickbutton.c: applied patch from Philip
|
|
|
|
|
|
Lafleur that fixes color picking for XInput devices (bug #143166).
|
|
|
|
|
|
|
2004-05-27 07:51:44 -07:00
|
|
|
|
2004-05-27 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
|
|
|
|
|
|
fixed handling of grid offsets in the grid drawing routine.
|
|
|
|
|
|
|
2004-05-27 05:41:22 -07:00
|
|
|
|
2004-05-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which
|
2004-05-27 07:51:44 -07:00
|
|
|
|
can be one of { FOREGROUND, BACKGROUND }.
|
2004-05-27 05:41:22 -07:00
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/gimpfgbgeditor.[ch]: new widget implementing the
|
|
|
|
|
|
FG/BG/Swap/Default color area known from the toolbox.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox-color-area.c: use the new widget.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and
|
|
|
|
|
|
the color area by a GimpFgBgEditor.
|
|
|
|
|
|
|
2004-05-27 02:02:28 -07:00
|
|
|
|
2004-05-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c (gimp_document_view_new):
|
|
|
|
|
|
gimp_editor_add_action_button() takes a va_list, terminate
|
|
|
|
|
|
it with NULL. Fixes bug #143258.
|
|
|
|
|
|
|
2004-05-26 12:50:56 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpink.c: restored old time/speed sensitivity
|
|
|
|
|
|
behaviour by doing nothing except figuring if we draw a straight
|
|
|
|
|
|
line in INIT_PAINT. Instead, do all the Blob creating in
|
|
|
|
|
|
MOTION_PAINT and special case the initial (null) "motion"
|
|
|
|
|
|
accordingly.
|
|
|
|
|
|
|
2004-05-26 11:24:54 -07:00
|
|
|
|
2004-05-26 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/video.c: code clean-up. Twice as fast now.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/flarefx.c: removed timing stuff.
|
|
|
|
|
|
|
2004-05-26 11:14:37 -07:00
|
|
|
|
2004-05-26 Sven Neumann <sven@gimp.org>
|
2004-05-26 10:29:30 -07:00
|
|
|
|
|
2004-05-26 11:14:37 -07:00
|
|
|
|
* app/core/core-enums.[ch]: shorter names for the gradient types
|
|
|
|
|
|
to reduce the width of the blend tool options.
|
2004-05-26 10:29:30 -07:00
|
|
|
|
|
|
|
|
|
|
2004-05-26 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/decompose.c
|
|
|
|
|
|
* plug-ins/common/deinterlace.c
|
|
|
|
|
|
* plug-ins/common/depthmerge.c
|
|
|
|
|
|
* plug-ins/common/despeckle.c
|
|
|
|
|
|
* plug-ins/common/destripe.c
|
|
|
|
|
|
* plug-ins/common/diffraction.c
|
|
|
|
|
|
* plug-ins/common/displace.c
|
|
|
|
|
|
* plug-ins/common/edge.c
|
|
|
|
|
|
* plug-ins/common/emboss.c
|
|
|
|
|
|
* plug-ins/common/engrave.c
|
2004-05-26 13:10:54 -07:00
|
|
|
|
* plug-ins/common/exchange.c
|
|
|
|
|
|
* plug-ins/common/film.c
|
|
|
|
|
|
* plug-ins/common/flarefx.c: Use HIG capitalization style.
|
|
|
|
|
|
Added GPL license in a few places. Minor code clean-up.
|
2004-05-26 10:29:30 -07:00
|
|
|
|
|
2004-05-26 09:33:14 -07:00
|
|
|
|
2004-05-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolordisplayeditor.c
|
|
|
|
|
|
* modules/cdisplay_colorblind.c
|
|
|
|
|
|
* modules/cdisplay_gamma.c
|
|
|
|
|
|
* modules/cdisplay_highcontrast.c
|
|
|
|
|
|
* modules/cdisplay_proof.c: HIG-ified color display filters.
|
|
|
|
|
|
|
2004-05-26 09:13:53 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: added "guint32 time" parameters
|
|
|
|
|
|
to GimpPaintCore::paint() and ::interpolate().
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpairbrush.c
|
|
|
|
|
|
* app/paint/gimpbrushcore.c
|
|
|
|
|
|
* app/paint/gimpclone.c
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint/gimpdodgeburn.c
|
|
|
|
|
|
* app/paint/gimperaser.c
|
|
|
|
|
|
* app/paint/gimppaintbrush.c
|
|
|
|
|
|
* app/paint/gimpsmudge.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpink.c: ditto and use the passed time instead of
|
|
|
|
|
|
hardcoded dummy values.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore-stroke.c: pass '0' as time.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c: pass the GdkEvent time.
|
|
|
|
|
|
|
2004-05-26 08:34:45 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/Makefile.am
|
|
|
|
|
|
* app/paint/gimpink-blob.[ch]
|
|
|
|
|
|
* app/paint/gimpink.[ch]
|
|
|
|
|
|
* app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool
|
|
|
|
|
|
to be a direct GimpPaintCore subclass without any GUI.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimp-paint.c: register GimpInk with the list of paint
|
|
|
|
|
|
cores.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/Makefile.am
|
|
|
|
|
|
* app/tools/gimpinkoptions.[ch]
|
|
|
|
|
|
* app/tools/gimpinktool-blob.[ch]: removed these files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpinkoptions-gui.[ch]: new files containing only
|
|
|
|
|
|
the GUI for GimpInkOptions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpinktool.[ch]: reduced to some few lines which
|
|
|
|
|
|
implement a simple GimpPaintTool subclass.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp-tools.c: associate the GimpInk paint_core with
|
|
|
|
|
|
the GimpInkTool.
|
|
|
|
|
|
|
2004-05-26 08:25:16 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore-stroke.c: check if we really have
|
|
|
|
|
|
a GimpBrushCore before casting and accessing its members.
|
|
|
|
|
|
|
2004-05-26 08:23:52 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.h
|
|
|
|
|
|
* app/paint/gimppaintcore.h: some cleanup.
|
|
|
|
|
|
|
2004-05-26 06:39:23 -07:00
|
|
|
|
2004-05-26 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-layer-select.c
|
|
|
|
|
|
* app/display/gimpprogress.c
|
|
|
|
|
|
* app/gui/brush-select.c
|
|
|
|
|
|
* app/gui/color-notebook.c
|
|
|
|
|
|
* app/gui/convert-dialog.c
|
|
|
|
|
|
* app/gui/font-select.c
|
|
|
|
|
|
* app/gui/gradient-select.c
|
|
|
|
|
|
* app/gui/info-dialog.c
|
|
|
|
|
|
* app/gui/offset-dialog.c
|
|
|
|
|
|
* app/gui/palette-select.c
|
|
|
|
|
|
* app/gui/pattern-select.c
|
|
|
|
|
|
* app/gui/stroke-dialog.c
|
|
|
|
|
|
* app/gui/tips-dialog.c
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c
|
|
|
|
|
|
* app/tools/gimptexttool.c
|
|
|
|
|
|
* app/widgets/gimpcolordisplayeditor.c
|
|
|
|
|
|
* app/widgets/gimpcolorframe.c
|
|
|
|
|
|
* app/widgets/gimpdevicestatus.c
|
|
|
|
|
|
* app/widgets/gimpviewabledialog.c: adjusted dialog spacings.
|
|
|
|
|
|
|
2004-05-26 05:55:10 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.c: don't do special stuff if a virtual
|
|
|
|
|
|
function doesn't exist. Instead, added default implementations
|
|
|
|
|
|
which do the special stuff and call the virtual functions
|
|
|
|
|
|
unconditionally.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c: some stylistic cleanup.
|
|
|
|
|
|
|
2004-05-26 04:37:23 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch] (gimp_paint_core_paste)
|
|
|
|
|
|
(gimp_paint_core_replace): replaced the "MaskBuf *paint_mask"
|
|
|
|
|
|
parameters by "PixelRegion *mask_bufPR", so subclasses can pass in
|
|
|
|
|
|
any kind of paint_mask buffer and are not restricted to MaskBufs.
|
|
|
|
|
|
|
|
|
|
|
|
Also removes implicit knowledge about the MaskBuf originating from
|
|
|
|
|
|
a brush in paint_mask_to_canvas_buf() and _to_canvas_tiles() which
|
|
|
|
|
|
don't need to offset the mask by width/2 height/2 any more.
|
|
|
|
|
|
|
|
|
|
|
|
Made gimp_paint_core_validate_undo_tiles() and
|
|
|
|
|
|
gimp_paint_core_validate_canvas_tiles() protected functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.c (gimp_brush_core_paste_canvas)
|
|
|
|
|
|
(gimp_brush_core_replace_canvas): create correctly positioned
|
|
|
|
|
|
PixelRegions from the MaskBufs before passing them to the
|
|
|
|
|
|
paint_core.
|
|
|
|
|
|
|
2004-05-26 02:32:03 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: removed "gdouble scale" parameter
|
|
|
|
|
|
and added "GimpPaintOptions" in GimpPaintCore::get_paint_area().
|
|
|
|
|
|
Check if virtual functions exist befoe calling them.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpbrushcore.[ch]: added "gdouble scale" to GimpBrushCore
|
|
|
|
|
|
and "gboolean use_scale" to GimpBrushCoreClass (defaults to TRUE).
|
|
|
|
|
|
Set scale from paint_options in GimpPaintCore::get_paint_area().
|
|
|
|
|
|
Removed "scale" parameter from gimp_brush_core_paste_canvas()
|
|
|
|
|
|
and _replace_canvas().
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpsmudge.c (gimp_smudge_class_init): set use_scale
|
|
|
|
|
|
to FALSE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpclone.c
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint/gimpdodgeburn.c
|
|
|
|
|
|
* app/paint/gimperaser.c
|
|
|
|
|
|
* app/paint/gimppaintbrush.c: removed all scale calculations and
|
|
|
|
|
|
simply pass paint_options to GimpPaintCore::get_paint_area().
|
|
|
|
|
|
|
2004-05-26 01:45:59 -07:00
|
|
|
|
2004-05-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimppainttool.c (gimp_paint_tool_button_press): check
|
2004-05-26 04:37:23 -07:00
|
|
|
|
if the GimpPaintCore really is a GimpBrushCore before casting and
|
2004-05-26 01:45:59 -07:00
|
|
|
|
fiddling with internaly.
|
|
|
|
|
|
|
2004-05-25 13:41:09 -07:00
|
|
|
|
2004-05-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/Makefile.am
|
|
|
|
|
|
* app/paint/gimpbrushcore-kernels.h
|
|
|
|
|
|
* app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass
|
|
|
|
|
|
containing all the brush painting specific stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore-kernels.h: removed this file.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.[ch]: removed all brush stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpairbrush.c
|
|
|
|
|
|
* app/paint/gimpclone.[ch]
|
|
|
|
|
|
* app/paint/gimpconvolve.[ch]
|
|
|
|
|
|
* app/paint/gimpdodgeburn.[ch]
|
|
|
|
|
|
* app/paint/gimperaser.[ch]
|
|
|
|
|
|
* app/paint/gimppaintbrush.[ch]
|
|
|
|
|
|
* app/paint/gimppencil.c
|
|
|
|
|
|
* app/paint/gimpsmudge.[ch]: changed accordingly. Derive all
|
|
|
|
|
|
classes which used to derive directly from GimpPaintCore from
|
|
|
|
|
|
GimpBrushCore now. Lots of cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/paint-types.h
|
|
|
|
|
|
* app/paint/gimp-paint.c
|
|
|
|
|
|
* app/paint/gimppaintcore-stroke.c
|
|
|
|
|
|
* app/tools/gimppainttool.c
|
|
|
|
|
|
* tools/kernelgen.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-25 13:16:07 -07:00
|
|
|
|
2004-05-25 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/align_layers.c
|
|
|
|
|
|
* plug-ins/common/animoptimize.c
|
|
|
|
|
|
* plug-ins/common/animationplay.c
|
|
|
|
|
|
* plug-ins/common/apply_lens.c
|
|
|
|
|
|
* plug-ins/common/autocrop.c
|
|
|
|
|
|
* plug-ins/common/autostretch_hsv.c
|
|
|
|
|
|
* plug-ins/common/blinds.c
|
|
|
|
|
|
* plug-ins/common/blur.c
|
2004-05-26 10:29:30 -07:00
|
|
|
|
* plug-ins/common/borderaverage.c
|
|
|
|
|
|
* plug-ins/common/bz2.c
|
|
|
|
|
|
* plug-ins/common/c_astretch.c
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c
|
|
|
|
|
|
* plug-ins/common/color_enhance.c
|
|
|
|
|
|
* plug-ins/common/colorify.c
|
|
|
|
|
|
* plug-ins/common/colortoalpha.c
|
|
|
|
|
|
* plug-ins/common/csource.c
|
|
|
|
|
|
* plug-ins/common/cubism.c
|
|
|
|
|
|
* plug-ins/common/curve_bend.c: Use HIG capitalization style.
|
|
|
|
|
|
Added GPL license in a few places. Minor code clean-up.
|
2004-05-25 13:16:07 -07:00
|
|
|
|
|
2004-05-25 11:36:52 -07:00
|
|
|
|
2004-05-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Sorry, couldn't resist to finish this task...
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-console.c
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-server.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-25 08:27:46 -07:00
|
|
|
|
2004-05-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/brush.c
|
|
|
|
|
|
* plug-ins/gimpressionist/color.c
|
|
|
|
|
|
* plug-ins/gimpressionist/general.c
|
|
|
|
|
|
* plug-ins/gimpressionist/gimpressionist.[ch]
|
|
|
|
|
|
* plug-ins/gimpressionist/orientation.c
|
|
|
|
|
|
* plug-ins/gimpressionist/orientmap.c
|
|
|
|
|
|
* plug-ins/gimpressionist/paper.c
|
|
|
|
|
|
* plug-ins/gimpressionist/placement.c
|
|
|
|
|
|
* plug-ins/gimpressionist/presets.c
|
|
|
|
|
|
* plug-ins/gimpressionist/preview.c
|
|
|
|
|
|
* plug-ins/gimpressionist/size.c
|
|
|
|
|
|
* plug-ins/gimpressionist/sizemap.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-25 07:37:02 -07:00
|
|
|
|
2004-05-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.h: added GimpContext parameters
|
|
|
|
|
|
to GimpActivateItemFunc, GimpNewItemFunc and GimpEditItemFunc.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdrawabletreeview.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c: pass the view's context to
|
|
|
|
|
|
the functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c (action_data_get_context): return
|
|
|
|
|
|
gimp_get_user_context() if "data" is a Gimp.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-commands.[ch]
|
|
|
|
|
|
* app/actions/layers-commands.[ch]
|
|
|
|
|
|
* app/actions/vectors-commands.[ch]: added GimpContext parameters
|
|
|
|
|
|
to the resp. activate, new and edit functions and use the passed
|
|
|
|
|
|
context instead of gimp_get_user_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/layers-commands.[ch]: removed the merge and flatten
|
|
|
|
|
|
callbacks.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.[ch]: made public layer merge utility
|
|
|
|
|
|
function private and cleaned the whole file up a lot.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/layers-actions.c: use the callbacks from
|
|
|
|
|
|
image-commands.c for merge and flatten.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-commands.c
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/actions/select-commands.c: use action_data_get_context()
|
|
|
|
|
|
instead of gimp_get_user_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c: some cleanup.
|
|
|
|
|
|
|
2004-05-25 06:55:42 -07:00
|
|
|
|
2004-05-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugindetails.c
|
|
|
|
|
|
* plug-ins/dbbrowser/dbbrowser_utils.c
|
|
|
|
|
|
* plug-ins/pagecurl/pagecurl.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-25 05:19:22 -07:00
|
|
|
|
2004-05-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/print/gimp_color_window.c
|
|
|
|
|
|
* plug-ins/print/gimp_main_window.c: HIG-ified and ported to
|
|
|
|
|
|
GtkFileChooser.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c (ifsfile_load_response): ported
|
|
|
|
|
|
forgotten callback to GtkFileChooser.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_browse.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_file.c: finished port to GtkFileChooser.
|
|
|
|
|
|
|
2004-05-25 05:02:54 -07:00
|
|
|
|
2004-05-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c
|
|
|
|
|
|
* app/actions/file-commands.[ch]: removed action "file-new", added
|
|
|
|
|
|
action "file-open-from-image".
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-actions.c
|
|
|
|
|
|
* app/actions/image-commands.[ch]: added actions "image-new" and
|
|
|
|
|
|
"image-new-from-image".
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: use the "-from-image" variants of
|
|
|
|
|
|
the "new" and "open" actions so the dialogs are preconfigured
|
|
|
|
|
|
from the image they were invoked from (regression fix).
|
|
|
|
|
|
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: s/file-new/image-new/.
|
|
|
|
|
|
|
2004-05-24 15:01:56 -07:00
|
|
|
|
2004-05-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/rcm/rcm.h
|
|
|
|
|
|
* plug-ins/rcm/rcm_dialog.[ch]: rearranged and HIG-ified dialog.
|
|
|
|
|
|
|
2004-05-24 12:33:22 -07:00
|
|
|
|
2004-05-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c (toolbox_create_tools): added an evil
|
|
|
|
|
|
hack as workaround for the missing gtk_action_get_accel_closure().
|
2004-05-24 12:35:06 -07:00
|
|
|
|
Re-enables accelerator display in the tool button tooltips.
|
2004-05-24 12:33:22 -07:00
|
|
|
|
|
2004-05-24 09:45:24 -07:00
|
|
|
|
2004-05-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/Makefile.am
|
|
|
|
|
|
* app/vectors/gimpcoordmath.[ch]: removed...
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/gimpcoords.[ch]: ...and added without the "bezier"
|
|
|
|
|
|
namespace.
|
|
|
|
|
|
|
|
|
|
|
|
* app/vectors/gimpbezierstroke.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: force it to link gimpcoords.o
|
|
|
|
|
|
|
2004-05-24 07:51:15 -07:00
|
|
|
|
2004-05-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfigwriter.c
|
|
|
|
|
|
* app/core/gimpstrokeoptions.c
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c
|
|
|
|
|
|
* app/widgets/gimpcolorframe.h
|
|
|
|
|
|
* app/widgets/gimpcolorpanel.h
|
|
|
|
|
|
* app/widgets/gimpcontainerview.[ch]
|
|
|
|
|
|
* app/widgets/gimptooldialog.h
|
|
|
|
|
|
* app/widgets/gimpuimanager.c
|
|
|
|
|
|
* app/widgets/widgets-types.h: fixed various small issues I
|
|
|
|
|
|
stumbled across when updating the API reference for app/.
|
|
|
|
|
|
|
2004-05-24 07:16:25 -07:00
|
|
|
|
2004-05-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpscalecombobox.c
|
|
|
|
|
|
(gimp_scale_combo_box_mru_remove_last): removed debugging output.
|
|
|
|
|
|
|
2004-05-24 07:11:58 -07:00
|
|
|
|
2004-05-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptoolinfo.[ch]: derive GimpToolInfo from
|
|
|
|
|
|
GimpViewable, it doesn't make sense for it to be a GimpData.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c
|
|
|
|
|
|
(gimp_tool_options_editor_get_title): do not append " Options" to
|
|
|
|
|
|
the tool name. Fixes bug #142280.
|
|
|
|
|
|
|
2004-05-24 06:51:11 -07:00
|
|
|
|
2004-05-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mblur.c: fixed range check of blur type
|
|
|
|
|
|
parameter (bug #142965).
|
|
|
|
|
|
|
2004-05-24 06:11:43 -07:00
|
|
|
|
2004-05-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/maze/maze_face.c: fixed a compiler warning.
|
|
|
|
|
|
|
|
|
|
|
|
2004-05-24 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Applied a patch from Philip Lafleur (bug #142808):
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.h: define PRESSURE_SCALE to 1.5
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimpairbrush.c
|
|
|
|
|
|
* app/paint/gimpclone.c
|
|
|
|
|
|
* app/paint/gimpconvolve.c
|
|
|
|
|
|
* app/paint/gimpdodgeburn.c
|
|
|
|
|
|
* app/paint/gimperaser.c
|
|
|
|
|
|
* app/paint/gimppaintbrush.c
|
|
|
|
|
|
* app/paint/gimpsmudge.c: use the PRESSURE_SCALE constant.
|
|
|
|
|
|
|
2004-05-24 03:49:34 -07:00
|
|
|
|
2004-05-24 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Long overdue core container cleanup:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplist.[ch]: added "unique-names" and "sort-func"
|
|
|
|
|
|
properties and merged the resp. code from GimpDataList into
|
|
|
|
|
|
GimpList. Removed "policy" parameters from gimp_list_new() and
|
|
|
|
|
|
added "unique_names". Added new constructor gimp_list_new_weak().
|
|
|
|
|
|
Made public function gimp_list_uniquefy_name() private.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/Makefile.am
|
|
|
|
|
|
* app/core/core-types.h
|
|
|
|
|
|
* app/core/gimpdatalist.[ch]: removed. Its functionality is
|
|
|
|
|
|
entirely in GimpList now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdata.[ch]: added gimp_data_name_compare() which
|
|
|
|
|
|
used to live in GimpDataList.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.c
|
|
|
|
|
|
* app/core/gimpdatafactory.c
|
|
|
|
|
|
* app/core/gimpimage.c
|
|
|
|
|
|
* app/core/gimptoolinfo.c
|
|
|
|
|
|
* app/core/gimpundostack.c
|
|
|
|
|
|
* app/paint/gimp-paint.c
|
|
|
|
|
|
* app/tools/gimp-tools.c
|
|
|
|
|
|
* app/widgets/gimpdevices.c
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c
|
|
|
|
|
|
* app/widgets/gimpundoeditor.c: changed list creation accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
Made gimp->templates, gimp->named_buffers, tool_info->presets and
|
|
|
|
|
|
the image's lists of layers, channels and vectors automatically
|
|
|
|
|
|
ensure unique names.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/actions/templates-commands.c
|
|
|
|
|
|
* app/actions/tool-options-commands.c: removed calls to
|
|
|
|
|
|
gimp_list_uniquefy_name().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.c: removed major insanity where the items
|
|
|
|
|
|
themselves where ensuring their unique names. Bah!
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayer.c (gimp_layer_name_changed): chain up
|
|
|
|
|
|
conditionally.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed
|
|
|
|
|
|
because there is no need any more to keep the parent
|
|
|
|
|
|
implementation from being invoked.
|
|
|
|
|
|
|
2004-05-23 14:12:29 -07:00
|
|
|
|
2004-05-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
More fixes for bug #142996:
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/postscript.c
|
|
|
|
|
|
* plug-ins/common/sparkle.c
|
|
|
|
|
|
* plug-ins/common/sunras.c
|
|
|
|
|
|
* plug-ins/common/uniteditor.c
|
|
|
|
|
|
* plug-ins/fits/fits.c: fixed typos.
|
|
|
|
|
|
|
2004-05-23 14:02:27 -07:00
|
|
|
|
2004-05-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Fixes for bug #142996:
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added missing gettext call.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimprc-blurbs.h
|
|
|
|
|
|
* app/core/gimptemplate.c
|
|
|
|
|
|
* app/gui/gradient-editor-menu.c: fixed typos.
|
|
|
|
|
|
|
2004-05-23 07:13:28 -07:00
|
|
|
|
2004-05-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdatalist.c: code cleanup, no logic changed.
|
|
|
|
|
|
|
2004-05-23 05:43:13 -07:00
|
|
|
|
2004-05-23 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimprc-blurbs.h
|
|
|
|
|
|
* plug-ins/gfig/gfig-spiral.c (spiral_button_press)
|
|
|
|
|
|
* plug-ins/gimpressionist/orientation.c (create_orientationpage)
|
|
|
|
|
|
* plug-ins/common/diffraction.c (diffraction_dialog)
|
|
|
|
|
|
* plug-ins/common/bumpmap.c (bumpmap_dialog)
|
|
|
|
|
|
* plug-ins/maze/maze.h
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_apply.c (compute_image)
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update)
|
|
|
|
|
|
* plug-ins/print/gimp_main_window.c (create_scaling_frame): marked
|
|
|
|
|
|
strings for translation, corrected small typos. Fixes part of bug
|
|
|
|
|
|
#142996
|
|
|
|
|
|
|
2004-05-23 04:45:24 -07:00
|
|
|
|
2004-05-23 Žygimantas Beručka <uid0@akl.lt>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Added "lt" to ALL_LINGUAS.
|
|
|
|
|
|
|
2004-05-23 04:21:40 -07:00
|
|
|
|
2004-05-23 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def: gimp_register_file_handler_mime added
|
|
|
|
|
|
|
2004-05-23 03:04:41 -07:00
|
|
|
|
2004-05-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: reoedered to somehow reflect the
|
|
|
|
|
|
class hierarchy.
|
|
|
|
|
|
|
|
|
|
|
|
Some dockable context handling cleanup:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdocked.[ch]: removed "prev_context" parameter
|
|
|
|
|
|
from GimpDocked::set_context(). Widgets which need the old context
|
|
|
|
|
|
to disconnect from should remember it themselves.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.c (gimp_dockable_set_context): don't
|
|
|
|
|
|
pass the old context to gimp_docked_set_context().
|
|
|
|
|
|
Some cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpnavigationview.[ch]
|
|
|
|
|
|
* app/widgets/gimpimageeditor.[ch]
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.[ch]: added a "context" member
|
|
|
|
|
|
which holds the context set by GimpDocked::set_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdrawabletreeview.c: use the view's context
|
|
|
|
|
|
instead of gimp_get_user_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcoloreditor.[ch]: removed separate API to
|
|
|
|
|
|
set the context because it implements the GimpDockedInterface.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c: pass "menu-factory",
|
|
|
|
|
|
"menu-identifier" and "ui-path" to g_object_new() instead of
|
|
|
|
|
|
calling gimp_editor_create_menu() later.
|
|
|
|
|
|
|
|
|
|
|
|
Action cleanup partly related to the context stuff above:
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c (action_data_get_gimp): get the Gimp from
|
|
|
|
|
|
context->gimp, not gimage->gimp because gimage may be NULL.
|
|
|
|
|
|
|
|
|
|
|
|
(action_data_get_context): changed to use the new context members
|
|
|
|
|
|
added above.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-actions.c (channels_actions_update): cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c (edit_actions_update): fixed
|
|
|
|
|
|
sensitivity of "edit-undo-clear".
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/vectors-actions.c (vectors_actions_update): make
|
|
|
|
|
|
"vectors-merge-visible" sensitive only if there is more than one
|
|
|
|
|
|
GimpVectors in the image.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/colormap-editor-actions.c
|
|
|
|
|
|
* app/actions/gradient-editor-actions.c
|
|
|
|
|
|
* app/actions/palette-editor-actions.c: added FG/BG color previews
|
|
|
|
|
|
to actions which take colors from them. Changed code to be safe
|
|
|
|
|
|
against "context" being NULL.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/drawable-commands.c:
|
|
|
|
|
|
s/active_drawable/drawable/g. Makes the code more readable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-commands.[ch]
|
|
|
|
|
|
* app/actions/vectors-commands.[ch]: removed public stroke utility
|
|
|
|
|
|
functions and other stuff which is not needed any more because
|
|
|
|
|
|
dialog buttons invoke the correct actions now. Moved the
|
|
|
|
|
|
functions' code to the resp. action callbacks.
|
|
|
|
|
|
|
2004-05-21 11:22:46 -07:00
|
|
|
|
2004-05-21 Nathan Summers <rock@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Somehow some of the changes from my commit on 2004-05-18 seem to have
|
|
|
|
|
|
gotten lost, including the addition to the ChangeLog. Sorry about that.
|
|
|
|
|
|
Recommitted.
|
|
|
|
|
|
|
|
|
|
|
|
* NEWS: Clarified end-user visible features.
|
|
|
|
|
|
Made sundry small grammar and consistancy fixes.
|
|
|
|
|
|
Reorganized list of changes slightly.
|
|
|
|
|
|
|
2004-05-21 08:23:28 -07:00
|
|
|
|
2004-05-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): better
|
|
|
|
|
|
fix for bug #123811; patch provided by Philip Lafleur.
|
|
|
|
|
|
|
2004-05-21 07:17:27 -07:00
|
|
|
|
2004-05-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: added some GtkSizeGroups and
|
|
|
|
|
|
changed spacings to improve the dialog layout.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-new-dialog.c
|
|
|
|
|
|
* app/widgets/gimpgrideditor.c
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c: minor changes for consistency.
|
|
|
|
|
|
|
2004-05-21 04:16:27 -07:00
|
|
|
|
2004-05-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gflare/gflare.c
|
|
|
|
|
|
* plug-ins/gfli/gfli.c
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c
|
|
|
|
|
|
* plug-ins/sel2path/sel2path.c
|
|
|
|
|
|
* plug-ins/sel2path/sel2path_adv_dialog.c
|
|
|
|
|
|
* plug-ins/sgi/sgi.c
|
|
|
|
|
|
* plug-ins/winicon/icodialog.c: HIG-ification.
|
|
|
|
|
|
|
2004-05-20 15:35:18 -07:00
|
|
|
|
2004-05-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/data-commands.c (data_delete_callback): eek, delete
|
|
|
|
|
|
the data only if "OK" was pressed.
|
|
|
|
|
|
|
2004-05-20 15:33:19 -07:00
|
|
|
|
2004-05-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
(gimp_error_console_save_ext_clicked): use
|
|
|
|
|
|
gtk_widget_get_screen(), not window_get_screen() on a button.
|
|
|
|
|
|
|
2004-05-20 13:50:23 -07:00
|
|
|
|
2004-05-20 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_*.[ch]: (partly) HIG-ified, replaced
|
|
|
|
|
|
deprecated widget GtkCList by GtkTreeModel/View (also fixes #136893),
|
|
|
|
|
|
use file choosers instead of file selectors, minor clean-up.
|
|
|
|
|
|
|
2004-05-20 08:05:48 -07:00
|
|
|
|
2004-05-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c
|
2004-05-20 08:51:25 -07:00
|
|
|
|
* plug-ins/MapObject/mapobject_ui.c
|
|
|
|
|
|
* plug-ins/bmp/bmpwrite.c
|
|
|
|
|
|
* plug-ins/fits/fits.c
|
|
|
|
|
|
* plug-ins/flame/flame.c
|
2004-05-20 09:47:18 -07:00
|
|
|
|
* plug-ins/fp/fp.c
|
|
|
|
|
|
* plug-ins/gfig/gfig-preview.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: HIG-ified.
|
2004-05-20 08:05:48 -07:00
|
|
|
|
|
2004-05-20 06:32:35 -07:00
|
|
|
|
2004-05-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/FractalExplorer/Dialogs.c
|
|
|
|
|
|
* plug-ins/FractalExplorer/FractalExplorer.c: HIG-ification and
|
|
|
|
|
|
some code cleanup.
|
|
|
|
|
|
|
2004-05-19 19:33:59 -07:00
|
|
|
|
2004-05-19 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
2004-05-20 06:32:35 -07:00
|
|
|
|
* plug-ins/pygimp/gimpfu.py: Actually return values from the run
|
2004-05-19 19:33:59 -07:00
|
|
|
|
function. Fixes #141338.
|
|
|
|
|
|
|
2004-05-19 18:40:48 -07:00
|
|
|
|
2004-05-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/maze/maze_face.c
|
|
|
|
|
|
* plug-ins/xjt/xjt.c: HIG-ified. Say goodbye to "Parameter Settings".
|
|
|
|
|
|
|
2004-05-19 18:19:47 -07:00
|
|
|
|
2004-05-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/warp.c
|
|
|
|
|
|
* plug-ins/common/whirlpinch.c
|
|
|
|
|
|
* plug-ins/common/wmf.c
|
|
|
|
|
|
* plug-ins/common/xbm.c
|
|
|
|
|
|
* plug-ins/common/xpm.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 18:13:14 -07:00
|
|
|
|
2004-05-19 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c: remove unnecessary G_OBJECT() casts.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/help.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/paths.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: a bit of quoting clean up.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: handle icon_data_length properly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-05-19 17:50:05 -07:00
|
|
|
|
2004-05-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tga.c
|
|
|
|
|
|
* plug-ins/common/threshold_alpha.c
|
|
|
|
|
|
* plug-ins/common/tiff.c
|
|
|
|
|
|
* plug-ins/common/tile.c
|
|
|
|
|
|
* plug-ins/common/tileit.c
|
|
|
|
|
|
* plug-ins/common/uniteditor.c
|
|
|
|
|
|
* plug-ins/common/unsharp.c
|
|
|
|
|
|
* plug-ins/common/video.c
|
|
|
|
|
|
* plug-ins/common/vpropagate.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 16:54:40 -07:00
|
|
|
|
2004-05-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/randomize.c
|
|
|
|
|
|
* plug-ins/common/ripple.c
|
|
|
|
|
|
* plug-ins/common/sample_colorize.c
|
|
|
|
|
|
* plug-ins/common/scatter_hsv.c
|
|
|
|
|
|
* plug-ins/common/sel_gauss.c
|
|
|
|
|
|
* plug-ins/common/sharpen.c
|
|
|
|
|
|
* plug-ins/common/shift.c
|
|
|
|
|
|
* plug-ins/common/smooth_palette.c
|
|
|
|
|
|
* plug-ins/common/snoise.c
|
|
|
|
|
|
* plug-ins/common/sobel.c
|
|
|
|
|
|
* plug-ins/common/sparkle.c
|
|
|
|
|
|
* plug-ins/common/spread.c
|
|
|
|
|
|
* plug-ins/common/struc.c
|
|
|
|
|
|
* plug-ins/common/sunras.c
|
|
|
|
|
|
* plug-ins/common/svg.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 13:56:37 -07:00
|
|
|
|
2004-05-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpaction.[ch]: new GtkAction subclass which can
|
|
|
|
|
|
show either a color or viewable preview in GtkImageMenuItem
|
|
|
|
|
|
proxies.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumaction.[ch]
|
|
|
|
|
|
* app/widgets/gimppluginaction.[ch]
|
|
|
|
|
|
* app/widgets/gimpstringaction.[ch]: derive them from GimpAction.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c (gimp_action_group_add_actions):
|
|
|
|
|
|
add GimpActions, not GtkActions.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_action_group_set_action_color)
|
|
|
|
|
|
(gimp_action_group_set_action_viewable): removed all hacks and
|
|
|
|
|
|
simply set the "color" or "viewable" properties of the GimpAction
|
|
|
|
|
|
to change. Fixes color/viewable previews in menus.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c: show previews in the "Open Recent"
|
|
|
|
|
|
menu items.
|
|
|
|
|
|
|
|
|
|
|
|
Unrelated:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: removed GimpDockedInterface typedef...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdocked.h: ...and added it here. We don't have
|
|
|
|
|
|
class struct typedefs in the types header either.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut
|
|
|
|
|
|
for "edit-fill-pattern".
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/gradient-editor-actions.c: added some stock IDs.
|
|
|
|
|
|
Please comment.
|
|
|
|
|
|
|
2004-05-19 10:53:21 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/papertile.c
|
|
|
|
|
|
* plug-ins/common/pat.c
|
|
|
|
|
|
* plug-ins/common/pixelize.c
|
|
|
|
|
|
* plug-ins/common/png.c
|
|
|
|
|
|
* plug-ins/common/postscript.c
|
|
|
|
|
|
* plug-ins/common/psp.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 09:51:32 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mapcolor.c
|
|
|
|
|
|
* plug-ins/common/mblur.c
|
|
|
|
|
|
* plug-ins/common/mng.c
|
|
|
|
|
|
* plug-ins/common/mosaic.c
|
|
|
|
|
|
* plug-ins/common/newsprint.c
|
|
|
|
|
|
* plug-ins/common/oilify.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 08:58:05 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/hot.c
|
|
|
|
|
|
* plug-ins/common/iwarp.c
|
|
|
|
|
|
* plug-ins/common/jpeg.c
|
|
|
|
|
|
* plug-ins/common/lic.c
|
|
|
|
|
|
* plug-ins/common/mail.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 08:28:01 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss_iir.c
|
|
|
|
|
|
* plug-ins/common/gauss_rle.c
|
|
|
|
|
|
* plug-ins/common/gbr.c
|
|
|
|
|
|
* plug-ins/common/gee.c
|
|
|
|
|
|
* plug-ins/common/gee_zoom.c
|
|
|
|
|
|
* plug-ins/common/gif.c
|
|
|
|
|
|
* plug-ins/common/gih.c
|
|
|
|
|
|
* plug-ins/common/glasstile.c
|
|
|
|
|
|
* plug-ins/common/gtm.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 05:08:05 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
2004-05-19 06:15:11 -07:00
|
|
|
|
* plug-ins/common/exchange.c: fixed minor dialog layout issues.
|
|
|
|
|
|
|
2004-05-19 05:24:36 -07:00
|
|
|
|
* plug-ins/common/screenshot.c: added the camera icon to the dialog.
|
|
|
|
|
|
|
2004-05-19 05:08:05 -07:00
|
|
|
|
* plug-ins/common/film.c
|
|
|
|
|
|
* plug-ins/common/fractaltrace.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-19 03:33:47 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): make
|
|
|
|
|
|
sure that pressure never becomes negative. Fixes bug #123811;
|
|
|
|
|
|
thanks to Philip Lafleur for investigating this problem.
|
|
|
|
|
|
|
2004-05-18 16:07:29 -07:00
|
|
|
|
2004-05-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c: added some stock icons.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/edge.c
|
|
|
|
|
|
* plug-ins/common/emboss.c
|
|
|
|
|
|
* plug-ins/common/engrave.c
|
|
|
|
|
|
* plug-ins/common/exchange.c: HIG-ified.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sel_gauss.c: tiny changes for a more consistent
|
|
|
|
|
|
HIG-ification.
|
|
|
|
|
|
|
2004-05-18 15:54:41 -07:00
|
|
|
|
2004-05-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: made plugin_icon_register() an
|
|
|
|
|
|
underscore-prefixed function which needs to be wrapped.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* libgimp/gimp.h
|
|
|
|
|
|
* libgimp/gimpplugin.[ch]: new files containing
|
|
|
|
|
|
gimp_plugin_icon_register() which has no "icon_data_length"
|
|
|
|
|
|
parameter and determines it from the passed icon data.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def: added gimp_plugin_icon_register.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugindetails.c
|
|
|
|
|
|
* plug-ins/common/screenshot.c
|
|
|
|
|
|
* plug-ins/common/uniteditor.c
|
|
|
|
|
|
* plug-ins/print/print.c: don't pass the icon_data_length.
|
|
|
|
|
|
|
2004-05-18 14:21:23 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/checkerboard.c
|
|
|
|
|
|
* plug-ins/common/colorify.c
|
|
|
|
|
|
* plug-ins/common/colortoalpha.c
|
|
|
|
|
|
* plug-ins/common/compose.c
|
|
|
|
|
|
* plug-ins/common/convmatrix.c
|
|
|
|
|
|
* plug-ins/common/csource.c
|
|
|
|
|
|
* plug-ins/common/cubism.c
|
|
|
|
|
|
* plug-ins/common/decompose.c
|
|
|
|
|
|
* plug-ins/common/deinterlace.c
|
|
|
|
|
|
* plug-ins/common/depthmerge.c
|
|
|
|
|
|
* plug-ins/common/despeckle.c
|
|
|
|
|
|
* plug-ins/common/destripe.c
|
|
|
|
|
|
* plug-ins/common/diffraction.c
|
|
|
|
|
|
* plug-ins/common/displace.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-18 14:19:43 -07:00
|
|
|
|
2004-05-18 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Allow plug-ins to register menu icons. Fixes bug #120500.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.[ch]: added enum GimpIconType which can
|
|
|
|
|
|
be one of { STOCK_ID, IMAGE_FILE, INLINE_PIXBUF }.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfigwriter.[ch] (gimp_config_writer_data)
|
|
|
|
|
|
* app/config/gimpscanner.[ch] (gimp_scanner_parse_data): new
|
|
|
|
|
|
functions which write/parse raw binary data. Needed for storing
|
|
|
|
|
|
inline pixbufs in pluginrc.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfigwriter.[ch] (gimp_config_writer_identifier):
|
|
|
|
|
|
new function which writes out an unquoted and unescaped string.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch] (struct PlugInProcDef): added
|
|
|
|
|
|
new members "icon_type", "icon_data_length" and "icon_data".
|
|
|
|
|
|
Reordered members so file_proc specific stuff is at the end.
|
|
|
|
|
|
|
|
|
|
|
|
(plug_in_proc_def_get_stock_id)
|
|
|
|
|
|
(plug_in_proc_def_get_pixbuf): new functions to access the
|
|
|
|
|
|
procedure's icon.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-rc.c: save/restore the registered icons.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-dialog-actions.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c: set the action's stock ID from
|
|
|
|
|
|
the procedure's stock ID.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppluginaction.c
|
|
|
|
|
|
(gimp_plug_in_action_connect_proxy): if the procedure provides a
|
|
|
|
|
|
pixbuf, set it as icon for the menu item.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/file-dialog-menu.[ch]
|
|
|
|
|
|
* app/menus/file-open-menu.c
|
|
|
|
|
|
* app/menus/file-save-menu.c
|
|
|
|
|
|
* app/xcf/xcf.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb (plugin_icon_register): new PDB
|
|
|
|
|
|
function which can be called during query().
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/enums.pl
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c
|
|
|
|
|
|
* libgimp/gimpenums.h
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.c
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.h
|
|
|
|
|
|
* plug-ins/pygimp/gimpenums.py
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-constants.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugindetails.c
|
|
|
|
|
|
* plug-ins/common/uniteditor.c
|
|
|
|
|
|
* plug-ins/print/print.c: register stock_id icons.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/screenshot.c: register an inline_pixbuf icon for
|
|
|
|
|
|
testing purposes (used emblem-camera.png from gnome-icon-theme).
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dialogs-actions.c
|
|
|
|
|
|
* app/actions/file-actions.c: unrelated: added some more icons
|
|
|
|
|
|
to menu items.
|
|
|
|
|
|
|
2004-05-18 13:22:37 -07:00
|
|
|
|
2004-05-18 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sel_gauss.c: HIGified, fixed indendation, speed
|
|
|
|
|
|
improvement (around 70 %).
|
|
|
|
|
|
|
2004-05-18 11:13:48 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/blur.c
|
|
|
|
|
|
* plug-ins/common/borderaverage.c
|
|
|
|
|
|
* plug-ins/common/bumpmap.c
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-18 10:06:06 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpsizeentry.[ch] (gimp_size_entry_attach_label):
|
|
|
|
|
|
return the created label widget so that it can for example be put
|
|
|
|
|
|
into a GtkSizeGroup.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/libgimpoldpreview/gimpoldpreview.[ch]: removed the
|
|
|
|
|
|
optional "Preview" frame. Always put the preview into a sunken
|
|
|
|
|
|
frame.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/AlienMap2.c
|
|
|
|
|
|
* plug-ins/common/blinds.c
|
|
|
|
|
|
* plug-ins/common/flarefx.c
|
|
|
|
|
|
* plug-ins/common/glasstile.c
|
|
|
|
|
|
* plug-ins/common/grid.c
|
|
|
|
|
|
* plug-ins/common/illusion.c
|
|
|
|
|
|
* plug-ins/common/jigsaw.c
|
|
|
|
|
|
* plug-ins/common/max_rgb.c
|
|
|
|
|
|
* plug-ins/common/nlfilt.c
|
|
|
|
|
|
* plug-ins/common/noisify.c
|
|
|
|
|
|
* plug-ins/common/nova.c
|
|
|
|
|
|
* plug-ins/common/plasma.c
|
|
|
|
|
|
* plug-ins/common/polar.c
|
|
|
|
|
|
* plug-ins/common/waves.c
|
|
|
|
|
|
* plug-ins/common/wind.c: changed accordingly, HIG-ified.
|
|
|
|
|
|
|
2004-05-18 05:54:26 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/aa.c
|
|
|
|
|
|
* plug-ins/common/align_layers.c
|
|
|
|
|
|
* plug-ins/common/animationplay.c
|
|
|
|
|
|
* plug-ins/common/apply_lens.c: HIG-ified.
|
|
|
|
|
|
|
2004-05-18 05:23:56 -07:00
|
|
|
|
2004-05-18 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptoolinfo.c: made the "visible" property serializable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp-tools.c: store the tools' order and visibility
|
|
|
|
|
|
in a new config file called "toolrc".
|
|
|
|
|
|
|
2004-05-18 04:39:22 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/brush.c: ported to GtkFileChooser.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gimpressionist/gimpressionist.h
|
|
|
|
|
|
* plug-ins/gimpressionist/ppmtool.[ch]: sprinkled some const
|
|
|
|
|
|
qualifiers.
|
|
|
|
|
|
|
2004-05-18 04:28:13 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/curve_bend.c
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c: ported to GtkFileChooser and
|
|
|
|
|
|
HIG-ified.
|
|
|
|
|
|
|
2004-05-18 02:39:24 -07:00
|
|
|
|
2004-05-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c
|
|
|
|
|
|
* plug-ins/common/gqbist.c: ported to GtkFileChooser and
|
|
|
|
|
|
HIG-ified.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/spheredesigner.c: ditto, but needs more love.
|
|
|
|
|
|
|
2004-05-18 02:04:12 -07:00
|
|
|
|
2004-05-18 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_label): new
|
|
|
|
|
|
function which returns a newly allocated string which is the menu
|
|
|
|
|
|
item's name stripped of mnemonics an ellipses.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c (plug_in_actions_update)
|
|
|
|
|
|
* app/plug-in/plug-in.c (plug_in_get_undo_desc): use the function
|
|
|
|
|
|
instead of implementing the same twice slightly different.
|
|
|
|
|
|
|
2004-05-17 11:49:44 -07:00
|
|
|
|
2004-05-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/CEL.c
|
|
|
|
|
|
* plug-ins/common/CML_explorer.c: ported to GtkFileChooser and
|
|
|
|
|
|
HIG-ified.
|
|
|
|
|
|
|
2004-05-17 10:50:57 -07:00
|
|
|
|
2004-05-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/AlienMap2.c: HIG-ified (more or less).
|
|
|
|
|
|
|
2004-05-17 06:38:03 -07:00
|
|
|
|
2004-05-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/menus.xsl: put the image popup menu into a dummy menubar
|
|
|
|
|
|
to work around the silly GtkUIManager restriction that popup menus
|
|
|
|
|
|
can't have tearoff items.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.c
|
|
|
|
|
|
* app/menus/image-menu.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/menus/plug-in-menus.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c (gui_restore_after_callback): connect to
|
|
|
|
|
|
"notify::tearoff-menus" of GimpGuiConfig and reconfigure the
|
|
|
|
|
|
global image UI manager accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpguiconfig.c: removed GIMP_PARAM_RESTART from the
|
|
|
|
|
|
"tearoff-menus" property because GtkUIManager can change this on
|
|
|
|
|
|
the fly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: added the menubar to the
|
|
|
|
|
|
GimpDisplayShell struct. Some cleanup in gimp_display_shell_new().
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-appearance.c
|
|
|
|
|
|
(gimp_display_shell_set_show_menubar): use shell->menubar instead
|
|
|
|
|
|
of asking the UI manager.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: changed gimp_ui_manager_ui_get()
|
|
|
|
|
|
to transparently load the XML files even if a sub-widget was
|
|
|
|
|
|
requested. Reordered parameters of gimp_ui_manager_ui_popup().
|
|
|
|
|
|
Lots of internal cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c: simplified accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpeditor.[ch]: added new function
|
|
|
|
|
|
gimp_editor_popup_menu() which takes a GimpMenuPositionFunc and
|
|
|
|
|
|
updates/shows the editor's menu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.c: use gimp_editor_popup_menu().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c: moved all code from
|
|
|
|
|
|
gimp_toolbox_new() to GObject::constructor().
|
|
|
|
|
|
|
2004-05-17 05:32:27 -07:00
|
|
|
|
2004-05-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tool-options-actions.c: added icons to the Save,
|
|
|
|
|
|
Load, Rename and Delete submenus.
|
|
|
|
|
|
|
2004-05-17 05:27:34 -07:00
|
|
|
|
2004-05-17 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c (edit_actions_update): don't forget
|
|
|
|
|
|
to set the sensitivity of "edit-named-copy".
|
|
|
|
|
|
|
2004-05-17 02:39:35 -07:00
|
|
|
|
2004-05-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.c (gimp_image_init): initialize the image
|
|
|
|
|
|
unit to GIMP_UNIT_PIXEL.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/image_cmds.c
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb: allow GIMP_UNIT_PIXEL to be used
|
|
|
|
|
|
in the gimp_image_set_unit() PDB call.
|
|
|
|
|
|
|
2004-05-16 05:04:14 -07:00
|
|
|
|
2004-05-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/old-photo.scm: fixed wrong use of
|
|
|
|
|
|
layer ID; bug #142326.
|
|
|
|
|
|
|
2004-05-15 06:11:07 -07:00
|
|
|
|
2004-05-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c: fixed position of vertical line
|
|
|
|
|
|
indicating the picked color. Patch from William Skaggs and
|
|
|
|
|
|
Søren Wedel Nielsen; fixes bug #142506.
|
|
|
|
|
|
|
2004-05-15 04:26:59 -07:00
|
|
|
|
2004-05-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-params.c (plug_in_proc_args_check): changed
|
|
|
|
|
|
warnings to include the invalid menu path. Added check that makes
|
|
|
|
|
|
sure menu paths are either "<Prefix>" or "<Prefix>/foo" but *not*
|
|
|
|
|
|
"<Prefix>foo".
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c: added function
|
|
|
|
|
|
plug_in_actions_check_translation() which validates both the
|
|
|
|
|
|
original and translated menu paths and spits detailed error
|
|
|
|
|
|
messages if any of them is broken. Made action creation simpler
|
|
|
|
|
|
(?) and more robust.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/plug-in-menus.c: argh, the translated menu path must
|
|
|
|
|
|
be a sorting criteria *only*. Fixed the whole stuff to always use
|
|
|
|
|
|
the original menu path because translation is done entirely by
|
|
|
|
|
|
plug-in-actions.c. Fixes bad crashes for all locales. Added
|
|
|
|
|
|
boolean return value to plug_in_menus_build_path() and don't try
|
|
|
|
|
|
to create the menu item in an invalid location if creating the
|
|
|
|
|
|
submenus failed.
|
|
|
|
|
|
|
2004-05-14 09:54:33 -07:00
|
|
|
|
2004-05-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/file-dialog-menu.c: check if the file procedure
|
|
|
|
|
|
registered a menu path at all. The menu should probably be created
|
|
|
|
|
|
from the registered menu path, not from gimp->[load|save]_procs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch]
|
|
|
|
|
|
* app/plug-in/plug-ins.c: removed broken code that used to sort
|
|
|
|
|
|
the file procedures.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/CEL.c
|
|
|
|
|
|
* plug-ins/common/bz2.c
|
|
|
|
|
|
* plug-ins/common/gz.c
|
|
|
|
|
|
* plug-ins/common/pcx.c
|
|
|
|
|
|
* plug-ins/common/pix.c
|
|
|
|
|
|
* plug-ins/common/sunras.c
|
|
|
|
|
|
* plug-ins/sgi/sgi.c
|
|
|
|
|
|
* plug-ins/xjt/xjt.c: register a mimetype, set a translatable
|
|
|
|
|
|
action name (mostly taken from shared-mime-info) and register to
|
|
|
|
|
|
the <Load> and <Save> menus using gimp_plugin_menu_register().
|
|
|
|
|
|
|
2004-05-14 06:47:04 -07:00
|
|
|
|
2004-05-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/fileops_cmds.c
|
|
|
|
|
|
* libgimp/gimpfileops_pdb.c: regenerated.
|
|
|
|
|
|
|
2004-05-14 06:43:48 -07:00
|
|
|
|
2004-05-14 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-actions.c (select_actions_update): don't
|
|
|
|
|
|
make "select-invert" insensitive if there is no selection.
|
|
|
|
|
|
|
2004-05-13 17:42:38 -07:00
|
|
|
|
2004-05-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/aa.c
|
|
|
|
|
|
* plug-ins/common/gbr.c
|
|
|
|
|
|
* plug-ins/common/gih.c
|
|
|
|
|
|
* plug-ins/common/gtm.c
|
|
|
|
|
|
* plug-ins/common/header.c
|
|
|
|
|
|
* plug-ins/common/pat.c
|
|
|
|
|
|
* plug-ins/common/pnm.c
|
|
|
|
|
|
* plug-ins/common/psp.c
|
|
|
|
|
|
* plug-ins/fits/fits.c
|
|
|
|
|
|
* plug-ins/gfli/gfli.c: register a mimetype, set a translatable
|
|
|
|
|
|
action name (mostly taken from shared-mime-info) and register to
|
|
|
|
|
|
the <Load> and <Save> menus using gimp_plugin_menu_register().
|
|
|
|
|
|
|
2004-05-13 17:01:11 -07:00
|
|
|
|
2004-05-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/fileops.pdb: added new PDB function
|
|
|
|
|
|
gimp_register_file_handler_mime() that allows to associate a MIME
|
|
|
|
|
|
type with a file procecdurre.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/fileops_cmds.c
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* libgimp/gimpfileops_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch]
|
|
|
|
|
|
* app/plug-in/plug-in-rc.c
|
|
|
|
|
|
* app/plug-in/plug-ins.[ch]: store a mimetype with file procedures.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/core/gimpdocumentlist.[ch]
|
|
|
|
|
|
* app/core/gimpimagefile.[ch]
|
|
|
|
|
|
* app/file/file-open.[ch]
|
|
|
|
|
|
* app/file/file-save.c: set the thumbnail's mimetype from the file
|
|
|
|
|
|
procedure used to load/save the image.
|
|
|
|
|
|
|
|
|
|
|
|
* app/xcf/xcf.c
|
|
|
|
|
|
* plug-ins/bmp/bmp.c
|
|
|
|
|
|
* plug-ins/common/csource.c
|
|
|
|
|
|
* plug-ins/common/dicom.c
|
|
|
|
|
|
* plug-ins/common/gif.c
|
|
|
|
|
|
* plug-ins/common/gifload.c
|
|
|
|
|
|
* plug-ins/common/jpeg.c
|
|
|
|
|
|
* plug-ins/common/mng.c
|
|
|
|
|
|
* plug-ins/common/png.c
|
|
|
|
|
|
* plug-ins/common/postscript.c
|
|
|
|
|
|
* plug-ins/common/psd.c
|
|
|
|
|
|
* plug-ins/common/psd_save.c
|
|
|
|
|
|
* plug-ins/common/sunras.c
|
|
|
|
|
|
* plug-ins/common/svg.c
|
|
|
|
|
|
* plug-ins/common/tga.c
|
|
|
|
|
|
* plug-ins/common/tiff.c
|
|
|
|
|
|
* plug-ins/common/wmf.c
|
|
|
|
|
|
* plug-ins/common/xbm.c
|
|
|
|
|
|
* plug-ins/common/xpm.c
|
|
|
|
|
|
* plug-ins/common/xwd.c
|
|
|
|
|
|
* plug-ins/faxg3/faxg3.c
|
|
|
|
|
|
* plug-ins/winicon/main.c: register a mimetype, set a translatable
|
|
|
|
|
|
action name (taken from shared-mime-info) and register to the <Load>
|
|
|
|
|
|
and <Save> menus using gimp_plugin_menu_register().
|
|
|
|
|
|
|
2004-05-13 12:59:11 -07:00
|
|
|
|
2004-05-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/lib.pl
|
|
|
|
|
|
* tools/pdbgen/pdbgen.pl: added new procedure variable 'since'
|
|
|
|
|
|
that allows to specify when a new function was added. Use that
|
|
|
|
|
|
info to generate an appropriate gtk-doc comment.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: set since = '2.2' for the new
|
|
|
|
|
|
function gimp_plugin_menu_register().
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.c: regenerated.
|
|
|
|
|
|
|
2004-05-13 08:50:55 -07:00
|
|
|
|
2004-05-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/tool-options-menu.xml: added "name" attributes to all
|
|
|
|
|
|
submenus.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/tool-options-menu.c: use the menu names instead of the
|
|
|
|
|
|
overly long action names.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/colormap-editor-commands.c
|
|
|
|
|
|
* app/actions/tool-options-commands.c: added some callback
|
|
|
|
|
|
implementations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c: removed the callbacks here
|
|
|
|
|
|
and use action buttons.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c
|
|
|
|
|
|
* app/actions/colormap-editor-actions.c
|
|
|
|
|
|
* app/actions/edit-actions.c: code review / cleanup.
|
|
|
|
|
|
|
2004-05-13 08:46:59 -07:00
|
|
|
|
2004-05-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpcontainer.c (gimp_container_add_handler): don't
|
|
|
|
|
|
try to lookup detailed "notify::foo" signal specs.
|
|
|
|
|
|
|
2004-05-13 08:14:50 -07:00
|
|
|
|
2004-05-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolview.[ch]: if in list mode, add an "eye"
|
|
|
|
|
|
column which toggles tool visibility.
|
|
|
|
|
|
|
2004-05-13 06:52:18 -07:00
|
|
|
|
2004-05-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tools-actions.c (tools_actions_update): don't use
|
|
|
|
|
|
action_data_get_context() to update the "tools" action group
|
|
|
|
|
|
because it may return NULL. Use gimp_get_user_context() instead
|
|
|
|
|
|
because the active tool is global regardless of the action group's
|
|
|
|
|
|
context. Fixes accidential tool hiding when closing the last
|
|
|
|
|
|
display.
|
|
|
|
|
|
|
2004-05-13 05:18:15 -07:00
|
|
|
|
2004-05-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save_thumb): oops.
|
|
|
|
|
|
|
2004-05-13 05:15:10 -07:00
|
|
|
|
2004-05-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Added GimpViewable infrastructure which enables migrating from
|
|
|
|
|
|
TempBuf to GdkPixbuf for both providing and getting previews:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpviewable.[ch]: added new virtual functions
|
|
|
|
|
|
GimpViewable::get_pixbuf() and GimpViewable::get_new_pixbuf()
|
|
|
|
|
|
which are implemented exactly as get_preview() and
|
|
|
|
|
|
get_new_preview() except that get_new_pixbuf() has a default
|
|
|
|
|
|
implementation which creates the pixbuf from a TempBuf.
|
|
|
|
|
|
|
|
|
|
|
|
Renamed public functions _get_preview_pixbuf() and
|
|
|
|
|
|
_get_new_preview_pixbuf() to _get_pixbuf() and _get_new_pixbuf().
|
|
|
|
|
|
|
|
|
|
|
|
Added gimp_viewable_get_dummy_pixbuf() and use it from
|
|
|
|
|
|
gimp_viewable_get_dummy_preview().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimagefile.c (gimp_imagefile_save_thumb)
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_update_icon)
|
|
|
|
|
|
* app/gui/resize-dialog.c (resize_dialog_new): changed accordingly.
|
|
|
|
|
|
|
2004-05-13 04:39:18 -07:00
|
|
|
|
2004-05-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpthumb/gimpthumbnail.[ch]: added mime-type support.
|
|
|
|
|
|
|
2004-05-13 04:17:29 -07:00
|
|
|
|
2004-05-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/Makefile.am: added file-menu.[ch] and
|
|
|
|
|
|
file-dialog-menu.[ch]
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.[ch]: removed menus_open_recent_add()...
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/file-menu.[ch]: ...and added it here as file_menu_setup().
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/image-menu.c
|
|
|
|
|
|
* app/menus/toolbox-menu.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/file-dialog-menu.[ch]: added factored out code from the
|
|
|
|
|
|
file-open and file-save menus as file_dialog_menu_setup().
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/file-open-menu.c
|
|
|
|
|
|
* app/menus/file-save-menu.c: call file_dialog_menu_setup().
|
|
|
|
|
|
|
2004-05-12 11:36:33 -07:00
|
|
|
|
2004-05-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/documents-actions.c
|
|
|
|
|
|
* app/actions/documents-commands.c
|
|
|
|
|
|
* app/actions/edit-actions.c
|
|
|
|
|
|
* app/actions/edit-commands.[ch]
|
|
|
|
|
|
* app/actions/layers-actions.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/select-actions.c
|
|
|
|
|
|
* app/actions/select-commands.[ch]
|
|
|
|
|
|
* app/actions/vectors-actions.c
|
|
|
|
|
|
* app/actions/vectors-commands.[ch]: added tooltips for actions
|
|
|
|
|
|
which are now used for dialog buttons, added callback
|
|
|
|
|
|
implementations which formerly lived in various widgets, moved
|
|
|
|
|
|
some actions around and did some general cleanups.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: s/edit-stroke/select-stroke/
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/selection-editor-menu.xml: new popup menu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.c: register <SelectionEditor> and <UndoEditor>
|
|
|
|
|
|
UI managers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpeditor.[ch]: added construct properties
|
|
|
|
|
|
"menu-factory", "menu-identifier", "ui-path" and "popup-data".
|
|
|
|
|
|
Implement GObject::constructor() and create the UI manager
|
|
|
|
|
|
if all needed properties were set. Enables creating action
|
|
|
|
|
|
buttons at widget construction time because they need a
|
|
|
|
|
|
UI manager.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_editor_add_action_button): extended to take a va_list of
|
|
|
|
|
|
"extended" actions which are invoked if the resp. button emits
|
|
|
|
|
|
"extended_clicked". Store the actions and their modifier masks in
|
|
|
|
|
|
a list attached to the button.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerview.c
|
|
|
|
|
|
(gimp_container_view_item_selected): if the view has container
|
|
|
|
|
|
*and* context, simply change the context and return.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_container_view_context_changed): don't emit "select_item"
|
|
|
|
|
|
manually but simply call gimp_container_view_select_item().
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_container_view_viewable_dropped): use
|
|
|
|
|
|
gimp_container_view_item_selected() instead of changing the
|
|
|
|
|
|
context directly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
(gimp_container_editor_select_item): update the UI manager.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.c: don't try to fiddle with the
|
|
|
|
|
|
dialog's menu if it doesn't have a ui_path (happens if the UI
|
|
|
|
|
|
manager is just a collection of actions for the dialog buttons and
|
|
|
|
|
|
has no menu registered).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpimageeditor.c: connect to the image's "flush"
|
|
|
|
|
|
signal and update the UI manager in the callback.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c: use GimpEditor's construct
|
|
|
|
|
|
properties to create the UI manager so GimpItemTreeView subclasses
|
|
|
|
|
|
can have action buttons. Update the UI manager in
|
|
|
|
|
|
gimp_item_tree_view_select_item().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.c
|
|
|
|
|
|
* app/widgets/gimpfontview.c
|
|
|
|
|
|
* app/widgets/gimpimageview.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimptoolview.c: changed calls to
|
|
|
|
|
|
gimp_editor_add_action_button() accordingly and removed some
|
|
|
|
|
|
unneeded select_item() implementations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpchanneltreeview.c
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.[ch]
|
|
|
|
|
|
* app/widgets/gimpdocumentview.[ch]
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimpselectioneditor.[ch]
|
|
|
|
|
|
* app/widgets/gimpundoeditor.[ch]: use action buttons and removed
|
|
|
|
|
|
lots of callbacks which went to the resp. action callbacks.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: removed some now unneeded function
|
|
|
|
|
|
prototypes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs-constructors.c: changed (simplified) many dialog
|
|
|
|
|
|
constructors accordingly.
|
|
|
|
|
|
|
2004-05-12 04:37:21 -07:00
|
|
|
|
2004-05-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
|
|
|
|
|
|
left-align the label.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-commands.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/qmask-commands.c
|
|
|
|
|
|
* app/actions/vectors-commands.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-scale.c
|
|
|
|
|
|
* app/gui/brush-select.c
|
|
|
|
|
|
* app/gui/file-new-dialog.c
|
|
|
|
|
|
* app/gui/info-dialog.c
|
|
|
|
|
|
* app/gui/info-window.c
|
|
|
|
|
|
* app/gui/module-browser.c
|
|
|
|
|
|
* app/gui/offset-dialog.c
|
|
|
|
|
|
* app/gui/palette-import-dialog.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/gui/resize-dialog.c
|
|
|
|
|
|
* app/tools/gimpblendoptions.c
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c
|
|
|
|
|
|
* app/tools/gimpscaletool.c
|
|
|
|
|
|
* app/tools/gimpselectionoptions.c
|
|
|
|
|
|
* app/tools/gimpsheartool.c
|
|
|
|
|
|
* app/tools/gimptextoptions.c
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpgrideditor.c
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimpstrokeeditor.c
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
|
|
|
|
|
|
by the HIG.
|
|
|
|
|
|
|
2004-05-12 01:13:33 -07:00
|
|
|
|
2004-05-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-deserialize.c
|
|
|
|
|
|
* app/config/gimpscanner.c
|
|
|
|
|
|
* app/core/gimp-edit.c
|
|
|
|
|
|
* app/core/gimpchannel-combine.c
|
|
|
|
|
|
* app/core/gimpcontainer.c
|
|
|
|
|
|
* app/core/gimpdrawable-bucket-fill.c
|
|
|
|
|
|
* app/core/gimpdrawable-combine.c
|
|
|
|
|
|
* app/core/gimpdrawable.c
|
|
|
|
|
|
* app/core/gimpgradient.c
|
|
|
|
|
|
* app/core/gimpimage-flip.c
|
|
|
|
|
|
* app/core/gimpimage-merge.c
|
|
|
|
|
|
* app/core/gimpimage-projection.c
|
|
|
|
|
|
* app/core/gimpimage.c
|
|
|
|
|
|
* app/display/gimpdisplay-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/display/gimpprogress.c
|
|
|
|
|
|
* app/gui/info-dialog.c
|
|
|
|
|
|
* app/gui/module-browser.c
|
|
|
|
|
|
* app/gui/offset-dialog.c
|
|
|
|
|
|
* app/plug-in/plug-in.c
|
|
|
|
|
|
* app/tools/gimpdrawtool.c
|
|
|
|
|
|
* app/tools/tool_manager.c
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c
|
|
|
|
|
|
* app/widgets/gimpdialogfactory.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpitemfactory.c
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c
|
|
|
|
|
|
* app/xcf/xcf-save.c
|
|
|
|
|
|
* libgimp/gimpexport.c
|
|
|
|
|
|
* libgimpwidgets/gimphelpui.c
|
|
|
|
|
|
* libgimpwidgets/gimppixmap.c
|
|
|
|
|
|
* libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION,
|
|
|
|
|
|
G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in
|
|
|
|
|
|
g_warning()s by G_STRFUNC.
|
|
|
|
|
|
|
2004-05-11 15:57:28 -07:00
|
|
|
|
2004-05-12 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/gradients-actions.c
|
|
|
|
|
|
* app/actions/palettes-actions.c
|
|
|
|
|
|
* app/actions/patterns-actions.c: added/fixed tooltips.
|
|
|
|
|
|
|
2004-05-11 10:19:24 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: define G*_DISABLE_DEPRECATED for all G* modules
|
|
|
|
|
|
except GTK+. Don't do so if compiling against GLib, GTK+ >= 2.5.0
|
|
|
|
|
|
and Pango >= 1.5.0
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpoffsetarea.c: s/gdk_gc_unref/g_object_unref/
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpconfig-deserialize.c
|
|
|
|
|
|
* app/widgets/gimpdeviceinfo.c:
|
|
|
|
|
|
s/g_value_set_foo_take_ownership/g_value_take_foo/
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptext-vectors.c
|
|
|
|
|
|
* app/text/gimptext-bitmap.c:
|
|
|
|
|
|
s/pango_ft2_font_get_face/pango_fc_font_lock,unlock_face/
|
|
|
|
|
|
|
2004-05-11 09:17:44 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/images-commands.c: added missing #includes.
|
|
|
|
|
|
|
2004-05-11 09:14:03 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontainermenu.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainermenuimpl.[ch]
|
|
|
|
|
|
* app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by
|
|
|
|
|
|
GimpContainerViewInterface implemented by GimpContainerComboBox.
|
|
|
|
|
|
|
2004-05-11 09:05:21 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.[ch]: added action_data_get_context() and
|
|
|
|
|
|
macro return_if_no_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/brushes-actions.c
|
|
|
|
|
|
* app/actions/buffers-actions.c
|
|
|
|
|
|
* app/actions/buffers-commands.c
|
|
|
|
|
|
* app/actions/data-commands.c
|
|
|
|
|
|
* app/actions/fonts-actions.c
|
|
|
|
|
|
* app/actions/fonts-commands.c
|
|
|
|
|
|
* app/actions/gradients-actions.c
|
|
|
|
|
|
* app/actions/images-actions.c
|
|
|
|
|
|
* app/actions/images-commands.c
|
|
|
|
|
|
* app/actions/palettes-actions.c
|
|
|
|
|
|
* app/actions/patterns-actions.c
|
|
|
|
|
|
* app/actions/templates-actions.c
|
|
|
|
|
|
* app/actions/templates-commands.[ch]
|
|
|
|
|
|
* app/actions/tools-actions.c
|
|
|
|
|
|
* app/actions/tools-commands.c: moved lots of code from widgets/
|
|
|
|
|
|
to the resp. action callbacks.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button()
|
|
|
|
|
|
which creates a GtkButton connected to the resp. action.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.[ch]: added "action_group"
|
|
|
|
|
|
parameters so we can distinguish brushes, patterns etc. actions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpimageview.[ch]
|
|
|
|
|
|
* app/widgets/gimpbrushfactoryview.c
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpfontview.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimppatternfactoryview.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.[ch]
|
|
|
|
|
|
* app/widgets/gimptoolview.c: removed tons of GtkButton::clicked()
|
|
|
|
|
|
callbacks and use gimp_editor_add_action_button() instead
|
|
|
|
|
|
of simply _add_button().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs-constructors.c
|
|
|
|
|
|
* app/gui/gradient-select.c
|
|
|
|
|
|
* app/gui/palette-select.c
|
|
|
|
|
|
* app/gui/pattern-select.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-11 09:01:00 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainercombobox.c: correctly get the default
|
|
|
|
|
|
GimpContainerViewInterface implementation and chain up to it for
|
|
|
|
|
|
clear_items(). Update the preview renderers on "update", enable
|
|
|
|
|
|
deselecting everything.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpimagedock.[ch]
|
|
|
|
|
|
* app/gui/file-new-dialog.c
|
|
|
|
|
|
* app/gui/palette-import-dialog.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/gui/stroke-dialog.c: use GimpContainerComboBox instead of
|
|
|
|
|
|
GimpContainerMenuImpl.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/palette-import-dialog.c: cleanup.
|
|
|
|
|
|
|
2004-05-11 08:04:43 -07:00
|
|
|
|
2004-05-11 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* docs/gimptool.1.in: fixed spelling.
|
|
|
|
|
|
|
2004-05-11 06:44:13 -07:00
|
|
|
|
2004-05-11 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c: minor cleanup.
|
|
|
|
|
|
|
2004-05-11 06:41:12 -07:00
|
|
|
|
2004-05-11 Michael Schumacher <schumaml@cvs.gnome.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def
|
|
|
|
|
|
* libgimpbase/gimpbase.def: updated
|
|
|
|
|
|
|
2004-05-11 05:55:12 -07:00
|
|
|
|
2004-05-11 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/user-install-dialog.c: removed the "Aborting
|
|
|
|
|
|
Installation" page. We added it as a nice little gimmick but
|
|
|
|
|
|
obviously people don't understand it's purpose. Fixes bug #142281.
|
|
|
|
|
|
|
2004-05-11 05:13:31 -07:00
|
|
|
|
2004-05-11 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontainercombobox.[ch]: added new widget, almost
|
|
|
|
|
|
finished.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerview.[ch]: added convenience functions
|
|
|
|
|
|
to get and set the GimpContainerView properties.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.c: use the convenience functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-new-dialog.c: use the new GimpContainerComboBox.
|
|
|
|
|
|
|
|
|
|
|
|
* etc/templaterc: use "pixels" as the unit for pixel sized templates.
|
|
|
|
|
|
|
2004-05-11 03:01:25 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpchanneltreeview.c
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.[ch]
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimpfontview.c
|
|
|
|
|
|
* app/widgets/gimpimageview.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimppatternfactoryview.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.c: code review / cleanup.
|
|
|
|
|
|
|
2004-05-10 16:22:39 -07:00
|
|
|
|
2004-05-11 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontainerview.[ch]: made GimpContainerView an
|
|
|
|
|
|
interface. Added accessors for all members in the private struct
|
|
|
|
|
|
and made it really private.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and
|
|
|
|
|
|
implement GimpContainerViewInterface and its properties.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpchanneltreeview.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* app/widgets/gimpdrawabletreeview.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimpvectorstreeview.c: implement
|
|
|
|
|
|
GimpContainerViewInterface and use the new accessor functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
* app/widgets/gimpundoeditor.c
|
|
|
|
|
|
* app/actions/palettes-commands.c: #include "gimpcontainerview.h"
|
|
|
|
|
|
|
2004-05-10 16:17:29 -07:00
|
|
|
|
2004-05-11 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.def
|
|
|
|
|
|
* libgimp/gimpui.def
|
|
|
|
|
|
* libgimpbase/gimpbase.def
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.def: updated.
|
|
|
|
|
|
|
2004-05-10 14:46:25 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c (gimp_frame_style_set): removed a
|
|
|
|
|
|
redundant call to gtk_widget_queue_resize().
|
|
|
|
|
|
|
2004-05-10 11:44:08 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/xcf/xcf-save.c (xcf_save_prop): fixed size of colormap
|
|
|
|
|
|
property. Patch by Daniel Kobras, fixes bug #142149.
|
|
|
|
|
|
|
2004-05-10 11:21:58 -07:00
|
|
|
|
2004-05-10 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/screenshot.c (shoot_dialog): fixed the spacing
|
|
|
|
|
|
of the dialog, thanks to Sven for pointing out my mistake.
|
|
|
|
|
|
|
2004-05-10 11:10:18 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptexteditor.c (gimp_text_editor_set_direction):
|
|
|
|
|
|
don't call gtk_widget_set_direction() on a non-existant widget.
|
|
|
|
|
|
Fixes bug #141792.
|
|
|
|
|
|
|
2004-05-10 10:36:37 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/tips-dialog.c: added missing newline in error message.
|
|
|
|
|
|
|
2004-05-10 10:16:50 -07:00
|
|
|
|
2004-05-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
More GimpContainerView chopping:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerview.[ch]: added
|
2004-05-10 10:36:37 -07:00
|
|
|
|
GimpContainerViewPrivate struct (which is currently public :-) and
|
2004-05-10 10:16:50 -07:00
|
|
|
|
removed all members from the GimpContainerView struct. Added
|
|
|
|
|
|
accessors for "context", "container" and "preview_size /
|
|
|
|
|
|
preview_border_width". Added macro to get the private struct
|
|
|
|
|
|
(*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable
|
|
|
|
|
|
for interfaces).
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrushfactoryview.c
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpchanneltreeview.c
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview-dnd.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimpfontview.c
|
|
|
|
|
|
* app/widgets/gimpimageview.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimpsessioninfo.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimptoolview.c
|
|
|
|
|
|
* app/actions/brushes-actions.c
|
|
|
|
|
|
* app/actions/buffers-actions.c
|
|
|
|
|
|
* app/actions/dockable-actions.c
|
|
|
|
|
|
* app/actions/dockable-commands.c
|
|
|
|
|
|
* app/actions/documents-actions.c
|
|
|
|
|
|
* app/actions/fonts-actions.c
|
|
|
|
|
|
* app/actions/gradients-actions.c
|
|
|
|
|
|
* app/actions/gradients-commands.c
|
|
|
|
|
|
* app/actions/images-actions.c
|
|
|
|
|
|
* app/actions/palettes-actions.c
|
|
|
|
|
|
* app/actions/palettes-commands.c
|
|
|
|
|
|
* app/actions/patterns-actions.c
|
|
|
|
|
|
* app/actions/templates-actions.c
|
|
|
|
|
|
* app/actions/tools-actions.c
|
|
|
|
|
|
* app/actions/tools-commands.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-10 10:02:20 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpmagnifyoptions.[ch]
|
|
|
|
|
|
* app/tools/gimpmagnifytool.c: applied a patch from William Skaggs
|
|
|
|
|
|
that changes a misleading option label. Fixes bug #137508.
|
|
|
|
|
|
|
2004-05-10 05:04:28 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpdisplayconfig.c (DEFAULT_IMAGE_TITLE_FORMAT):
|
|
|
|
|
|
removed the display scale from the default image title because
|
|
|
|
|
|
it's now displayed in the statusbar. Show the image pixel size
|
|
|
|
|
|
instead.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: include a preset for the title
|
|
|
|
|
|
format string that shows the image size (bug #141720).
|
|
|
|
|
|
|
2004-05-10 04:08:51 -07:00
|
|
|
|
2004-05-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Prepare for making an interface out of GimpContainerView:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpcontainerbox.[ch]: new GimpContainerView
|
|
|
|
|
|
subclass which implements GimpDocked interface and contains the
|
|
|
|
|
|
vbox-with-scrolled-window stuff common to GimpContainerGridView
|
|
|
|
|
|
and GimpContainerTreeView.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainerview.[ch]: removed that functionality
|
|
|
|
|
|
here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.[ch]: derive them from
|
|
|
|
|
|
GimpContainerBox.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/brush-select.c
|
|
|
|
|
|
* app/gui/font-select.c
|
|
|
|
|
|
* app/gui/gradient-select.c
|
|
|
|
|
|
* app/gui/palette-select.c
|
|
|
|
|
|
* app/gui/pattern-select.c
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-10 03:33:21 -07:00
|
|
|
|
2004-05-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/view-actions.c: added a stock icon for "view-zoom-1-1".
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpunitcombobox.[ch]: added functions to get and
|
|
|
|
|
|
set the active unit.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpunitstore.c (gimp_unit_store_tree_model_get_value):
|
|
|
|
|
|
need to special case GIMP_UNIT_PIXEL.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/Makefile.am
|
|
|
|
|
|
* app/display/display-types.h
|
|
|
|
|
|
* app/display/gimpscalecombobox.[ch]: new widget to be used in the
|
|
|
|
|
|
display's statusbar.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-cursor.[ch]: always display the
|
|
|
|
|
|
cursor position, not only if the cursor is inside the image. Added
|
|
|
|
|
|
new function gimp_display_shell_clear_cursor() to clear the cursor
|
|
|
|
|
|
label.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-scale.c: do not explicitely resize
|
|
|
|
|
|
the statusbar cursor label, connect to GimpDisplayShell::scaled
|
|
|
|
|
|
instead. Added a GimpScaleComboBox to the status bar.
|
|
|
|
|
|
|
2004-05-09 17:41:57 -07:00
|
|
|
|
2004-05-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Started making the toolbox configurable.
|
|
|
|
|
|
Addresses bug #105764. Not finished yet.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible"
|
|
|
|
|
|
and made it a GObject property.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp-tools.[ch]: added new function
|
|
|
|
|
|
gimp_tools_get_default_order() which returns a GList of tool
|
|
|
|
|
|
identifiers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tools-actions.c
|
|
|
|
|
|
* app/actions/tools-commands.[ch]: added actions & callbacks for
|
|
|
|
|
|
toggling the "visible" boolean and for resetting all tools.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimptoolview.[ch]: new widget which allows to
|
|
|
|
|
|
toggle a tool's visibility and to reorder the tools.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash"
|
|
|
|
|
|
and pack all tool buttons into the same wrap box. Connect to
|
|
|
|
|
|
"reoder" of the tool container and to "notify::visible" of all
|
|
|
|
|
|
tool infos and update the toolbox accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs-constructors.c: create a GimpToolView for the
|
|
|
|
|
|
tools list/grid.
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.c: register a <Tools> menu for the dialog above.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/tools-menu.xml: added the menu.
|
|
|
|
|
|
|
2004-05-09 16:28:37 -07:00
|
|
|
|
2004-05-10 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.c: re-added help for menu items. Still
|
|
|
|
|
|
incomplete because there is no fallback help ID yet when pressing
|
|
|
|
|
|
F1 over a menu item which has a submenu. Added evil workaround and
|
|
|
|
|
|
version check for signal brokenness of GtkUIManager in GTK+ 2.4.1.
|
|
|
|
|
|
|
2004-05-09 14:55:01 -07:00
|
|
|
|
2004-05-09 Hans Breuer <hans@breuer.org>
|
|
|
|
|
|
|
|
|
|
|
|
Merge from stable branch :
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/winclipboard.c : support gray images;
|
|
|
|
|
|
fixes bug #141382
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/winprint.c : dito; fixes bug #141145
|
|
|
|
|
|
|
2004-05-09 11:45:14 -07:00
|
|
|
|
2004-05-09 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/aa.c
|
|
|
|
|
|
* plug-ins/common/apply_lens.c
|
|
|
|
|
|
* plug-ins/common/autocrop.c
|
|
|
|
|
|
* plug-ins/common/autostretch_hsv.c: HIGified, GPL license added in
|
|
|
|
|
|
some plug-ins, minor code clean-up.
|
|
|
|
|
|
|
2004-05-08 13:33:28 -07:00
|
|
|
|
2004-05-08 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/spread.c: HIGified, simplified and fixes #141733
|
|
|
|
|
|
|
2004-05-08 10:44:00 -07:00
|
|
|
|
2004-05-08 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/screenshot.c (shoot_dialog): HIGify the
|
2004-05-08 10:44:48 -07:00
|
|
|
|
screenshot plug-in. Fixes part of bug #141772.
|
2004-05-08 10:44:00 -07:00
|
|
|
|
|
2004-05-07 16:45:29 -07:00
|
|
|
|
2004-05-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.c (gimp_statusbar_resize_cursor):
|
|
|
|
|
|
added 1 pixel horizontal padding around the label.
|
|
|
|
|
|
|
2004-05-07 16:31:01 -07:00
|
|
|
|
2004-05-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.[ch]: renamed struct member combo to
|
|
|
|
|
|
unit_combo. Place the combobox into the cursor frame.
|
|
|
|
|
|
|
2004-05-07 15:16:15 -07:00
|
|
|
|
2004-05-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpunitcombobox.[ch]
|
|
|
|
|
|
* app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu
|
|
|
|
|
|
based on GtkComboBox. Will move this to libgimpwidgets later...
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and
|
|
|
|
|
|
GimpUnitStore.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/gtkrc
|
|
|
|
|
|
* themes/Small/gtkrc: hardcode the appearance of the
|
|
|
|
|
|
GimpUnitComboBox. It uses a hack that doesn't work in list mode.
|
|
|
|
|
|
|
2004-05-07 08:45:56 -07:00
|
|
|
|
2004-05-07 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-colormap.[ch]: added a const qualifier.
|
|
|
|
|
|
|
|
|
|
|
|
Changed how the image unit and dot-for-dot mode is handled. Might
|
|
|
|
|
|
break things and certainly needs more changes (mainly in tools):
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimptemplate.c: allow GIMP_UNIT_PIXEL as image unit.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-scale.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-title.c
|
|
|
|
|
|
* app/display/gimpstatusbar.c: always use the image unit for the
|
|
|
|
|
|
rulers and to display lengths.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c: redone GimpTemplateEditor
|
|
|
|
|
|
based on a dialog mockup from Jimmac and Tigert.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.[ch]: changed some descriptions used by the
|
|
|
|
|
|
template editor.
|
|
|
|
|
|
|
2004-05-07 07:59:33 -07:00
|
|
|
|
2004-05-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/AlienMap2.c
|
|
|
|
|
|
* plug-ins/common/CML_explorer.c
|
|
|
|
|
|
* plug-ins/common/animationplay.c
|
|
|
|
|
|
* plug-ins/common/despeckle.c
|
|
|
|
|
|
* plug-ins/fp/fp.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c
|
|
|
|
|
|
* plug-ins/gflare/gflare.c
|
|
|
|
|
|
* plug-ins/script-fu/script-fu.c
|
|
|
|
|
|
* plug-ins/twain/twain.c: forgot some gimp_plugin_menu_register().
|
|
|
|
|
|
|
2004-05-07 06:15:52 -07:00
|
|
|
|
2004-05-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/FractalExplorer/FractalExplorer.c
|
|
|
|
|
|
* plug-ins/Lighting/lighting_main.c
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_main.c
|
|
|
|
|
|
* plug-ins/dbbrowser/dbbrowser.c
|
|
|
|
|
|
* plug-ins/flame/flame.c
|
|
|
|
|
|
* plug-ins/gimpressionist/gimp.c
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_main.c
|
|
|
|
|
|
* plug-ins/maze/maze.c
|
|
|
|
|
|
* plug-ins/pagecurl/pagecurl.c
|
|
|
|
|
|
* plug-ins/print/print.c
|
|
|
|
|
|
* plug-ins/rcm/rcm.c
|
|
|
|
|
|
* plug-ins/winsnap/winsnap.c
|
|
|
|
|
|
* plug-ins/common/[g-z]*.c: use gimp_plugin_menu_register(). Some
|
|
|
|
|
|
formatting cleanups in some query() functions.
|
|
|
|
|
|
|
2004-05-07 04:25:45 -07:00
|
|
|
|
2004-05-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch]: removed member "accelerator".
|
|
|
|
|
|
It was never set and this is the conceptually wrong place to store
|
|
|
|
|
|
it anyway.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-dialog-actions.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c
|
|
|
|
|
|
* app/plug-in/plug-in-message.c
|
|
|
|
|
|
* app/xcf/xcf.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb (plugins_query): always return NULL
|
|
|
|
|
|
as accelerator. Cleaned up the function a bit and made it aware of
|
|
|
|
|
|
proc_def->menu_label added below.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-05-06 17:30:24 -07:00
|
|
|
|
2004-05-07 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Changed plug-in menu registration again to allow passing just the
|
|
|
|
|
|
menu item's label (not the full path) in gimp_install_procedure()
|
|
|
|
|
|
and only the path (excluding the item's label) in
|
|
|
|
|
|
gimp_plugin_menu_register(). Matches the internal action system
|
|
|
|
|
|
better and makes translating the menu paths much easier.
|
|
|
|
|
|
|
|
|
|
|
|
(Of yourse it's still possible to use the old syntax for backward
|
|
|
|
|
|
compatibility).
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label".
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-params.[ch]: added new functions
|
|
|
|
|
|
plug_in_param_defs_check() and plug_in_proc_args_check() which
|
|
|
|
|
|
check if a procedure's parameters match its menu location
|
|
|
|
|
|
(e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE).
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if
|
|
|
|
|
|
registering an old-style (full) menu_path, use
|
|
|
|
|
|
plug_in_param_defs_check(), set proc_def->menu_label otherwise.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use
|
|
|
|
|
|
plug_in_proc_args_check() on the passed menu_path and make sure
|
|
|
|
|
|
old and new style menu registration are not mixed.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-rc.c: save/restore "menu_label".
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-dialog-actions.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c
|
|
|
|
|
|
* app/menus/plug-in-menus.c: changed action/menu creation
|
|
|
|
|
|
accordingly. Some hacks needed to allow both old and new style
|
|
|
|
|
|
menu_label/menu_paths.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.c
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
* app/xcf/xcf.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/align_layers.c
|
|
|
|
|
|
* plug-ins/common/animationplay.c
|
|
|
|
|
|
* plug-ins/common/animoptimize.c
|
|
|
|
|
|
* plug-ins/common/apply_lens.c
|
|
|
|
|
|
* plug-ins/common/autocrop.c
|
|
|
|
|
|
* plug-ins/common/autostretch_hsv.c
|
|
|
|
|
|
* plug-ins/common/blinds.c
|
|
|
|
|
|
* plug-ins/common/blur.c
|
|
|
|
|
|
* plug-ins/common/borderaverage.c
|
|
|
|
|
|
* plug-ins/common/bumpmap.c
|
|
|
|
|
|
* plug-ins/common/c_astretch.c
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c
|
|
|
|
|
|
* plug-ins/common/checkerboard.c
|
|
|
|
|
|
* plug-ins/common/color_enhance.c
|
|
|
|
|
|
* plug-ins/common/colorify.c
|
|
|
|
|
|
* plug-ins/common/colortoalpha.c
|
|
|
|
|
|
* plug-ins/common/compose.c
|
|
|
|
|
|
* plug-ins/common/convmatrix.c
|
|
|
|
|
|
* plug-ins/common/cubism.c
|
|
|
|
|
|
* plug-ins/common/curve_bend.c
|
|
|
|
|
|
* plug-ins/common/decompose.c
|
|
|
|
|
|
* plug-ins/common/deinterlace.c
|
|
|
|
|
|
* plug-ins/common/depthmerge.c
|
|
|
|
|
|
* plug-ins/common/destripe.c
|
|
|
|
|
|
* plug-ins/common/diffraction.c
|
|
|
|
|
|
* plug-ins/common/displace.c
|
|
|
|
|
|
* plug-ins/common/edge.c
|
|
|
|
|
|
* plug-ins/common/emboss.c
|
|
|
|
|
|
* plug-ins/common/engrave.c
|
|
|
|
|
|
* plug-ins/common/exchange.c
|
|
|
|
|
|
* plug-ins/common/film.c
|
|
|
|
|
|
* plug-ins/common/flarefx.c
|
|
|
|
|
|
* plug-ins/common/fractaltrace.c
|
|
|
|
|
|
* plug-ins/common/screenshot.c: ported the first few plug-ins
|
|
|
|
|
|
to the new registration scheme.
|
|
|
|
|
|
|
2004-05-06 16:26:45 -07:00
|
|
|
|
2004-05-06 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/app.pl: make libgimp* headers always included
|
|
|
|
|
|
before any app headers.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/paint_tools.pdb: Fix silly "Dodgebure" typo.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/*_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-05-06 13:18:53 -07:00
|
|
|
|
2004-05-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-preview.c
|
|
|
|
|
|
* app/core/gimpimage-projection.c: added sanity so we don't just
|
|
|
|
|
|
plain crash when an indexed image doesn't have a colormap.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/png.c: keep at least one entry in the colormap.
|
|
|
|
|
|
Fixes bug #142029.
|
|
|
|
|
|
|
2004-05-06 13:51:49 -07:00
|
|
|
|
2004-05-06 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sobel.c: replaced RMS macro by smarter one,
|
|
|
|
|
|
resulting in a doubling in speed for this plug-in.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/fp/fp.c: include stdlib for free, malloc and abs.
|
|
|
|
|
|
|
2004-05-06 10:59:21 -07:00
|
|
|
|
2004-05-06 Maurits Rijk <m.rijk@chello.nl>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/fp/fp_gdk.c
|
|
|
|
|
|
* plug-ins/fp/fp_gtk.c
|
|
|
|
|
|
* plug-ins/fp/fp_misc.c
|
|
|
|
|
|
* plug-ins/fp/fp.h: removed
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/fp/Makefile.am: changed accordingly
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/fp/fp.c: merged into one single file to get rid of all
|
|
|
|
|
|
global variables and functions. Major clean-up. Still more to come.
|
|
|
|
|
|
|
2004-05-06 07:26:31 -07:00
|
|
|
|
2004-05-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/about-dialog.c: center the about dialog on the monitor,
|
|
|
|
|
|
not on the screen. Fixes window position on xinerama setups.
|
|
|
|
|
|
|
2004-05-06 07:23:21 -07:00
|
|
|
|
2004-05-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: renamed gimp_plugin_menu_add() to
|
|
|
|
|
|
gimp_plugin_menu_register() for consistency with other
|
|
|
|
|
|
gimp_plugin_foo_register() functions which can be called during
|
|
|
|
|
|
query().
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c
|
|
|
|
|
|
* plug-ins/common/colortoalpha.c
|
|
|
|
|
|
* plug-ins/common/screenshot.c
|
|
|
|
|
|
* plug-ins/winsnap/winsnap.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-06 06:51:56 -07:00
|
|
|
|
2004-05-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Enabled multiple menu entries per plug-in procedure:
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to
|
|
|
|
|
|
"GList *menu_paths".
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-message.c
|
|
|
|
|
|
* app/plug-in/plug-in-rc.c
|
|
|
|
|
|
* app/plug-in/plug-in.c
|
|
|
|
|
|
* app/plug-in/plug-ins.c
|
|
|
|
|
|
* app/menus/menus.c
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
* app/xcf/xcf.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-dialog-actions.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c: create an action for the first
|
|
|
|
|
|
element of proc_def->menu_paths.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/menus/plug-in-menus.[ch]: create proxy widgets for each
|
|
|
|
|
|
element of proc_def->menu_paths.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/plug_in.pdb: added new function
|
|
|
|
|
|
gimp_plugin_menu_add() which can be called during query() and adds
|
|
|
|
|
|
a menu path to a procedure registered by the calling plugin.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/internal_procs.c
|
|
|
|
|
|
* app/pdb/plug_in_cmds.c
|
|
|
|
|
|
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: added lots of <placeholder>s for
|
|
|
|
|
|
logical groups (like Image/Resize, Image/Scale, Image/Crop
|
|
|
|
|
|
etc.). Added empty placeholder File/Send for stuff like print and
|
|
|
|
|
|
mail. Added an "Acquire" menu under <Image>/File
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mail.c
|
|
|
|
|
|
* plug-ins/print/print.c
|
|
|
|
|
|
* plug-ins/common/winprint.c: register under File/Send.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/screenshot.c
|
|
|
|
|
|
* plug-ins/winsnap/winsnap.c: also register under
|
|
|
|
|
|
<Image>/File/Acquire.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/autocrop.c
|
|
|
|
|
|
* plug-ins/common/ccanalyze.c
|
|
|
|
|
|
* plug-ins/common/colortoalpha.c
|
|
|
|
|
|
* plug-ins/common/threshold_alpha.c
|
|
|
|
|
|
* plug-ins/common/zealouscrop.c: register additional menu entries
|
|
|
|
|
|
under placeholders in the "Image" and "Layer" menus. This is not
|
|
|
|
|
|
meant to be final but just a hint to keep in mind when
|
|
|
|
|
|
reorganizing the plug-in menus.
|
|
|
|
|
|
|
2004-05-06 06:17:49 -07:00
|
|
|
|
2004-05-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/resize-dialog.[ch]: cleaned up variable names and
|
|
|
|
|
|
external API. Still quite a mess.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/layers-commands.c: changed accordingly.
|
|
|
|
|
|
|
2004-05-06 03:54:44 -07:00
|
|
|
|
2004-05-06 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/menus/menus.c: no need for including gimp-intl.h.
|
|
|
|
|
|
|
2004-05-06 00:41:53 -07:00
|
|
|
|
2004-05-06 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in
|
|
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* app/menus/.cvsignore
|
|
|
|
|
|
* app/menus/Makefile.am
|
|
|
|
|
|
* app/menus/menus-types.h
|
|
|
|
|
|
* app/menus/menus.[ch]
|
|
|
|
|
|
* app/menus/file-open-menu.[ch]
|
|
|
|
|
|
* app/menus/file-save-menu.[ch]
|
|
|
|
|
|
* app/menus/image-menu.[ch]
|
|
|
|
|
|
* app/menus/plug-in-menus.[ch]
|
|
|
|
|
|
* app/menus/tool-options-menu.[ch]
|
|
|
|
|
|
* app/menus/toolbox-menu.[ch]: moved all menus files to their
|
|
|
|
|
|
own directory.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/menus.[ch]
|
|
|
|
|
|
* app/gui/file-open-menu.[ch]
|
|
|
|
|
|
* app/gui/file-save-menu.[ch]
|
|
|
|
|
|
* app/gui/image-menu.[ch]
|
|
|
|
|
|
* app/gui/plug-in-menus.[ch]
|
|
|
|
|
|
* app/gui/tool-options-menu.[ch]
|
|
|
|
|
|
* app/gui/toolbox-menu.[ch]: removed them here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/debug-commands.c
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/gui/brush-select.c
|
|
|
|
|
|
* app/gui/dialogs.c
|
|
|
|
|
|
* app/gui/font-select.c
|
|
|
|
|
|
* app/gui/gradient-select.c
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/gui/gui.c
|
|
|
|
|
|
* app/gui/palette-select.c
|
|
|
|
|
|
* app/gui/pattern-select.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c: changed #includes accordingly.
|
|
|
|
|
|
|
2004-05-05 14:23:45 -07:00
|
|
|
|
2004-05-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-new-dialog.c: use a normal GimpDialog instead of a
|
|
|
|
|
|
GimpViewableDialog that never has a viewable set.
|
|
|
|
|
|
|
2004-05-05 09:22:18 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/brush-select.[ch] (brush_select_new): reordered parameters
|
|
|
|
|
|
so the first four are the same for all foo_select_new() functions.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/brush_select.pdb: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/brush_select_cmds.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/font-select.c (font_select_new): set the vbox'
|
|
|
|
|
|
border width to 6 to match the other foo_select dialogs.
|
|
|
|
|
|
|
2004-05-05 08:54:42 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/debug-actions.c
|
|
|
|
|
|
* app/actions/debug-commands.[ch]
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: added action & callback which XML-dump
|
|
|
|
|
|
all UI managers.
|
|
|
|
|
|
|
2004-05-05 08:34:11 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c (plug_in_actions_add_proc): fixed
|
|
|
|
|
|
bug which would have leaked broken menu translations.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/plug-in-menus.c: removed useless #includes.
|
|
|
|
|
|
|
2004-05-05 04:40:20 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c
|
|
|
|
|
|
* app/actions/file-commands.[ch]: remove "file-close" action and
|
|
|
|
|
|
callback...
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/view-actions.c
|
|
|
|
|
|
* app/actions/view-commands.[ch]: ...and added it here as
|
|
|
|
|
|
"view-close" because that's what it does.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/qmask-actions.c
|
|
|
|
|
|
* app/actions/qmask-commands.c: s/QMask/QuickMask/g
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c: add the "channels" action group to the <Image>
|
|
|
|
|
|
and <Dock> UI managers, renamed UI manager <Dialogs> to
|
|
|
|
|
|
<Dockable>.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockbook.c: s/<Dialogs>/<Dockable>/.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: s/file-close/view-close/, added
|
|
|
|
|
|
separators at the end of most menus, moved the bottom group of the
|
|
|
|
|
|
"View" menu after the zoom group.
|
|
|
|
|
|
|
2004-05-04 18:17:23 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-actions.c: removed action "select-by-color".
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpbycolorselecttool.c: add the shortcut here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tools-actions.c: added alternative tool actions for
|
|
|
|
|
|
"by-color-select" and "rotate" which are identical to the ones
|
|
|
|
|
|
generated from the GimpToolInfo except for their label. Make sure
|
|
|
|
|
|
they have the same accelerators as the generated ones.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: use the alternative actions for
|
|
|
|
|
|
"<Image>/Select/By Color" and
|
|
|
|
|
|
"<Layer>/Transform/Arbitrary Rotation...".
|
|
|
|
|
|
|
2004-05-04 18:15:46 -07:00
|
|
|
|
2004-05-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimphelpui.c: documentation.
|
|
|
|
|
|
|
2004-05-04 18:06:14 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Finally enable global accelerators in all docks:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
|
|
|
|
|
|
iterate all of the UI manager's actions and enable their
|
|
|
|
|
|
accelerators manually. Fixes bug #119878.
|
|
|
|
|
|
|
2004-05-04 17:01:19 -07:00
|
|
|
|
2004-05-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpviewabledialog.c: added construct properties to
|
|
|
|
|
|
make it possible to derive from GimpViewableDialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real
|
|
|
|
|
|
object, not just a convenience constructor.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/gtkrc
|
|
|
|
|
|
* themes/Small/gtkrc: set a smaller border_width of 6 pixels for
|
|
|
|
|
|
the action area of tool dialogs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcolorpickertool.c
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c: set a smaller border_width of 6
|
|
|
|
|
|
pixels on tool dialogs to make them more compact.
|
|
|
|
|
|
|
2004-05-04 16:12:59 -07:00
|
|
|
|
2004-05-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpoffsetarea.[ch]: added new function
|
|
|
|
|
|
gimp_offset_area_set_pixbuf(). Started to clean up the
|
|
|
|
|
|
code a bit.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/resize-dialog.c (resize_widget_new): use the new feature
|
|
|
|
|
|
and set a preview of the image. Fixes bug #78733.
|
|
|
|
|
|
|
2004-05-04 15:33:52 -07:00
|
|
|
|
2004-05-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/info-dialog.c
|
|
|
|
|
|
* app/tools/gimpcolorbalancetool.c
|
|
|
|
|
|
* app/tools/gimpcolorizetool.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimphuesaturationtool.c
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptexteditor.c: tweaked.
|
|
|
|
|
|
|
2004-05-04 14:37:42 -07:00
|
|
|
|
2004-05-05 Jakub Steiner <jimmac@ximian.com>
|
|
|
|
|
|
|
|
|
|
|
|
* data/images/gimp_splash.png: ustable splash
|
|
|
|
|
|
|
2004-05-04 14:16:40 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c: register a <Dock> UI manager which has all
|
|
|
|
|
|
action groups <Image> has except "view".
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpimagedock.[ch]: re-enabled the global shortcuts,
|
|
|
|
|
|
using UI manager instead of item factory. Unfortunately actions
|
|
|
|
|
|
without proxy widgets can't be activated so this change is pretty
|
|
|
|
|
|
useless. Oh well, will find a hack to work around this later...
|
|
|
|
|
|
|
2004-05-04 14:11:06 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpblendoptions.c
|
|
|
|
|
|
* app/tools/gimpbucketfilloptions.c
|
|
|
|
|
|
* app/tools/gimpcoloroptions.c
|
|
|
|
|
|
* app/tools/gimpinkoptions.c
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c
|
|
|
|
|
|
* app/tools/gimpselectionoptions.c
|
|
|
|
|
|
* app/tools/gimptooloptions-gui.c
|
|
|
|
|
|
* app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame
|
|
|
|
|
|
was used. Put "Pressure Sensitivity" frame into a GtkExpander.
|
|
|
|
|
|
|
2004-05-04 13:05:10 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c: added a style property to control
|
|
|
|
|
|
boldening of the frame title.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/gtkrc
|
|
|
|
|
|
* themes/Small/gtkrc: suppress the bold title for GimpFrames in
|
|
|
|
|
|
GimpDockables,
|
|
|
|
|
|
|
2004-05-04 08:43:40 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): allocate
|
|
|
|
|
|
the full width for the label widget, looks better and is more
|
|
|
|
|
|
convenient to use with activatable widgets such as toggle buttons.
|
|
|
|
|
|
|
2004-05-04 08:09:53 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c: removed debugging output, added
|
|
|
|
|
|
#warning about runtime version check that can be removed as soon
|
|
|
|
|
|
as we depend on GTK+ 2.4.1.
|
|
|
|
|
|
|
2004-05-04 07:51:10 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-dialog-actions.c (file_dialog_actions_setup):
|
|
|
|
|
|
don't forget to set the action's accelerator.
|
|
|
|
|
|
|
2004-05-04 07:21:13 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-commands.c
|
|
|
|
|
|
* app/actions/gradient-editor-commands.c
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/qmask-commands.c
|
|
|
|
|
|
* app/actions/templates-commands.c
|
|
|
|
|
|
* app/actions/vectors-commands.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-filter-dialog.c
|
|
|
|
|
|
* app/gui/convert-dialog.c
|
|
|
|
|
|
* app/gui/module-browser.c
|
|
|
|
|
|
* app/gui/offset-dialog.c
|
|
|
|
|
|
* app/gui/palette-import-dialog.c
|
|
|
|
|
|
* app/gui/resize-dialog.c
|
|
|
|
|
|
* app/gui/resolution-calibrate-dialog.c
|
|
|
|
|
|
* app/gui/tips-dialog.c
|
|
|
|
|
|
* app/gui/user-install-dialog.c
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c
|
|
|
|
|
|
* libgimpwidgets/gimpquerybox.c: set dialog border spacing to 12.
|
|
|
|
|
|
|
2004-05-04 06:31:57 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/widgets/widgets-enums.[ch]
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c (gimp_window_set_hint): added
|
|
|
|
|
|
new window hint "keep-above" to force toolbox and/or dock windows
|
|
|
|
|
|
to be kept above (if the WM supports this hint). Fixes bug #131672.
|
|
|
|
|
|
|
2004-05-04 06:09:39 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Fix bug #141719:
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT()
|
|
|
|
|
|
instead of ROUND() to round double coords to guide positions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
(gimp_display_shell_canvas_tool_events): pass RINT()-rounded
|
|
|
|
|
|
coords to gimp_display_shell_update_cursor() instead of implicitly
|
|
|
|
|
|
truncating by casting to int.
|
|
|
|
|
|
|
2004-05-04 05:32:36 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpundoeditor.c: removed code duplication by adding
|
|
|
|
|
|
utility function gimp_undo_editor_update_buttons(), some general
|
|
|
|
|
|
cleanups.
|
|
|
|
|
|
|
2004-05-04 05:07:58 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.c (gimp_image_undo_freeze,thaw): emit the
|
|
|
|
|
|
"undo-freeze" and "undo-thaw" signals only on the first freeze and
|
|
|
|
|
|
last thaw, not on any of them.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp-ids.h: added GIMP_HELP_EDIT_UNDO_CLEAR.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpundoeditor.[ch]: added a "Clear Undo History"
|
|
|
|
|
|
button. Fixes bug #136300.
|
|
|
|
|
|
|
|
|
|
|
|
Also don't attach to the image's undo stack if the image's undo is
|
|
|
|
|
|
disabled and set the buttons' sensitivity accordingly. Should fix
|
|
|
|
|
|
all kinds of unpredictable undo history brokenness.
|
|
|
|
|
|
|
2004-05-04 04:26:22 -07:00
|
|
|
|
2004-05-04 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Treat FG/BG just like all other context properties:
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK
|
|
|
|
|
|
and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify
|
|
|
|
|
|
that they are used by GimpPaintOptions (automatically affects all
|
|
|
|
|
|
paint tools).
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpblendtool.c
|
|
|
|
|
|
* app/tools/gimpbucketfilltool.c
|
|
|
|
|
|
* app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK
|
|
|
|
|
|
manually here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/tool_manager.c (tool_manager_tool_changed): decide
|
|
|
|
|
|
about the globality of FG and BG at the same place where we decide
|
|
|
|
|
|
about the brush's, pattern's etc. globality, but hardcode them to
|
|
|
|
|
|
global = TRUE instead of looking at GimpConfig.
|
|
|
|
|
|
|
|
|
|
|
|
Fixes bug #141786.
|
|
|
|
|
|
|
2004-05-04 02:29:03 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sobel.c (sobel_dialog): removed frame, adjusted
|
|
|
|
|
|
spacing, fixes bug #141773.
|
|
|
|
|
|
|
2004-05-03 17:15:49 -07:00
|
|
|
|
2004-05-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/stroke-dialog.c:
|
|
|
|
|
|
* app/widgets/gimpstrokeeditor.c: moved line style options into a
|
|
|
|
|
|
GtkExpander. Changed dialog spacings.
|
|
|
|
|
|
|
2004-05-03 15:36:59 -07:00
|
|
|
|
2004-05-03 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/qmask-actions.c: initialize is_active for qmask-toggle.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tools-actions.c: set entry help_id from tool_info,
|
|
|
|
|
|
since gimp_action_group_add_string_actions expects it to be there
|
|
|
|
|
|
now.
|
|
|
|
|
|
|
2004-05-03 10:22:28 -07:00
|
|
|
|
2004-05-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c (gimp_frame_new): added a hack that
|
|
|
|
|
|
allows to get the label_spacing but no label. Useful when the frame
|
|
|
|
|
|
is packed into a GtkExpander.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c: pack the "Image Comment" frame
|
|
|
|
|
|
into a GtkExpander to reduce clutter and dialog size.
|
|
|
|
|
|
|
2004-05-03 08:54:54 -07:00
|
|
|
|
2004-05-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimphelpui.[ch]: added gimp_help_id_quark()
|
|
|
|
|
|
which is G_GNUC_CONST and a new macro GIMP_HELP_ID as shortcut.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
|
|
|
|
|
|
attach the help ID to the action using the new quark key. Call
|
|
|
|
|
|
gtk_action_group_add_action() instead of the _with_accel() variant
|
|
|
|
|
|
if the accel is the empty string (== if we explicitely want no
|
|
|
|
|
|
accel even if the stock item specifies one). Fixes warning flood
|
|
|
|
|
|
with GTK+ 2.4.1.
|
|
|
|
|
|
|
2004-05-03 08:37:56 -07:00
|
|
|
|
2004-05-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c: if the label_widget is a button, set
|
|
|
|
|
|
the button label as bold. Cache the indentation instead of
|
|
|
|
|
|
calculating it over and over again.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/gtkrc: set HIG-compliant spacing for the
|
|
|
|
|
|
action_area.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.[ch]: added
|
|
|
|
|
|
gimp_prop_enum_radio_box_new() for a radio group that is no
|
|
|
|
|
|
embedded in a frame.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpstrokeeditor.c: use a frame-less radio box for
|
|
|
|
|
|
the Stroke style.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-new-dialog.c
|
|
|
|
|
|
* app/gui/grid-dialog.c
|
|
|
|
|
|
* app/gui/stroke-dialog.c: HIG-compliant spacings.
|
|
|
|
|
|
|
2004-05-03 07:57:19 -07:00
|
|
|
|
2004-05-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdock.c (gimp_dock_key_press_event): new function
|
2004-05-03 08:04:24 -07:00
|
|
|
|
which overrides GtkWindow's default handler in order to give the
|
|
|
|
|
|
focus widget precedence over accelerators for keys without any
|
|
|
|
|
|
modifier or with <Shift> modifier. Enables e.g. having a <Shift>+s
|
|
|
|
|
|
accelerator while still being able to enter 'S' in an entry.
|
|
|
|
|
|
Thanks to Tim Janik for the code.
|
2004-05-03 07:57:19 -07:00
|
|
|
|
|
2004-05-03 07:46:29 -07:00
|
|
|
|
2004-05-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.h. added the various return_if_no_foo()
|
|
|
|
|
|
macros here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-commands.c
|
|
|
|
|
|
* app/actions/dialogs-commands.c
|
|
|
|
|
|
* app/actions/drawable-commands.c
|
|
|
|
|
|
* app/actions/edit-commands.c
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/qmask-commands.c
|
|
|
|
|
|
* app/actions/select-commands.c
|
|
|
|
|
|
* app/actions/vectors-commands.c
|
|
|
|
|
|
* app/actions/view-commands.c: removed them here. Some cleanup.
|
|
|
|
|
|
|
2004-05-03 07:03:51 -07:00
|
|
|
|
2004-05-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.[ch]: added some utility functions to get a
|
|
|
|
|
|
Gimp, GimpImage, GimpDisplay and GtkWidget from the "data" pointer
|
|
|
|
|
|
passed to action callbacks.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-actions.c
|
|
|
|
|
|
* app/actions/channels-commands.c
|
|
|
|
|
|
* app/actions/drawable-actions.c
|
|
|
|
|
|
* app/actions/drawable-commands.c
|
|
|
|
|
|
* app/actions/edit-actions.c
|
|
|
|
|
|
* app/actions/edit-commands.c
|
|
|
|
|
|
* app/actions/file-actions.c
|
|
|
|
|
|
* app/actions/file-commands.c
|
|
|
|
|
|
* app/actions/help-commands.c
|
|
|
|
|
|
* app/actions/image-actions.c
|
|
|
|
|
|
* app/actions/image-commands.c
|
|
|
|
|
|
* app/actions/layers-actions.c
|
|
|
|
|
|
* app/actions/layers-commands.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c
|
|
|
|
|
|
* app/actions/plug-in-commands.c
|
|
|
|
|
|
* app/actions/qmask-actions.c
|
|
|
|
|
|
* app/actions/qmask-commands.c
|
|
|
|
|
|
* app/actions/select-actions.c
|
|
|
|
|
|
* app/actions/select-commands.c
|
|
|
|
|
|
* app/actions/tools-commands.c
|
|
|
|
|
|
* app/actions/vectors-actions.c
|
|
|
|
|
|
* app/actions/vectors-commands.c
|
|
|
|
|
|
* app/actions/view-commands.c: use the new functions instead of
|
|
|
|
|
|
duplicating insane macros and if() constructs over and over again.
|
|
|
|
|
|
|
2004-05-02 17:10:24 -07:00
|
|
|
|
2004-05-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.c: use a GimpFrame for
|
|
|
|
|
|
gimp_radio_group_new() and friends.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Default/gtkrc
|
|
|
|
|
|
* themes/Small/gtkrc: set a smaller label_spacing for GimpFrame
|
|
|
|
|
|
widgets in GimpDockables. Lame hack to keep the tool options
|
|
|
|
|
|
compact.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/image-commands.c: changed spacing.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/offset-dialog.c: merged check and radio buttons into a
|
|
|
|
|
|
single radio button group; changed spacing.
|
|
|
|
|
|
|
2004-05-02 15:33:33 -07:00
|
|
|
|
2004-05-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): respect
|
|
|
|
|
|
the frame's border width.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolorframe.[ch]: derive from GimpFrame.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/convert-dialog.c
|
|
|
|
|
|
* app/gui/info-window.c
|
|
|
|
|
|
* app/gui/palette-import-dialog.c
|
|
|
|
|
|
* app/gui/resize-dialog.c: use GimpFrames, changed some spacings.
|
|
|
|
|
|
|
2004-05-02 15:23:26 -07:00
|
|
|
|
2004-05-03 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dockable-commands.c (dockable_add_tab_cmd_callback):
|
|
|
|
|
|
truncate the passed dialog identifier at the first '|'. Fixes
|
|
|
|
|
|
creating brushes, paterns etc. dialogs from the dockables'
|
|
|
|
|
|
"Add Tab" menu.
|
|
|
|
|
|
|
2004-05-02 14:42:52 -07:00
|
|
|
|
2004-05-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpframe.c (gimp_frame_size_request): take the
|
|
|
|
|
|
left margin into account.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpgrideditor.c
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c: removed container borders that
|
|
|
|
|
|
aren't needed any longer.
|
|
|
|
|
|
|
2004-05-02 14:13:51 -07:00
|
|
|
|
2004-05-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumwidgets.c
|
|
|
|
|
|
* app/widgets/gimpgrideditor.c
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c: use the GimpFrame widget,
|
|
|
|
|
|
changed some spacings to better comply with the HIG.
|
|
|
|
|
|
|
2004-05-02 13:30:41 -07:00
|
|
|
|
2004-05-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpframe.[ch]: added new widget GimpFrame, a HIG
|
|
|
|
|
|
compliant variant of GtkFrame.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/preferences-dialog.c: enable the HIG compliant mode by
|
|
|
|
|
|
default and use the new GimpFrame widget for it.
|
|
|
|
|
|
|
|
|
|
|
|
* themes/Small/gtkrc: set a smaller spacing between the GimpFrame
|
|
|
|
|
|
title label and the frame content.
|
|
|
|
|
|
|
2004-05-02 12:37:17 -07:00
|
|
|
|
2004-05-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/qmask-actions.c: renamed action "qmask-toggle" to
|
|
|
|
|
|
"qmask-active" and added new action "qmask-toggle" with a label
|
|
|
|
|
|
and shortcut suited for the "Select" menu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-actions.c: removed "select-toggle-qmask".
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/select-commands.[ch]: removed callback
|
|
|
|
|
|
select_toggle_quickmask_cmd_callback().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/channels-actions.c (channels_actions_update)
|
|
|
|
|
|
* app/actions/vectors-actions.c (vectors_actions_update): handle
|
|
|
|
|
|
"data" being both GimpDisplay and GimpDisplayShell so the actions
|
|
|
|
|
|
can be used in the image menu.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: s/select-toggle-qmask/qmask-toggle/.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/qmask-menu.xml: s/qmask-toggle/qmask-active/.
|
|
|
|
|
|
|
2004-05-02 06:48:27 -07:00
|
|
|
|
2004-05-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in
|
|
|
|
|
|
* menus/tool-options-menu.xml
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: use empty elements for empty menus.
|
|
|
|
|
|
Makes the XML somewhat easier to read.
|
|
|
|
|
|
|
2004-05-02 03:41:28 -07:00
|
|
|
|
2004-05-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/dialogs-menuitems.xml: new file that holds menuitems that
|
|
|
|
|
|
appear in several places.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/dockable-menu.xml.in: new file used to generate
|
|
|
|
|
|
dockable-menu.xml.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/toolbox-menu.xml.in: new file used to generate
|
|
|
|
|
|
toolbox-menu.xml.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: include dialogs-menuitems.xml.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/menus.xsl: allow inclusion of menuitems using XInclude.
|
|
|
|
|
|
|
2004-05-02 12:37:17 -07:00
|
|
|
|
2004-05-02 Michael Natterer <mitch@gimp.org>
|
2004-05-02 03:34:04 -07:00
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/file-dialog-actions.[ch]: new files containing
|
|
|
|
|
|
factored out code to set up the <Load> and <Save> actions.
|
|
|
|
|
|
Use GimpPlugInActions instead of just GtkActions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-dialog-commands.[ch]: new files containing
|
|
|
|
|
|
file_dialog_type_cmd_callback() which is a
|
|
|
|
|
|
GimpPlugInAction::selected() callback now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-commands.[ch]: removed the callback here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-open-actions.c
|
|
|
|
|
|
* app/actions/file-save-actions.c: removed code duplication and
|
|
|
|
|
|
use file_dialog_actions_setup() instead.
|
|
|
|
|
|
|
2004-05-02 01:56:07 -07:00
|
|
|
|
2004-05-02 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/*-actions.c: added help IDs to all actions
|
|
|
|
|
|
representing the toplevel popups and menus (as fallbacks for the
|
|
|
|
|
|
still-to-be-written help system intrgration of GimpUIManager).
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.c (gimp_display_shell_new): removed
|
|
|
|
|
|
call to gtk_ui_manager_ensure_update() because that's done by
|
|
|
|
|
|
gimp_ui_manager_ui_get() now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.[ch]: removed API to register and
|
|
|
|
|
|
create item factories.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs.c
|
|
|
|
|
|
* app/actions/plug-in-commands.c
|
|
|
|
|
|
* app/gui/file-dialog-utils.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c
|
|
|
|
|
|
* app/widgets/gimpdataeditor.c
|
|
|
|
|
|
* app/widgets/gimpdockable.c
|
|
|
|
|
|
* app/widgets/gimpdockbook.[ch]
|
|
|
|
|
|
* app/widgets/gimpimagedock.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c: removed leftover item factory
|
|
|
|
|
|
cruft.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: removed item factory typedefs...
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpitemfactory.h: ...and added them here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: added new function
|
|
|
|
|
|
gimp_action_group_add_plug_in_actions().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c: use it here instead of adding
|
|
|
|
|
|
the actions manually.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptoolbox.c: ported the code which dynamically
|
|
|
|
|
|
updates the tool button tooltips on accelerator changes to
|
|
|
|
|
|
GtkAction. Disabled the whole stuff because GTK+ lacks
|
|
|
|
|
|
gtk_action_get_accel_closure().
|
|
|
|
|
|
|
2004-05-01 15:43:15 -07:00
|
|
|
|
2004-05-02 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am: added a rule to generate gtkuimanager XML
|
|
|
|
|
|
files using an XSL transformation.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/menus.xsl: a simple XSLT to generate a menubar and a popup
|
|
|
|
|
|
menu with identical content.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml: removed this file from CVS ...
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml.in: ... and added this instead.
|
|
|
|
|
|
|
|
|
|
|
|
* HACKING: xsltproc is now needed to build from CVS.
|
|
|
|
|
|
|
2004-05-01 10:45:33 -07:00
|
|
|
|
2004-05-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: check for xmllint and xsltproc but don't require
|
|
|
|
|
|
these tools.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* tips/Makefile.am: simplified "validate" targets.
|
|
|
|
|
|
|
2004-04-30 12:14:37 -07:00
|
|
|
|
2004-04-30 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimprectselecttool.c: Cleanups.
|
|
|
|
|
|
(gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
|
|
|
|
|
|
bug #138103, which led to bug #140649.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/procedural_db.c (procedural_db_init_procs): Add missing
|
|
|
|
|
|
compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset.
|
|
|
|
|
|
|
2004-04-30 10:11:07 -07:00
|
|
|
|
2004-04-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/tool-options-menu.c: added casts to please the compiler.
|
|
|
|
|
|
|
2004-04-30 08:29:11 -07:00
|
|
|
|
2004-04-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: added signal "update" which
|
|
|
|
|
|
is G_SIGNAL_RUN_LAST, so handlers can hook in before and after
|
|
|
|
|
|
the default implementation. Update the action groups
|
|
|
|
|
|
in the default implementations.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_ui_manager_ui_get): make sure we always return a widget
|
|
|
|
|
|
by calling gtk_ui_manager_ensure_update().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.c (gimp_dockable_show_menu): make
|
|
|
|
|
|
sure the dockable menu is loaded before trying to access its
|
|
|
|
|
|
widgets/actions.
|
|
|
|
|
|
|
|
|
|
|
|
Resurrected the dynamic tool options menus:
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tool-options-actions.c: dynamically destroy/create
|
|
|
|
|
|
actions for the tool options' presets.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/tool-options-commands.[ch]: all callbacks are
|
|
|
|
|
|
GimpEnumAction::selected() callbacks now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/tool-options-menu.[ch]: connect and connect_after to
|
|
|
|
|
|
GimpUIManager::update(). Remove the old preset menu items
|
|
|
|
|
|
in the former callback, create the new ones in the latter.
|
|
|
|
|
|
Removed the last item factory entries.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c: changed accordingly.
|
|
|
|
|
|
|
2004-04-29 12:47:24 -07:00
|
|
|
|
2004-04-29 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/main.c: when glibc is used, call mallopt, so that memory
|
|
|
|
|
|
chunks >= 4k (= 64*64 pixels, 1bpp - the smallest full tile)
|
|
|
|
|
|
get allocated via mmap. This ensures that after closing an image
|
|
|
|
|
|
the memory allocated for image data gets returned to the system.
|
|
|
|
|
|
|
|
|
|
|
|
Thanks to Phil Blundell <pb@nexus.co.uk> for bringing mallopt
|
|
|
|
|
|
to my attention.
|
|
|
|
|
|
|
|
|
|
|
|
Please watch closely for performance problems.
|
|
|
|
|
|
|
2004-04-29 10:47:53 -07:00
|
|
|
|
2004-04-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/file-open-actions.[ch]
|
|
|
|
|
|
* app/actions/file-save-actions.[ch]: actions for the <Load> and
|
|
|
|
|
|
<Save> menus...
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/file-open-menu.xml
|
|
|
|
|
|
* menus/file-save-menu.xml: ...and the menus.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-menu.[ch]
|
|
|
|
|
|
* app/gui/file-save-menu.[ch]: ported to UI Manager.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.[ch]: ditto.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c
|
|
|
|
|
|
* app/gui/menus.c
|
|
|
|
|
|
* app/gui/file-open-dialog.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.c: removed debugging code which
|
|
|
|
|
|
automatically loaded all registered menus. They are now loaded on
|
|
|
|
|
|
demand only.
|
|
|
|
|
|
|
2004-04-29 09:47:53 -07:00
|
|
|
|
2004-04-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpbase/gimputils.[ch] (gimp_escape_uline): new function
|
|
|
|
|
|
which does the opposite of gimp_strip_uline().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c (file_actions_last_opened_update):
|
|
|
|
|
|
escape ulines in filenames so they don't end up as mnemonics.
|
|
|
|
|
|
Spotted by Pedro Gimeno.
|
|
|
|
|
|
|
2004-04-29 09:09:09 -07:00
|
|
|
|
2004-04-29 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/plug-ins/py-slice.py: Quick fix to make uppercase
|
|
|
|
|
|
tags work properly.
|
|
|
|
|
|
|
2004-04-29 06:19:28 -07:00
|
|
|
|
2004-04-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu
|
|
|
|
|
|
paths from the "menu_path". Will be renamed to "action_name" or
|
|
|
|
|
|
something soon...
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/dbbrowser/dbbrowser.c
|
|
|
|
|
|
* plug-ins/common/plugindetails.c
|
|
|
|
|
|
* plug-ins/common/uniteditor.c: register under the new
|
|
|
|
|
|
"Extensions" placeholder.
|
|
|
|
|
|
|
2004-04-29 05:52:29 -07:00
|
|
|
|
2004-04-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Switch from GtkItemFactory to GtkUIManager. The migration is
|
|
|
|
|
|
almost complete, still stuff missing/incomplete, definitely added
|
|
|
|
|
|
a bunch of new bugs...
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/*-commands.[ch]: converted all callback from
|
|
|
|
|
|
GtkItemFactory callbacks to GtkAction callbacks.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/debug-actions.c
|
|
|
|
|
|
* app/actions/gradient-editor-actions.c
|
|
|
|
|
|
* app/actions/help-actions.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c
|
|
|
|
|
|
* app/actions/qmask-actions.c
|
|
|
|
|
|
* app/actions/tool-options-actions.c: various fixes.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell-appearance.[ch]
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: move everything from
|
|
|
|
|
|
GtkItemFactory to GtkUIManager.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs.[ch]: added new function dialogs_get_toolbox().
|
|
|
|
|
|
Needed because the action callbacks don't have a widget parameter
|
|
|
|
|
|
and sometimes we need a parent window for showing dialogs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/brushes-menu.[ch]
|
|
|
|
|
|
* app/gui/buffers-menu.[ch]
|
|
|
|
|
|
* app/gui/channels-menu.[ch]
|
|
|
|
|
|
* app/gui/colormap-editor-menu.[ch]
|
|
|
|
|
|
* app/gui/dialogs-menu.[ch]
|
|
|
|
|
|
* app/gui/documents-menu.[ch]
|
|
|
|
|
|
* app/gui/error-console-menu.[ch]
|
|
|
|
|
|
* app/gui/fonts-menu.[ch]
|
|
|
|
|
|
* app/gui/gradient-editor-menu.[ch]
|
|
|
|
|
|
* app/gui/gradients-menu.[ch]
|
|
|
|
|
|
* app/gui/images-menu.[ch]
|
|
|
|
|
|
* app/gui/layers-menu.[ch]
|
|
|
|
|
|
* app/gui/palette-editor-menu.[ch]
|
|
|
|
|
|
* app/gui/palettes-menu.[ch]
|
|
|
|
|
|
* app/gui/patterns-menu.[ch]
|
|
|
|
|
|
* app/gui/qmask-menu.[ch]
|
|
|
|
|
|
* app/gui/templates-menu.[ch]
|
|
|
|
|
|
* app/gui/vectors-menu.[ch]: removed these files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c: create a global UI manager for the image popup
|
|
|
|
|
|
menu and the toolbox menubar.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.[ch]: removed all GtkItemFactory code.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/image-menu.[ch]
|
|
|
|
|
|
* app/gui/toolbox-menu.[ch]: removed everything except the trivial
|
|
|
|
|
|
setup_funcs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-open-menu.c
|
|
|
|
|
|
* app/gui/file-save-menu.c
|
|
|
|
|
|
* app/gui/tool-options-menu.c: don't use the macros from menus.h
|
|
|
|
|
|
any more, they are gone.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in
|
|
|
|
|
|
menu entries.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/
|
|
|
|
|
|
gimp_ui_manager_update/g
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: added API to get an action
|
|
|
|
|
|
group by name.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.c: don't choke on the item_factory
|
|
|
|
|
|
entries being NULL.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c: make sure booleans set using
|
|
|
|
|
|
g_object_set() only have TRUE or FALSE values.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.[ch]
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimpdockable.[ch]
|
|
|
|
|
|
* app/widgets/gimpdocked.[ch]
|
|
|
|
|
|
* app/widgets/gimpeditor.[ch]
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.c
|
|
|
|
|
|
* app/widgets/gimptoolbox.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory
|
|
|
|
|
|
code and enable the #if 0'ed UI manager stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/gradient-editor-menu.xml: fixed typos.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml: duplicate everything so we have both
|
|
|
|
|
|
an image menubar and an image popup menu. Badly cries for an
|
|
|
|
|
|
XSL processor.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/toolbox-menu.xml: added an "Extensions" placeholder.
|
|
|
|
|
|
|
2004-04-27 06:55:26 -07:00
|
|
|
|
2004-04-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimppluginaction.[ch]: new GtkAction subclass which
|
|
|
|
|
|
remembers the PlugInProcDef.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to
|
|
|
|
|
|
the GimpActionGroup struct and to gimp_action_group_new(). Removed
|
|
|
|
|
|
the user_data parameter from gimp_action_group_add_*_actions().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionfactory.[ch]: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/*-actions.[ch]: removed user_data from all setup_funcs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c: use a GimpPlugInAction and
|
|
|
|
|
|
finally use the right user_data for the callback so plug-in
|
|
|
|
|
|
callbacks have a proper context.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to
|
|
|
|
|
|
plug_in_menus_setup().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/image-menu.c
|
|
|
|
|
|
* app/gui/toolbox-menu.c: changed accordingly.
|
|
|
|
|
|
|
2004-04-27 05:51:08 -07:00
|
|
|
|
2004-04-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: removed "translation-domain"
|
|
|
|
|
|
property and simply use gettext(). Plug-In domains are handled
|
|
|
|
|
|
by plug-in-actions.c
|
|
|
|
|
|
|
|
|
|
|
|
The following change finally starts breaking the old menu system
|
|
|
|
|
|
while the new one is not fully in place yet. Have fun:
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml: added several <placeholder>s for plug-ins
|
|
|
|
|
|
to register their menu entries in the middle of already existing
|
|
|
|
|
|
menus.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c
|
|
|
|
|
|
* plug-ins/common/mail.c
|
|
|
|
|
|
* plug-ins/print/print.c
|
|
|
|
|
|
* plug-ins/script-fu/scripts/copy-visible.scm: use the new
|
|
|
|
|
|
placeholders to register menu entries.
|
|
|
|
|
|
|
2004-04-27 05:28:27 -07:00
|
|
|
|
2004-04-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Correctly translated & sorted plug-in actions & menu entries:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: added a "gchar *name" property
|
|
|
|
|
|
and a hash table which keeps all created UI managers (similar to
|
|
|
|
|
|
GimpActionGroup's hash table). Added function
|
|
|
|
|
|
gimp_ui_managers_from_name() which returns a list of all managers
|
|
|
|
|
|
with the given name.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.c: register a name per UI manager
|
|
|
|
|
|
and pass the name to gimp_ui_manager_new().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.c: added code which correctly
|
|
|
|
|
|
translates the created plug-in actions and also creates translated
|
|
|
|
|
|
menu actions for the plug-in's menu_path elements.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/plug-in-menus.[ch]: sort the plug-ins' menu entries
|
|
|
|
|
|
using a GTree. For each entry, recursivlely create submenus
|
|
|
|
|
|
from the dynamic menu actions created above before creating
|
|
|
|
|
|
the plug-in's menu entry itself.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/image-menu.c (image_menu_setup2)
|
|
|
|
|
|
* app/gui/toolbox-menu.c (toolbox_menu_setup2): call
|
|
|
|
|
|
plug_in_menus_create2().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c (gui_menus_create_entry)
|
|
|
|
|
|
(gui_menus_delete_entry): added some uglyness which maps old <Prefix>
|
|
|
|
|
|
menu identifiers to new-style UI manager plus ui_path tuples and
|
|
|
|
|
|
call plug_in_menus_add,remove_proc() accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml
|
|
|
|
|
|
* menus/toolbox-menu.xml: added name="Foo" attributes to all menus
|
|
|
|
|
|
so plug-in entries find their place.
|
|
|
|
|
|
|
2004-04-27 03:23:35 -07:00
|
|
|
|
2004-04-27 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.c (gui_restore_callback): call actions_init()
|
|
|
|
|
|
(gui_exit_after_callback): call actions_exit().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c (menus_init)
|
|
|
|
|
|
(menu_exit): don't call them here.
|
|
|
|
|
|
|
2004-04-26 08:51:21 -07:00
|
|
|
|
2004-04-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: added GimpUIManagerSetupFunc typedef.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: added the setup_func to the
|
|
|
|
|
|
GimpUIManagerUIEntry struct and to gimp_ui_manager_ui_register().
|
|
|
|
|
|
Call the setup_func after creating the UI. Replaced the term
|
|
|
|
|
|
"identifier" by "ui_path".
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.c: ditto.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c (menus_init): register the new setup_funcs below.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.[ch] (menus_open_recent_add)
|
|
|
|
|
|
* app/gui/image-menu.[ch] (image_menu_setup2)
|
|
|
|
|
|
* app/gui/toolbox-menu.[ch] (toolbox_menu_setup2): new setup_funcs
|
|
|
|
|
|
which add the "Open Recent" menu items.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/file-actions.c: removed "file-open-recent-empty"
|
|
|
|
|
|
action because it's not needed.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml
|
|
|
|
|
|
* menus/toolbox-menu.xml: removed "file-open-recent-empty" menu
|
|
|
|
|
|
items and added <placeholder>s for the "Open Recent" menu items.
|
|
|
|
|
|
|
2004-04-26 08:01:00 -07:00
|
|
|
|
2004-04-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.[ch]: removed "locale_domain" and "help_domain"
|
|
|
|
|
|
parameters from GimpMenusCreateFunc.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
|
|
|
|
|
|
* app/actions/plug-in-actions.[ch] (plug_in_actions_add_proc_def):
|
|
|
|
|
|
changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: remember all created action
|
|
|
|
|
|
groups is a hash table in GimpActionGroupClass. Added
|
|
|
|
|
|
gimp_action_groups_from_name() which returns a GList of all groups
|
|
|
|
|
|
with the given name.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.[ch] (plug_in_actions_setup):
|
|
|
|
|
|
removed the tree sorting code. Actions don't need to be ordered
|
|
|
|
|
|
alphabetically.
|
|
|
|
|
|
|
|
|
|
|
|
(plug_in_actions_update): copied & ported plug_in_menus_update().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui-vtable.c (gui_menus_create,delete_entry):
|
|
|
|
|
|
dynamically add/remove plug-in actions in all "plug-in" action
|
|
|
|
|
|
groups.
|
|
|
|
|
|
|
2004-04-25 01:22:22 -07:00
|
|
|
|
2004-04-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.[ch]: changed GimpMenusDeleteFunc to take
|
|
|
|
|
|
a PlugInProcDef* instead of a const gchar*.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.c
|
|
|
|
|
|
* app/gui/gui-vtable.c
|
|
|
|
|
|
* app/gui/plug-in-menus.[ch]: changed accordingly.
|
|
|
|
|
|
|
2004-04-24 15:18:47 -07:00
|
|
|
|
2004-04-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/AlienMap2.c: some UI improvements based on a
|
|
|
|
|
|
patch by William Skaggs (bug #140079).
|
|
|
|
|
|
|
2004-04-22 10:38:14 -07:00
|
|
|
|
2004-04-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs-constructors.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c: silent the compiler.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/winicon/icodialog.c: simplified by using a
|
|
|
|
|
|
GimpIntComboBox.
|
|
|
|
|
|
|
2004-04-22 10:14:22 -07:00
|
|
|
|
2004-04-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: remember and ref the created
|
|
|
|
|
|
widgets. Added gimp_ui_manager_ui_popup() which pops up a GtkMenu
|
|
|
|
|
|
with a custom GimpMenuPositionFunc and a GtkDestroyNotify which is
|
|
|
|
|
|
called on popdown.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.c (gimp_menu_factory_finalize):
|
|
|
|
|
|
don't forget to free the list of managed UIs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdockable.[ch]
|
|
|
|
|
|
* app/widgets/gimpdockbook.[ch]
|
|
|
|
|
|
* app/widgets/gimpdocked.[ch]
|
|
|
|
|
|
* app/widgets/gimpeditor.[ch]: added GimpUIManager stuff parallel
|
|
|
|
|
|
to the to-be-removed GtkItemFactory stuff.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainergridview.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.c
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c: changed accordingly and added
|
|
|
|
|
|
#if 0'ed code which actually uses all the UI managers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.c
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/gui/gui-vtable.c: disabled some gimp_ui_manager_update()
|
|
|
|
|
|
calls because they were invoking toggle and radio callbacks
|
|
|
|
|
|
which still have the wrong signature.
|
|
|
|
|
|
|
2004-04-22 09:56:27 -07:00
|
|
|
|
2004-04-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gflare/gflare.c: ported the last plug-in from
|
|
|
|
|
|
GtkOptionMenu to GimpIntComboBox.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/newsprint.c: changed a comment that was still
|
|
|
|
|
|
talking about option menus.
|
|
|
|
|
|
|
2004-04-22 09:18:40 -07:00
|
|
|
|
2004-04-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c (menus_init): fixed some typos in the UI Manager
|
|
|
|
|
|
registration code.
|
|
|
|
|
|
|
2004-04-22 09:16:43 -07:00
|
|
|
|
2004-04-22 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: implemented
|
|
|
|
|
|
gimp_action_group_set_action_color() and
|
|
|
|
|
|
gimp_action_group_set_action_viewable().
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/*-actions.c: added stock IDs to all actions which
|
|
|
|
|
|
represent toplevel popup menus. Fixed typos.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/brushes-menu.xml
|
|
|
|
|
|
* menus/colormap-editor-menu.xml
|
|
|
|
|
|
* menus/dockable-menu.xml
|
|
|
|
|
|
* menus/gradients-menu.xml
|
|
|
|
|
|
* menus/patterns-menu.xml
|
|
|
|
|
|
* menus/toolbox-menu.xml: fixed typos.
|
|
|
|
|
|
|
2004-04-22 08:54:59 -07:00
|
|
|
|
2004-04-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/rcm/rcm_callback.[ch]
|
|
|
|
|
|
* plug-ins/rcm/rcm_dialog.c: ported from GtkOptionMenu to
|
|
|
|
|
|
GimpIntComboBox.
|
|
|
|
|
|
|
2004-04-22 08:25:01 -07:00
|
|
|
|
2004-04-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintstore.[ch]: automatically add an "(Empty)"
|
|
|
|
|
|
item if the store is empty and remove it as soon as other items
|
|
|
|
|
|
are being added.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablecombobox.c
|
|
|
|
|
|
* libgimp/gimpimagecombobox.c: removed handling of the empty list;
|
|
|
|
|
|
the store does this for us now.
|
|
|
|
|
|
|
2004-04-21 18:27:30 -07:00
|
|
|
|
2004-04-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.c (gimp_int_combo_box_new):
|
|
|
|
|
|
removed the check for first_label != NULL. Passing a NULL label
|
|
|
|
|
|
makes a perfect empty combo_box.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/newsprint.c
|
|
|
|
|
|
* plug-ins/common/spheredesigner.c: ported from GtkOptioMenu to
|
|
|
|
|
|
GimpIntComboBox.
|
|
|
|
|
|
|
2004-04-21 16:09:16 -07:00
|
|
|
|
2004-04-22 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/flame/flame.c
|
|
|
|
|
|
* plug-ins/gimpressionist/brush.c: ported the last two users of
|
|
|
|
|
|
gimpmenu.h to GimpDrawableComboBox.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpmenu.[ch]: declared the functions found here as
|
|
|
|
|
|
deprecated.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/plugindetails.c
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c: silent the compiler.
|
|
|
|
|
|
|
2004-04-21 09:50:13 -07:00
|
|
|
|
2004-04-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablecombobox.c
|
|
|
|
|
|
* libgimp/gimpimagecombobox.c
|
|
|
|
|
|
* libgimp/gimpmenu.c: changed the label for the empty menu from
|
|
|
|
|
|
"None" to "Empty" since that's what GTK+ uses.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.[ch]: added convenience function
|
|
|
|
|
|
gimp_int_combo_box_connect().
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/bumpmap.c
|
|
|
|
|
|
* plug-ins/common/compose.c
|
|
|
|
|
|
* plug-ins/common/depthmerge.c
|
|
|
|
|
|
* plug-ins/common/displace.c
|
|
|
|
|
|
* plug-ins/common/lic.c
|
|
|
|
|
|
* plug-ins/common/warp.c: ported to GimpDrawableComboBox.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_ui.c
|
|
|
|
|
|
* plug-ins/common/sample_colorize.c: use
|
|
|
|
|
|
gimp_int_combo_box_connect(). This restores the correct behaviour
|
|
|
|
|
|
of setting the drawable_ID to the first drawable from the list if
|
|
|
|
|
|
it's invalid.
|
|
|
|
|
|
|
2004-04-21 09:33:17 -07:00
|
|
|
|
2004-04-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds
|
|
|
|
|
|
API to update all action groups and knows which UIs it can create
|
|
|
|
|
|
from which XML files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.[ch]: register the XML file
|
|
|
|
|
|
basenames along with path of their toplevel menus. Create
|
|
|
|
|
|
GimpUIManagers instead of GtkUIManagers and register the
|
|
|
|
|
|
XML files and menu paths with them.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c: register all XML files and their toplevel
|
|
|
|
|
|
menu paths.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpeditor.[ch]: also create a GimpUIManager when
|
|
|
|
|
|
creating the GtkItemFactory. Added "const gchar *ui_identifier"
|
|
|
|
|
|
parameter to gimp_editor_create_menu().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpcontainereditor.[ch]
|
|
|
|
|
|
* app/widgets/gimpdataeditor.[ch]
|
|
|
|
|
|
* app/widgets/gimpdatafactoryview.[ch]
|
|
|
|
|
|
* app/widgets/gimpitemtreeview.[ch]: added "ui_identifier"
|
|
|
|
|
|
parameters to all constructors.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpbrusheditor.c
|
|
|
|
|
|
* app/widgets/gimpbrushfactoryview.c
|
|
|
|
|
|
* app/widgets/gimpbufferview.c
|
|
|
|
|
|
* app/widgets/gimpcolormapeditor.c
|
|
|
|
|
|
* app/widgets/gimpcomponenteditor.c
|
|
|
|
|
|
* app/widgets/gimpcontainerpopup.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
* app/widgets/gimpfontview.c
|
|
|
|
|
|
* app/widgets/gimpgradienteditor.c
|
|
|
|
|
|
* app/widgets/gimpimageview.c
|
|
|
|
|
|
* app/widgets/gimppaletteeditor.c
|
|
|
|
|
|
* app/widgets/gimppatternfactoryview.c
|
|
|
|
|
|
* app/widgets/gimptemplateview.c
|
|
|
|
|
|
* app/widgets/gimptooloptionseditor.c
|
|
|
|
|
|
* app/gui/dialogs-constructors.c
|
|
|
|
|
|
* app/gui/gradient-select.c
|
|
|
|
|
|
* app/gui/palette-select.c
|
|
|
|
|
|
* app/gui/pattern-select.c: pass UI identifiers to the changed
|
|
|
|
|
|
functions above.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: added a GimpUIManager for
|
|
|
|
|
|
the menubar (menubar creating code still commented out).
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay.c
|
|
|
|
|
|
* app/gui/gui-vtable.c: update the ui manager.
|
|
|
|
|
|
|
2004-04-21 09:10:00 -07:00
|
|
|
|
2004-04-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/actions.c: forgot to register the "patterns" actions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/*-actions.c: added actions representing the toplevel
|
|
|
|
|
|
menus (popups and menubars). Fixed some typos.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/*-menu.xml: added action="foo" attributes to all toplevel
|
|
|
|
|
|
menus. Fixed typos here too.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/gtkuimanager.dtd: fixed possible attributes.
|
|
|
|
|
|
|
2004-04-21 05:14:01 -07:00
|
|
|
|
2004-04-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpmenu.c (gimp_menu_add_none): use the same label as
|
|
|
|
|
|
in the new combo_box widgets.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.[ch]
|
|
|
|
|
|
* libgimpwidgets/gimpintstore.[ch]: use LibGIMP copyright headers.
|
|
|
|
|
|
|
2004-04-21 04:51:21 -07:00
|
|
|
|
2004-04-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablecombobox.c
|
|
|
|
|
|
* libgimp/gimpimagecombobox.c
|
|
|
|
|
|
* libgimp/gimppixbuf.c
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.c
|
|
|
|
|
|
* libgimpwidgets/gimpintstore.c: API documentation.
|
|
|
|
|
|
|
2004-04-21 04:09:03 -07:00
|
|
|
|
2004-04-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.[ch]: added new functions
|
2004-04-21 04:21:51 -07:00
|
|
|
|
gimp_int_combo_box_[prepend|append].
|
2004-04-21 04:09:03 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/sample_colorize.c: ported to GimpDrawableComboBox.
|
|
|
|
|
|
|
2004-04-21 03:55:45 -07:00
|
|
|
|
2004-04-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/qmask-actions.c
|
|
|
|
|
|
* app/actions/qmask-commands.c: prepared qmask_actions_update()
|
|
|
|
|
|
and the qmask callbacks to be merged into the image ui manager.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/dialogs-actions.c
|
|
|
|
|
|
* app/actions/edit-actions.c
|
|
|
|
|
|
* app/actions/file-actions.c
|
|
|
|
|
|
* app/actions/image-actions.c
|
|
|
|
|
|
* app/actions/layers-actions.c
|
|
|
|
|
|
* app/actions/plug-in-actions.c
|
|
|
|
|
|
* app/actions/tools-actions.c
|
|
|
|
|
|
* app/actions/view-actions.c: fixed lots of typos and buglets
|
|
|
|
|
|
spotted in my first test run.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c: register the needed action groups with the
|
|
|
|
|
|
<Image> menu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimp-tools.c
|
|
|
|
|
|
* app/tools/gimpdodgeburntool.[ch]
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactionfactory.c
|
|
|
|
|
|
* app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g,
|
|
|
|
|
|
updated copyright header.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml: fixed typos and added the "Filters"
|
|
|
|
|
|
submenus.
|
|
|
|
|
|
|
2004-04-20 16:04:50 -07:00
|
|
|
|
2004-04-21 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
More unused action stuff:
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpactionfactory.[ch]: added a simple factory which
|
|
|
|
|
|
produces GimpActionGroups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: added an "update_func" member
|
|
|
|
|
|
to the GimpActionGroup struct. Added it as parameter to
|
|
|
|
|
|
gimp_action_group_new(). Added function gimp_action_group_update().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpmenufactory.[ch]: added an "action_factory"
|
|
|
|
|
|
member and constructor parameter. Added code to create
|
|
|
|
|
|
GtkUIManagers from registered action group identifiers.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/actions.[ch]: new files: create a
|
|
|
|
|
|
"global_action_factory" and register all action groups with it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.[ch]: added API to add/remove
|
|
|
|
|
|
plug-in procedure actions dynamically (unfinished).
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/menus.c (menus_init): call actions_init().
|
|
|
|
|
|
(menus_exit): call actions_exit().
|
|
|
|
|
|
|
2004-04-20 16:01:03 -07:00
|
|
|
|
2004-04-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_ui.c: ported to the new API.
|
|
|
|
|
|
|
2004-04-20 15:14:49 -07:00
|
|
|
|
2004-04-21 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/Makefile.am
|
|
|
|
|
|
* libgimp/gimpui.h
|
|
|
|
|
|
* libgimp/gimppixbuf.[ch]: new file that holds pixbuf accessors
|
|
|
|
|
|
to gimp data (drawable and image thumbnails for now).
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimpdrawablecombobox.[ch]
|
|
|
|
|
|
* libgimp/gimpimagecombobox.[ch]: new files with GimpIntComboBox
|
|
|
|
|
|
constructors for image, drawable, channel and layer menus.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c: use the new functions
|
|
|
|
|
|
instead of the gimpmenu API that is about to be deprecated.
|
|
|
|
|
|
|
2004-04-20 15:04:18 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail): removed
|
|
|
|
|
|
color cast. Merged from stable branch.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/fileops_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-04-20 12:06:37 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived
|
|
|
|
|
|
from GtkListStore, to be used by GimpIntComboBox and also by the
|
|
|
|
|
|
image and drawable menus.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.[ch]: derive from GimpIntStore,
|
|
|
|
|
|
removed API that is provided by the parent class.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox,
|
|
|
|
|
|
removed API that is provided by the parent class.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/resize-dialog.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c
|
|
|
|
|
|
* app/widgets/gimpcolorframe.c
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c
|
|
|
|
|
|
* app/widgets/gimpstrokeeditor.c: changed accordingly.
|
|
|
|
|
|
|
2004-04-20 10:51:49 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.[ch]
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.c: let the pixbuf renderer take care
|
|
|
|
|
|
of rendering the pixbuf from the stock_id.
|
|
|
|
|
|
|
2004-04-20 07:37:12 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpmemsizeentry.c
|
2004-04-20 07:57:44 -07:00
|
|
|
|
* modules/cdisplay_colorblind.c
|
2004-04-20 07:37:12 -07:00
|
|
|
|
* modules/cdisplay_proof.c: ported to GimpIntComboBox.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.[ch]: declared the gimp option_menu
|
|
|
|
|
|
API as deprecated and removed the code here.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpoldwidgets.[ch]: new files with deprecated
|
|
|
|
|
|
code, guarded with #ifndef GIMP_DISABLE_DEPRECATED ... #endif.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.h: added G_BEGIN_DECLS, G_END_DECLS.
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in (CPP_FLAGS): added -DGIMP_DISABLE_DEPRECATED.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-constructors.c: added a #warning and
|
|
|
|
|
|
#undef GIMP_DISABLE_DEPRECATED. The paint mode menu is the last
|
|
|
|
|
|
remaining user of gimp_int_option_menu_new().
|
|
|
|
|
|
|
2004-04-20 06:44:19 -07:00
|
|
|
|
2004-04-20 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/convert-dialog.[ch]: renamed convert_to_indexed()
|
|
|
|
|
|
to convert_dialog_new() and return the dialog. Removed
|
|
|
|
|
|
convert_to_rgb() and convert_to_grayscale().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/offset-dialog.[ch]: renamed offset_dialog_create()
|
|
|
|
|
|
to offset_dialog_new() and return the dialog.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* app/actions/drawable-commands.c
|
|
|
|
|
|
* app/actions/image-commands.c: changed accordingly.
|
|
|
|
|
|
|
2004-04-20 06:25:55 -07:00
|
|
|
|
2004-04-20 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/*-commands.[ch]: removed...
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/*-commands.[ch]: ...and added here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/*-menu.c
|
|
|
|
|
|
* app/gui/dialogs-constructors.c
|
|
|
|
|
|
* app/gui/gui.c
|
|
|
|
|
|
* app/gui/menus.c
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/*-actions.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/plug-in-actions.[ch]
|
|
|
|
|
|
* app/actions/tools-actions.[ch]: new files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: had to add more -u evilness because gui/
|
|
|
|
|
|
and actions/ have cyclic dependencies.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/image-menu.xml: added some more items.
|
|
|
|
|
|
|
2004-04-20 06:10:50 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-constructors.[ch]: added new function
|
|
|
|
|
|
gimp_paint_mode_menu_set_history().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/brush-select.c
|
|
|
|
|
|
* app/widgets/gimplayertreeview.c
|
|
|
|
|
|
* app/widgets/gimppropwidgets.c: use the new function instead of
|
|
|
|
|
|
the deprecated gimp_int_option_menu API.
|
|
|
|
|
|
|
2004-04-20 05:21:17 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/align_layers.c
|
|
|
|
|
|
* plug-ins/common/borderaverage.c
|
|
|
|
|
|
* plug-ins/common/channel_mixer.c
|
|
|
|
|
|
* plug-ins/common/gif.c
|
|
|
|
|
|
* plug-ins/common/mng.c
|
|
|
|
|
|
* plug-ins/flame/flame.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: ported remaining plug-ins to GimpIntComboBox.
|
|
|
|
|
|
|
2004-04-20 03:17:59 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/iwarp.c (iwarp_get_pixel): check tile != NULL
|
|
|
|
|
|
before unrefing it. Fixes bug #140554; merged from stable branch.
|
|
|
|
|
|
|
2004-04-20 01:35:36 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.c: added more sanity checks.
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.[ch]: added another GimpIntComboBox
|
|
|
|
|
|
constructor: gimp_int_combo_box_new_array().
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_ui.c
|
|
|
|
|
|
* plug-ins/common/CML_explorer.c: ported to GimpIntComboBox.
|
|
|
|
|
|
|
2004-04-19 17:01:57 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpwidgets/Makefile.am
|
|
|
|
|
|
* libgimpwidgets/gimpwidgets.h
|
|
|
|
|
|
* libgimpwidgets/gimpwidgetstypes.h
|
|
|
|
|
|
* libgimpwidgets/gimpintcombobox.[ch]: added new widget
|
|
|
|
|
|
GimpIntComboBox, a GtkComboBox with a simple list store to hold a
|
|
|
|
|
|
label and an associated integer value. This is going to replace
|
|
|
|
|
|
gimp_int_option_menu.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c
|
|
|
|
|
|
* plug-ins/print/gimp_main_window.c: ported these two plug-ins to
|
|
|
|
|
|
the newly added widget.
|
|
|
|
|
|
|
2004-04-19 15:22:26 -07:00
|
|
|
|
2004-04-20 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: removed unused return locations for menu
|
|
|
|
|
|
item pointers.
|
|
|
|
|
|
|
2004-04-19 13:10:05 -07:00
|
|
|
|
2004-04-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: set gimp_plugin_version, gimp_sysconf_version and
|
|
|
|
|
|
gimp_data_version to 2.1 so that the development version is
|
|
|
|
|
|
clearly separated from stable gimp 2.0.
|
|
|
|
|
|
|
2004-04-19 12:36:00 -07:00
|
|
|
|
2004-04-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/image-menu.xml
|
|
|
|
|
|
* menus/tool-options-menu.xml: more menus.
|
|
|
|
|
|
|
2004-04-19 09:23:22 -07:00
|
|
|
|
2004-04-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.c
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.c
|
|
|
|
|
|
* app/widgets/gimpenumstore.c: fixed inline docs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumaction.c: fixed property declaration.
|
|
|
|
|
|
|
2004-04-19 09:00:54 -07:00
|
|
|
|
2004-04-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/colormap-editor-commands.[ch]
|
|
|
|
|
|
* app/gui/debug-commands.[ch]
|
|
|
|
|
|
* app/gui/dockable-commands.[ch]
|
|
|
|
|
|
* app/gui/error-console-commands.[ch]
|
|
|
|
|
|
* app/gui/file-commands.[ch]
|
|
|
|
|
|
* app/gui/gradient-editor-commands.[ch]
|
|
|
|
|
|
* app/gui/help-commands.[ch]
|
|
|
|
|
|
* app/gui/qmask-commands.[ch]
|
|
|
|
|
|
* app/gui/tool-options-commands.[ch]: removed "guint action"
|
|
|
|
|
|
parameter from all callbacks which don't need it.
|
|
|
|
|
|
|
2004-04-19 08:36:27 -07:00
|
|
|
|
2004-04-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/gtkuimanager.dtd: added a DTD (basically copied from the
|
|
|
|
|
|
GTK+ API docs). Added a "validate" rule that allows to easily
|
|
|
|
|
|
validate the XML files.
|
|
|
|
|
|
|
|
|
|
|
|
* menus/*.xml: added a DOCTYPE declaration that refers to the
|
|
|
|
|
|
newly added DTD.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.[ch]:
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.c: documented the new API.
|
|
|
|
|
|
|
2004-04-19 08:19:14 -07:00
|
|
|
|
2004-04-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/actions-types.h: oops, forgot to commit this one.
|
|
|
|
|
|
|
2004-04-19 08:15:40 -07:00
|
|
|
|
2004-04-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
2004-04-19 08:16:15 -07:00
|
|
|
|
* menus/Makefile.am
|
2004-04-19 08:15:40 -07:00
|
|
|
|
* menus/toolbox-menu.xml: added the toolbox menu.
|
|
|
|
|
|
|
2004-04-19 07:54:24 -07:00
|
|
|
|
2004-04-19 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
More GtkAction stuff (still unused):
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: added new directories menus/ and app/actions/
|
|
|
|
|
|
|
|
|
|
|
|
* Makefile.am: build menus/
|
|
|
|
|
|
|
|
|
|
|
|
* menus/.cvsignore
|
|
|
|
|
|
* menus/Makefile.am
|
|
|
|
|
|
* menus/*-menu.xml: new files: XML menu descriptions for each menu
|
|
|
|
|
|
which is now defined in gui/*-menu.c.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/widgets-types.h: some typedefs for GimpActionGroup.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]: added a "Gimp" construct-only
|
|
|
|
|
|
property. Added APIs to set actions visible/sensitive/active
|
|
|
|
|
|
and an unimplemented stub for setting the action's color.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am: build actions/ and link libappactions.a
|
|
|
|
|
|
|
|
|
|
|
|
* app/actions/.cvsignore
|
|
|
|
|
|
* app/actions/Makefile.am
|
|
|
|
|
|
* app/actions/*-actions.[ch]: new files: GtkActions for each
|
|
|
|
|
|
*-commands.c file in gui/. Ported all "update" functions from the
|
|
|
|
|
|
*-menu.c files.
|
|
|
|
|
|
(everything completely unused, untested and partly #if 0'ed)
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.[ch]: for reasons of (action-) symmetry, added
|
|
|
|
|
|
API to raise/lower channels/vectors to top/bottom.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/channels-commands.[ch]
|
|
|
|
|
|
* app/gui/vectors-commands.[ch]: added callbacks for the new
|
|
|
|
|
|
to top/bottom functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/Makefile.am
|
|
|
|
|
|
* app/gui/dockable-commands.[ch]: new files split out of
|
|
|
|
|
|
dialogs-commands.[ch].
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/dialogs-commands.[ch]
|
|
|
|
|
|
* app/gui/dialogs-menu.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/edit-commands.[ch]: added edit_paste_into_cmd_callback()
|
|
|
|
|
|
and remove usage of "guint action".
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/image-menu.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/palette-editor-commands.[ch]: split
|
|
|
|
|
|
+palette_editor_new_color_cmd_callback() into separate callbacks
|
|
|
|
|
|
for adding from FG and BG.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/palette-editor-menu.c: changed accordingly.
|
|
|
|
|
|
|
2004-04-19 02:01:23 -07:00
|
|
|
|
2004-04-19 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/gimp-headers.scm
|
|
|
|
|
|
* plug-ins/script-fu/scripts/gimp-labels.scm: applied a patch from
|
|
|
|
|
|
William Skaggs which changes the sub menu title for the gimp web
|
|
|
|
|
|
theme to classic.gimp.org. Fixes bug #137036.
|
|
|
|
|
|
|
2004-04-18 17:08:53 -07:00
|
|
|
|
2004-04-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdrawabletreeview.c: removed unused includes.
|
|
|
|
|
|
|
2004-04-18 16:48:30 -07:00
|
|
|
|
2004-04-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.[ch]
|
|
|
|
|
|
* app/gui/preferences-dialog.c: replaced
|
|
|
|
|
|
gimp_prop_boolean_option_menu_new() with
|
|
|
|
|
|
gimp_prop_boolean_combo_box_new().
|
|
|
|
|
|
|
2004-04-18 15:38:45 -07:00
|
|
|
|
2004-04-19 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.[ch]: avoid unnecessary casts.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.[ch]: added an API that inserts a
|
|
|
|
|
|
GtkTreeModelFilter to make items invisible. This is a kludge to
|
2004-04-18 16:52:34 -07:00
|
|
|
|
workaround bug #135875.
|
2004-04-18 15:38:45 -07:00
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c
|
2004-04-18 16:53:31 -07:00
|
|
|
|
* app/widgets/gimphistogrameditor.c: use the new function to hide
|
|
|
|
|
|
channels that are not available.
|
2004-04-18 15:38:45 -07:00
|
|
|
|
|
2004-04-18 13:46:46 -07:00
|
|
|
|
2004-04-18 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c
|
|
|
|
|
|
(gimp_template_editor_constructor): use g_signal_connect_object()
|
|
|
|
|
|
instead of g_signal_connect(). Fixes bug #140315.
|
|
|
|
|
|
|
2004-04-18 11:11:36 -07:00
|
|
|
|
2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss_rle.c (gauss_rle): Oops, fixed my fix.
|
|
|
|
|
|
|
2004-04-18 10:29:43 -07:00
|
|
|
|
2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss_iir.c: Change tabs to spaces all over the
|
|
|
|
|
|
file, in preparation for other changes. Minor cleanup.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/gauss_rle.c (gauss_rle): Plug a leak with the
|
|
|
|
|
|
returned value from make_curve().
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tga.c (load_image): Fix a condition which was
|
|
|
|
|
|
preventing GRAYA images from loading.
|
|
|
|
|
|
|
2004-04-18 08:12:42 -07:00
|
|
|
|
2004-04-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumwidgets.[ch]: moved widget constructors that
|
|
|
|
|
|
don't use GimpEnumMenu from gimpenummenu.[ch] to these new files.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget
|
|
|
|
|
|
using GimpEnumStore; replaces GimpEnumMenu.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpenumstore.[ch]: added new function
|
|
|
|
|
|
gimp_enum_store_lookup_by_value().
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimppropwidgets.[ch]: replaced
|
|
|
|
|
|
gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/brush-select.[ch]
|
|
|
|
|
|
* app/gui/convert-dialog.c
|
|
|
|
|
|
* app/gui/layers-commands.c
|
|
|
|
|
|
* app/gui/preferences-dialog.c
|
|
|
|
|
|
* app/gui/resize-dialog.c
|
|
|
|
|
|
* app/tools/gimpblendoptions.c
|
|
|
|
|
|
* app/tools/gimpcolorbalancetool.c
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpcurvestool.c
|
|
|
|
|
|
* app/tools/gimplevelstool.c
|
|
|
|
|
|
* app/tools/gimpmagnifytool.c
|
|
|
|
|
|
* app/tools/gimppaintoptions-gui.c
|
|
|
|
|
|
* app/tools/gimpselectionoptions.c
|
|
|
|
|
|
* app/tools/gimptransformoptions.c
|
|
|
|
|
|
* app/widgets/gimpcolorframe.c
|
|
|
|
|
|
* app/widgets/gimpeditor.c
|
|
|
|
|
|
* app/widgets/gimpgrideditor.c
|
|
|
|
|
|
* app/widgets/gimphistogrameditor.c
|
|
|
|
|
|
* app/widgets/gimpstrokeeditor.c
|
|
|
|
|
|
* app/widgets/gimptemplateeditor.c
|
|
|
|
|
|
* app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
|
|
|
|
|
|
|
2004-04-17 18:20:26 -07:00
|
|
|
|
2004-04-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore,
|
|
|
|
|
|
a GtkListStore for enum values.
|
|
|
|
|
|
|
2004-04-17 16:33:17 -07:00
|
|
|
|
2004-04-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/print/gimp_main_window.c: replaced wrong use of
|
|
|
|
|
|
gimp_option_menu with gimp_int_option_menu.
|
|
|
|
|
|
|
2004-04-17 15:47:56 -07:00
|
|
|
|
2004-04-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/script-fu-scripts.c: use a GtkComboBox for
|
|
|
|
|
|
SF-OPTION.
|
|
|
|
|
|
|
2004-04-17 15:35:01 -07:00
|
|
|
|
2004-04-18 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/winicon/icodialog.c
|
|
|
|
|
|
* plug-ins/winicon/icosave.c: ported GtkOptionMenu to GtkComboBox.
|
|
|
|
|
|
|
2004-04-17 10:48:51 -07:00
|
|
|
|
2004-04-17 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-constructors.[ch]:
|
|
|
|
|
|
s/GtkSignalFunc/GCallback/
|
|
|
|
|
|
|
2004-04-16 19:06:59 -07:00
|
|
|
|
2004-04-17 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimphuesaturationtool.c
|
|
|
|
|
|
(gimp_hue_saturation_tool_dialog): resolved conflicting
|
|
|
|
|
|
mnemonic. Fixes bug #139868.
|
|
|
|
|
|
|
2004-04-16 17:14:35 -07:00
|
|
|
|
2004-04-17 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c (save_dialog): live preview doesn't
|
|
|
|
|
|
modify the undo history of the image anymore, label changed
|
|
|
|
|
|
accordingly. Fixes bug #140296.
|
|
|
|
|
|
|
2004-04-16 10:45:30 -07:00
|
|
|
|
2004-04-16 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/tile.c (tile): changed a call to
|
|
|
|
|
|
gimp_image_undo_enable to _undo_disable which was obviously the
|
|
|
|
|
|
intention of the author. Added a call to gimp_drawable_update to
|
|
|
|
|
|
get the previews refreshed.
|
|
|
|
|
|
|
2004-04-16 06:50:28 -07:00
|
|
|
|
2004-04-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcolorpickertool.c
|
|
|
|
|
|
* app/tools/gimpmeasuretool.c: don't use gtk_window_present() to
|
|
|
|
|
|
raise the tool dialog since it also moves the focus away from the
|
|
|
|
|
|
image window. Fixes the problem described in bug #139349.
|
|
|
|
|
|
|
2004-04-16 06:36:14 -07:00
|
|
|
|
2004-04-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcroptool.c: some code cleanup that I forgot to do
|
|
|
|
|
|
when applying the patch.
|
|
|
|
|
|
|
2004-04-16 06:19:54 -07:00
|
|
|
|
2004-04-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/helpbrowser/dialog.c (browser_dialog_load): present the
|
|
|
|
|
|
help browser window.
|
|
|
|
|
|
|
2004-04-16 05:35:29 -07:00
|
|
|
|
2004-04-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/helpbrowser/dialog.c: use a GtkComboBox instead of
|
|
|
|
|
|
GtkCombo and keep the history in a GtkListStore.
|
|
|
|
|
|
|
2004-04-16 05:09:46 -07:00
|
|
|
|
2004-04-16 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpmarshal.list: new marshaller VOID:STRING
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/Makefile.am
|
|
|
|
|
|
* app/widgets/widgets-types.h
|
|
|
|
|
|
* app/widgets/gimpactiongroup.[ch]
|
|
|
|
|
|
* app/widgets/gimpenumaction.[ch]
|
|
|
|
|
|
* app/widgets/gimpstringaction.[ch]: added some completely unused
|
|
|
|
|
|
GtkAction infrastructure.
|
|
|
|
|
|
|
2004-04-16 14:10:19 -07:00
|
|
|
|
2004-04-15 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/Makefile.am
|
|
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* configure.in: app, tools, and user dir bumped to version 2.1 names.
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimpfontlist.c: since we now depend on pango 1.4, we can
|
|
|
|
|
|
use pango_fc_font_description_from_pattern() instead of our
|
|
|
|
|
|
cut-n-paste function, gimp_font_list_font_desc_from_pattern().
|
|
|
|
|
|
|
2004-04-15 15:16:21 -07:00
|
|
|
|
2004-04-15 Tor Lillqvist <tml@iki.fi>
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-message.c (plug_in_handle_proc_install)
|
|
|
|
|
|
* app/plug-in/plug-in-proc.h (struct _PlugInProcDef)
|
|
|
|
|
|
* app/plug-in/plug-in-rc.c (plug_in_rc_write)
|
|
|
|
|
|
* app/plug-in/plug-ins.c (plug_ins_init): Make PDB procedures
|
|
|
|
|
|
(including their menu entries) installed during a plug-ins init()
|
|
|
|
|
|
phase show up. Add a flag to PlugInProcDef that tells whether the
|
|
|
|
|
|
proc was installed during the init() phase. Such procs aren't
|
|
|
|
|
|
saved to the pluginrc. Move the code that initializes plug-ins
|
|
|
|
|
|
that need initialization earlier, before the procs are added to
|
|
|
|
|
|
the PDB and menus are built. Fixes bug #139969.
|
|
|
|
|
|
|
2004-04-15 15:06:28 -07:00
|
|
|
|
2004-04-16 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl
|
|
|
|
|
|
* plug-ins/common/AlienMap.c: removed the AlienMap plug-in since
|
|
|
|
|
|
AlienMap2 duplicates its functionality.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/AlienMap2.c: applied patch from William Skaggs
|
|
|
|
|
|
with a couple of user interface improvements (bug #140079).
|
|
|
|
|
|
|
2004-04-15 14:09:23 -07:00
|
|
|
|
2004-04-15 Tor Lillqvist <tml@iki.fi>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpthumb/Makefile.am: For Win32, install gimpthumb.def, like
|
|
|
|
|
|
the .def files of the other libgimp* libs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/Makefile.am (INCLUDES): Add PANGOFT2_CFLAGS.
|
|
|
|
|
|
|
|
|
|
|
|
* gimp-zip.in: Put also libgimpthumb in the developer package.
|
|
|
|
|
|
|
2004-04-15 13:11:44 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/winicon/icodialog.c: fixed gtk+ includes, added a
|
|
|
|
|
|
warning that deprecated widgets are being used.
|
|
|
|
|
|
|
2004-04-15 11:39:48 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in
|
|
|
|
|
|
* plug-ins/Makefile.am
|
|
|
|
|
|
* plug-ins/winicon/Makefile.am
|
|
|
|
|
|
* plug-ins/winicon/icodialog.[ch]
|
|
|
|
|
|
* plug-ins/winicon/icoload.[ch]
|
|
|
|
|
|
* plug-ins/winicon/icosave.[ch]
|
|
|
|
|
|
* plug-ins/winicon/main.[ch]: added plug-in to load and save
|
|
|
|
|
|
Windows icon files. Plug-in written by Christian Kreibich, port to
|
|
|
|
|
|
GIMP-2.0 API by Gregor Riepl, massive code cleanup by me. Fixes
|
|
|
|
|
|
bug #139160.
|
|
|
|
|
|
|
2004-04-15 10:04:43 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdnd.c (gimp_dnd_data_source_add)
|
|
|
|
|
|
(gimp_dnd_data_source_remove): use the new dynamic GtkTargetList
|
|
|
|
|
|
based API for changing the widget's drag source types.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c (gimp_document_view_new): simply
|
|
|
|
|
|
call gimp_dnd_file_source_add() instead of duplicating the whole
|
|
|
|
|
|
GtkTargetEntry array insanity just for adding one source type.
|
|
|
|
|
|
|
2004-04-15 09:58:21 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/FractalExplorer/Dialogs.c
|
|
|
|
|
|
* plug-ins/flame/flame.c
|
|
|
|
|
|
* plug-ins/gfig/gfig.c: first plug-ins ported to GtkFileChooser.
|
|
|
|
|
|
|
2004-04-15 09:54:44 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/display/gimpdisplayshell.c
|
|
|
|
|
|
* app/widgets/gimpcontainertreeview.c: removed runtime version
|
|
|
|
|
|
checks and workarounds for bugs which are fixed in GTK+ 2.4.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.c
|
|
|
|
|
|
(gimp_file_dialog_selection_changed): added runtime check for GTK+
|
|
|
|
|
|
2.4.1 and work around GtkFileChooser's missing "update_preview"
|
|
|
|
|
|
functionality for multiple selections if the dependency is not
|
|
|
|
|
|
met.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
|
|
|
|
|
|
(gimp_menu_button_position): call gtk_menu_set_monitor() until
|
|
|
|
|
|
bug #139187 is fixed.
|
|
|
|
|
|
|
2004-04-15 09:28:26 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
|
|
|
|
|
|
instead of GtkFileSelection.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/file-dialog-utils.c
|
|
|
|
|
|
* app/gui/file-open-dialog.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gradients-commands.c
|
|
|
|
|
|
* app/gui/vectors-commands.c
|
|
|
|
|
|
* app/tools/gimpimagemaptool.c
|
|
|
|
|
|
* app/widgets/gimperrorconsole.c
|
|
|
|
|
|
* app/widgets/gimptexteditor.c
|
|
|
|
|
|
* libgimpwidgets/gimpfileentry.c: use file choosers instead of
|
|
|
|
|
|
file selectors.
|
|
|
|
|
|
|
2004-04-15 09:15:04 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: depend on glib 2.4.0, gtk+ 2.4.0, pangoft2 1.4.0
|
|
|
|
|
|
|
|
|
|
|
|
* app/sanity.c: changed accordingly.
|
|
|
|
|
|
|
2004-04-15 08:17:36 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpcropoptions.[ch]
|
|
|
|
|
|
* app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that
|
|
|
|
|
|
allows to keep the aspect ratio fixed.
|
|
|
|
|
|
|
2004-04-15 08:07:30 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayermask.c (gimp_layer_mask_class_init): set
|
|
|
|
|
|
translate_desc to "Move Layer Mask".
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c: take the undo desc
|
|
|
|
|
|
from the moved item's class instead of duplicating all
|
|
|
|
|
|
strings here.
|
|
|
|
|
|
|
2004-04-15 08:03:20 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimppalette-import.[ch]
|
|
|
|
|
|
* app/gui/palette-import-dialog.c: added palette import from RIFF
|
2004-05-11 06:41:12 -07:00
|
|
|
|
palette files based on a patch from ÃRDI Gergõ (bug #129788).
|
2004-04-15 08:03:20 -07:00
|
|
|
|
|
2004-04-15 07:58:42 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/xcf/xcf.c (xcf_save_invoker) (xcf_load_invoker): forgot
|
|
|
|
|
|
to add context parameters to this non-generated PDB invokers.
|
|
|
|
|
|
Fixes XCF loading/saving.
|
|
|
|
|
|
|
2004-04-15 07:41:36 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.[ch]: added "const gchar *stroke_desc" to
|
|
|
|
|
|
the GimpItemClass struct and always push an undo group
|
|
|
|
|
|
around GimpItem::stroke().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.c
|
|
|
|
|
|
* app/core/gimpselection.c
|
|
|
|
|
|
* app/vectors/gimpvectors.c: set the stroke_desc accordingly
|
|
|
|
|
|
and don't push undo groups.
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextlayer.c (gimp_text_layer_class_init): set
|
|
|
|
|
|
all of GimpItemClass' undo_descs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextlayer-transform.c: don't push undo groups here.
|
|
|
|
|
|
|
2004-04-15 07:17:51 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpcolor/gimpcolorspace.c (gimp_rgb_to_hsv): applied patch
|
|
|
|
|
|
from Marco Munari that removes a redundant "if" (bug #133540).
|
|
|
|
|
|
|
2004-04-15 07:14:10 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c: applied patch from Yeti that
|
|
|
|
|
|
adds spinbuttons instead of simple text entries (bug #138132).
|
|
|
|
|
|
|
2004-04-15 06:55:07 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/Makefile.am
|
|
|
|
|
|
* plug-ins/common/plugin-defs.pl
|
|
|
|
|
|
* plug-ins/common/gicon.c: removed the GIcon plug-in (addresses
|
|
|
|
|
|
one aspect of bug #139160).
|
|
|
|
|
|
|
2004-04-15 06:10:51 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Context cleanup continued:
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.[ch]: added context parameter to
|
|
|
|
|
|
GimpItem::stroke().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.c (gimp_channel_stroke)
|
|
|
|
|
|
* app/vectors/gimpvectors.c (gimp_vectors_stroke): use it to get
|
|
|
|
|
|
default values from instead of gimp_get_user_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpselection.c
|
|
|
|
|
|
* app/gui/stroke-dialog.c
|
|
|
|
|
|
* tools/pdbgen/pdb/edit.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/paths.pdb: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/edit_cmds.c
|
|
|
|
|
|
* app/pdb/paths_cmds.c: regenerated.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in.[ch]: added GimpContext member to the PlugIn
|
|
|
|
|
|
struct. Added context parameter to plug_in_new(),
|
|
|
|
|
|
plug_in_call_query() and plug_in_call_init().
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-run.[ch]: added context parameters to
|
|
|
|
|
|
plug_in_run() and plug_in_repeat().
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/plug-in-commands.c
|
|
|
|
|
|
* app/gui/vectors-commands.c
|
|
|
|
|
|
* app/pdb/procedural_db.c
|
|
|
|
|
|
* app/widgets/gimphelp.c: pass a context to plug_in_run() and
|
|
|
|
|
|
plug_in_repeat().
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): call
|
|
|
|
|
|
procedures with the plug-in's context.
|
|
|
|
|
|
|
|
|
|
|
|
* app/plug-in/plug-ins.c: use a temporary context for running the
|
|
|
|
|
|
plug-ins' query() and init() functions. Use the same context for
|
|
|
|
|
|
running automatic extensions. This temporarily separates the main
|
|
|
|
|
|
Script-Fu extension from the user context (i.e. scripts have no
|
|
|
|
|
|
way of setting/getting the global FG, BG, brush etc.).
|
|
|
|
|
|
|
2004-04-15 06:06:39 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* NEWS
|
|
|
|
|
|
* README: mention that this is the development branch.
|
|
|
|
|
|
|
2004-04-15 05:38:54 -07:00
|
|
|
|
2004-04-15 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/paint-funcs/paint-funcs.[ch]:
|
|
|
|
|
|
* app/paint-funcs/paint-funcs-generic.h: header cleanup, added
|
|
|
|
|
|
some const qualifiers, converted tabs to spaces. Fixes bug #140115
|
|
|
|
|
|
for the HEAD branch.
|
|
|
|
|
|
|
2004-04-14 16:37:34 -07:00
|
|
|
|
2004-04-15 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Get rid of the "current_context" which was in fact just a bunch of
|
|
|
|
|
|
global variables. Instead, pass the needed context all the way
|
|
|
|
|
|
from the GUI and the PDB to the core. This is a prerequisite for
|
|
|
|
|
|
macro recording and generally helps separating the various
|
|
|
|
|
|
subsystems from each other. Work in progress...
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp.[ch]: removed member "current_context" and
|
|
|
|
|
|
gimp_[get|set]_current_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-edit.[ch]
|
|
|
|
|
|
* app/core/gimpdrawable-blend.[ch]
|
|
|
|
|
|
* app/core/gimpdrawable-bucket-fill.[ch]
|
|
|
|
|
|
* app/core/gimpdrawable-offset.[ch]
|
|
|
|
|
|
* app/core/gimpdrawable-transform.[ch]
|
|
|
|
|
|
* app/core/gimpimage-crop.[ch]
|
|
|
|
|
|
* app/core/gimpimage-flip.[ch]
|
|
|
|
|
|
* app/core/gimpimage-merge.[ch]
|
|
|
|
|
|
* app/core/gimpimage-resize.[ch]
|
|
|
|
|
|
* app/core/gimpimage-rotate.[ch]
|
|
|
|
|
|
* app/core/gimpimage.[ch]
|
|
|
|
|
|
* app/core/gimpimagefile.[ch]
|
|
|
|
|
|
* app/core/gimpitem-linked.[ch]
|
|
|
|
|
|
* app/core/gimpitem.[ch]
|
|
|
|
|
|
* app/core/gimplayer.[ch]
|
|
|
|
|
|
* app/core/gimpselection.[ch]
|
|
|
|
|
|
* app/core/gimptemplate.[ch]
|
|
|
|
|
|
* app/file/file-open.[ch]
|
|
|
|
|
|
* app/file/file-save.[ch]
|
|
|
|
|
|
* app/pdb/procedural_db.[ch]
|
|
|
|
|
|
* app/text/gimptext-compat.[ch]
|
|
|
|
|
|
* app/text/gimptextlayer-transform.[ch]
|
|
|
|
|
|
* app/gui/brush-select.[ch]
|
|
|
|
|
|
* app/gui/font-select.[ch]
|
|
|
|
|
|
* app/gui/gradient-select.[ch]
|
|
|
|
|
|
* app/gui/palette-select.[ch]
|
|
|
|
|
|
* app/gui/pattern-select.[ch]: added tons of "GimpContext *context"
|
|
|
|
|
|
parameters and use the passed context instead of
|
|
|
|
|
|
gimp_get_current_context().
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.c
|
|
|
|
|
|
* app/batch.c
|
|
|
|
|
|
* app/core/gimpchannel.c
|
|
|
|
|
|
* app/core/gimpdrawable.c
|
|
|
|
|
|
* app/paint/gimperaser.c
|
|
|
|
|
|
* app/paint/gimppaintbrush.c
|
|
|
|
|
|
* app/plug-in/plug-in-message.c
|
|
|
|
|
|
* app/plug-in/plug-ins.c
|
|
|
|
|
|
* app/text/gimptextlayer.c
|
|
|
|
|
|
* app/tools/gimpblendtool.c
|
|
|
|
|
|
* app/tools/gimpbucketfilltool.c
|
|
|
|
|
|
* app/tools/gimpcroptool.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
* app/tools/gimpfliptool.c
|
|
|
|
|
|
* app/tools/gimpinktool.c
|
|
|
|
|
|
* app/tools/gimptransformtool.c
|
|
|
|
|
|
* app/vectors/gimpvectors.c
|
|
|
|
|
|
* app/gui/convert-dialog.c
|
|
|
|
|
|
* app/gui/drawable-commands.c
|
|
|
|
|
|
* app/gui/edit-commands.c
|
|
|
|
|
|
* app/gui/file-commands.c
|
|
|
|
|
|
* app/gui/file-new-dialog.c
|
|
|
|
|
|
* app/gui/file-open-dialog.c
|
|
|
|
|
|
* app/gui/file-save-dialog.c
|
|
|
|
|
|
* app/gui/image-commands.c
|
|
|
|
|
|
* app/gui/layers-commands.c
|
|
|
|
|
|
* app/gui/offset-dialog.c
|
|
|
|
|
|
* app/gui/select-commands.c
|
|
|
|
|
|
* app/gui/vectors-commands.c
|
|
|
|
|
|
* app/widgets/gimpdnd.c
|
|
|
|
|
|
* app/widgets/gimpdocumentview.c
|
|
|
|
|
|
* app/widgets/gimphelp.c
|
|
|
|
|
|
* app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or
|
|
|
|
|
|
GIMP_CONTEXT(tool_options) or whatever is the right context
|
|
|
|
|
|
to the changed core functions.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/app.pl: pass "GimpContext *context" to all
|
|
|
|
|
|
generated PDB invokers.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/brush_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/brushes.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/drawable.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/edit.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/font_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/gradient_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/gradients.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/image.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/layer.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/paint_tools.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/palette.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/palette_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/palettes.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/paths.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/pattern_select.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/patterns.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/selection.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/text_tool.pdb
|
|
|
|
|
|
* tools/pdbgen/pdb/transform_tools.pdb: pass the new context
|
|
|
|
|
|
parameter to the changed core functions.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/*_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-05-11 06:41:12 -07:00
|
|
|
|
2004-04-14 Raphaël Quinet <quinet@gamers.org>
|
2004-04-14 14:45:43 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/copy-visible.scm: New version of the
|
|
|
|
|
|
script that works on a temporary copy of the image instead of
|
|
|
|
|
|
copying the visible layers. Fixes bug #139989.
|
|
|
|
|
|
|
2004-04-14 08:11:12 -07:00
|
|
|
|
2004-04-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/film.c: fixed typo (bug #140039).
|
|
|
|
|
|
|
2004-04-13 16:39:03 -07:00
|
|
|
|
2004-04-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: bumped version to 2.1.0, interface age 0, binary
|
|
|
|
|
|
age 0. Changed library versioning to include gimp_minor_version
|
|
|
|
|
|
similar to how gtk+ does it.
|
|
|
|
|
|
|
2004-04-13 16:00:15 -07:00
|
|
|
|
2004-04-14 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Made 2.0.1 release.
|
|
|
|
|
|
|
2004-05-11 06:41:12 -07:00
|
|
|
|
2004-04-13 Raphaël Quinet <quinet@gamers.org>
|
2004-04-13 14:32:10 -07:00
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/mng.c (query, run): Workaround for bug #139947:
|
|
|
|
|
|
do not register the plug-in for INDEXED* modes and do not declare
|
|
|
|
|
|
that it can handle INDEXED images in gimp_export_image(). This
|
|
|
|
|
|
forces a conversion to RGB instead of generating broken indexed
|
|
|
|
|
|
images. The generation of correct indexed MNG files is likely to
|
|
|
|
|
|
require a newer release of libmng.
|
|
|
|
|
|
(mng_data): Set default compression level to 9 instead of 6.
|
|
|
|
|
|
|
2004-04-13 13:40:28 -07:00
|
|
|
|
2004-04-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_cern_parse.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_csim_parse.c
|
|
|
|
|
|
* plug-ins/imagemap/imap_ncsa_parse.c: regenerated using GNU Bison
|
|
|
|
|
|
version 1.875a. Fixes bug #139894.
|
|
|
|
|
|
|
2004-04-13 09:42:03 -07:00
|
|
|
|
2004-04-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/gimp-remote.c: reverted last change and go back to the
|
|
|
|
|
|
solution using fork(). Hopefully fixes bug #139158 this time.
|
|
|
|
|
|
|
2004-04-13 08:07:30 -07:00
|
|
|
|
2004-04-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-utils.[ch] (gimp_get_default_language): added a
|
|
|
|
|
|
category parameter to make this function more flexible.
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptext.c: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp.c (gimp_help): localize the help pages
|
|
|
|
|
|
according to the value of LC_MESSAGES. Fixes bug #139917.
|
|
|
|
|
|
|
2004-04-13 06:54:54 -07:00
|
|
|
|
2004-04-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Moved the calls to floating_sel_relax()/rigor() from various
|
|
|
|
|
|
places to two single spots in the core where they are actually
|
|
|
|
|
|
needed. Fixes bug #138356 (which was caused by the projection
|
|
|
|
|
|
being triggered in the middle of changing the floating selection's
|
|
|
|
|
|
size or the size of the drawable it is attached to). This commit
|
|
|
|
|
|
effectively removes floating selection fiddling from the core's
|
|
|
|
|
|
public API.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new
|
|
|
|
|
|
function which returns TRUE if there is a floating selection
|
|
|
|
|
|
attached to the drawable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable.c (gimp_drawable_translate)
|
|
|
|
|
|
(gimp_drawable_set_tiles_full): if the drawable *has* a floating
|
|
|
|
|
|
selection, relax/rigor it before/after modifying the drawable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayer.c (gimp_layer_translate)
|
|
|
|
|
|
(gimp_layer_set_tiles): if the layer *is* the floating selection,
|
|
|
|
|
|
relax/rigor it before/after modifying it.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.c
|
|
|
|
|
|
* app/core/gimpimage-convert.c
|
|
|
|
|
|
* app/core/gimpimage-crop.c
|
|
|
|
|
|
* app/core/gimpimage-flip.c
|
|
|
|
|
|
* app/core/gimpimage-resize.c
|
|
|
|
|
|
* app/core/gimpimage-rotate.c
|
|
|
|
|
|
* app/core/gimpimage-scale.c
|
|
|
|
|
|
* app/gui/layers-commands.c
|
|
|
|
|
|
* app/tools/gimpeditselectiontool.c
|
|
|
|
|
|
* tools/pdbgen/pdb/layer.pdb: removed calls to
|
|
|
|
|
|
floating_sel_rigor()/relax() all over the place. Also removed
|
|
|
|
|
|
lots of undo groups which are obsolete now.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/layer_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-04-13 06:01:08 -07:00
|
|
|
|
2004-04-13 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/imagemap/imap_file.c (do_file_error_dialog): convert
|
|
|
|
|
|
the filename to UTF-8 before displaying it.
|
|
|
|
|
|
|
2004-04-13 04:43:27 -07:00
|
|
|
|
2004-04-13 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
GimpItem undo group cleanup in preparation of fixing bug #138356:
|
|
|
|
|
|
|
2004-04-13 06:54:54 -07:00
|
|
|
|
* app/core/core-enums.[ch]: renamed LAYER_SCALE and LAYER_RESIZE
|
2004-04-13 04:43:27 -07:00
|
|
|
|
undo groups to ITEM_SCALE and ITEM_RESIZE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.[ch]: always push undo groups around
|
|
|
|
|
|
GimpItem::translate(), scale(), resize(), flip(), rotate() and
|
|
|
|
|
|
transform(). Added the resp. undo_desc strings to GimpItemClass.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpchannel.[ch]
|
|
|
|
|
|
* app/core/gimpdrawable.[ch]
|
|
|
|
|
|
* app/core/gimplayer.c: removed all undo groups from
|
|
|
|
|
|
implementations of the above methods. Removed the undo_desc
|
|
|
|
|
|
strings which were moved to GimpItemClass.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-crop.c
|
|
|
|
|
|
* app/core/gimpselection.c
|
|
|
|
|
|
* app/gui/layers-commands.c
|
|
|
|
|
|
* app/vectors/gimpvectors.c
|
|
|
|
|
|
* tools/pdbgen/pdb/layer.pdb: changed accordingly.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/layer_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-04-12 11:25:57 -07:00
|
|
|
|
2004-04-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: cleaned up the check for Xmu. Include <gdk/gdkx.h>
|
|
|
|
|
|
when testing for Xmu.h. Fixes bug #139803.
|
|
|
|
|
|
|
2004-04-12 02:51:15 -07:00
|
|
|
|
2004-04-12 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimpmath/Makefile.am: remove test-md5 on make clean.
|
|
|
|
|
|
|
2004-04-11 10:00:39 -07:00
|
|
|
|
2004-04-11 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/pygimp/plug-ins/py-slice.py: When using a separate dir for
|
|
|
|
|
|
images, actually prepend the dir to the img srcs in the html. Allow
|
|
|
|
|
|
only horizontal or vertical guides in an image, do not require both.
|
|
|
|
|
|
A bit smarter path handling. Addresses most of bug #138714.
|
|
|
|
|
|
|
2004-04-11 08:21:09 -07:00
|
|
|
|
2004-04-11 Hans Breuer <hans@breuer.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/makefile.msc : build sanity.obj
|
|
|
|
|
|
app/text/makefile.msc : gimptextundo.obj
|
|
|
|
|
|
app/widgets/makefile.msc : gimppatternfactoryview.obj
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/winclipboard.c : don't call
|
|
|
|
|
|
gimp_image_undo_enable() when it's not switched off.
|
|
|
|
|
|
Otherwise the undo history would be destroyed with
|
|
|
|
|
|
Gimp-Core-CRITICAL **: file gimpimage.c: line 1579: assertion
|
|
|
|
|
|
`gimage->undo_freeze_count > 0' failed
|
|
|
|
|
|
|
2004-04-10 11:11:00 -07:00
|
|
|
|
2004-04-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo
|
|
|
|
|
|
group only when it's needed. This resurrects text undo compression
|
|
|
|
|
|
that broke when bug #137767 got fixed.
|
|
|
|
|
|
|
2004-04-10 07:23:22 -07:00
|
|
|
|
2004-04-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* docs/gimp-remote.1.in: updated example URL.
|
|
|
|
|
|
|
2004-04-10 04:23:22 -07:00
|
|
|
|
2004-04-10 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.c
|
|
|
|
|
|
(gimp_drawable_transform_tiles_affine): Applied patch from William
|
|
|
|
|
|
Skaggs that addresses bug #120490.
|
|
|
|
|
|
|
|
|
|
|
|
* app/sanity.c (sanity_check): Modified the message that reports
|
|
|
|
|
|
an old version of Fontconfig in an attempt to make it more
|
|
|
|
|
|
informative.
|
|
|
|
|
|
|
2004-04-10 03:25:36 -07:00
|
|
|
|
2004-04-10 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/gimp-remote.c (start_new_gimp): reverted the last change
|
|
|
|
|
|
and did a different fix that involves closing the X display before
|
|
|
|
|
|
starting gimp (bug #139158).
|
|
|
|
|
|
|
2004-04-09 11:38:48 -07:00
|
|
|
|
2004-04-09 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: Uglier workaround for bug #138357, since
|
|
|
|
|
|
the previous one did break error handling. Fixes bug #139571.
|
|
|
|
|
|
|
2004-04-09 05:13:48 -07:00
|
|
|
|
2004-04-09 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* README.i18n: s/14/20/ plus whitespace clean-up.
|
|
|
|
|
|
|
2004-04-08 09:05:27 -07:00
|
|
|
|
2004-04-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/siod-wrapper.c: applied a patch from Kevin
|
|
|
|
|
|
Cozens that makes the Script-Fu PDB marshaller handle NULL
|
|
|
|
|
|
strings. Some minor code cleanup. Fixes bug #139386.
|
|
|
|
|
|
|
2004-04-08 08:19:44 -07:00
|
|
|
|
2004-04-08 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/gimp-remote.c (start_new_gimp): applied a patch from
|
|
|
|
|
|
Michael Matz that calls fork() before starting gimp. This is to
|
|
|
|
|
|
avoid X server authentification problems (bug #139158).
|
|
|
|
|
|
|
2004-04-07 01:15:06 -07:00
|
|
|
|
2004-04-07 Henrik Brix Andersen <brix@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in (ALL_LINGUAS): revert addition of "is" until all
|
|
|
|
|
|
.po files are there.
|
|
|
|
|
|
|
2004-05-11 06:41:12 -07:00
|
|
|
|
2004-04-07 Samúel Jón Gunnarsson <sammi@techattack.nu>
|
2004-04-06 19:05:15 -07:00
|
|
|
|
|
|
|
|
|
|
* configure.in: Added "is" to ALL_LINGUAS
|
|
|
|
|
|
|
2004-05-11 06:41:12 -07:00
|
|
|
|
2004-04-06 Iñaki Larrañaga <dooteo@euskalgnu.org>
|
2004-04-06 10:47:24 -07:00
|
|
|
|
|
|
|
|
|
|
* configure.in: Added "eu" (Basque) to ALL_LINGUAS.
|
|
|
|
|
|
|
2004-04-05 14:35:03 -07:00
|
|
|
|
2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/copy-visible.scm: Use
|
|
|
|
|
|
gimp-image-get-active-layer/channel instead of the passed
|
|
|
|
|
|
drawable for later restoring the initially active layer/channel.
|
|
|
|
|
|
Addresses bug #138662.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/drop-shadow.scm: Add a call to
|
|
|
|
|
|
gimp-image-set-active-layer in order for it to fail early instead
|
|
|
|
|
|
of failing with the undo group open in case the drawable is not
|
|
|
|
|
|
suitable for applying the effect.
|
|
|
|
|
|
|
2004-04-05 08:38:26 -07:00
|
|
|
|
2004-04-05 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage.c (gimp_image_real_mode_changed): update the
|
|
|
|
|
|
whole image.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplay-handlers.c: removed obsolete
|
|
|
|
|
|
"mode_changed" and "colormap_changed" handlers because GimpImage's
|
|
|
|
|
|
default handlers already update the whole image.
|
|
|
|
|
|
|
2004-04-05 01:08:23 -07:00
|
|
|
|
2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es>
|
|
|
|
|
|
|
|
|
|
|
|
Sanitize rectangle and ellipse selection handling (bug #138237
|
|
|
|
|
|
and bug #138103):
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimprectselecttool.h
|
|
|
|
|
|
* app/tools/gimprectselecttool.c (GimpRectSelectTool): new
|
|
|
|
|
|
member "moved" indicating whether the cursor was moved after
|
|
|
|
|
|
the click.
|
|
|
|
|
|
(gimp_rect_select_tool_coords_to_integer): New function for
|
|
|
|
|
|
consistent conversion of the rectangle FP coords to pixels.
|
|
|
|
|
|
(gimp_rect_select_tool_button_press,
|
|
|
|
|
|
gimp_rect_select_tool_button_release,
|
|
|
|
|
|
gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use
|
|
|
|
|
|
it instead of fiddling with the FP coordinates. Update "moved"
|
|
|
|
|
|
and use it to detect whether the selection needs to be cleared.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpellipseselecttool.c
|
|
|
|
|
|
(gimp_ellipse_select_tool_draw): use the new coords_to_integer
|
|
|
|
|
|
function.
|
|
|
|
|
|
|
2004-04-04 17:35:46 -07:00
|
|
|
|
2004-04-05 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_ui.c: applied the second patch
|
|
|
|
|
|
attached to bug #138788 by William Skaggs. Removes some user
|
|
|
|
|
|
interface elements that have no corresponding implementation and
|
|
|
|
|
|
fixes preview updates.
|
|
|
|
|
|
|
2004-04-04 17:17:57 -07:00
|
|
|
|
2004-04-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Makefile.am
|
|
|
|
|
|
* NEWS.pre-2-0: moved old NEWS to this new file.
|
|
|
|
|
|
|
|
|
|
|
|
* NEWS: list bugs fixed since 2.0.0.
|
|
|
|
|
|
|
2004-04-04 12:23:30 -07:00
|
|
|
|
2004-04-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Makefile.am
|
|
|
|
|
|
* docs/Makefile.am: don't install gimptool symlinks to
|
|
|
|
|
|
gimptool-2.0 and its manpage. gimp.m4 as installed with gimp-1.2
|
|
|
|
|
|
looks for gimptool (bug #139024).
|
|
|
|
|
|
|
2004-04-04 10:17:40 -07:00
|
|
|
|
2004-04-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-callbacks.c
|
|
|
|
|
|
* app/display/gimpdisplayshell-draw.[ch] pass the bounding box of
|
|
|
|
|
|
the exposed area to gimp_display_shell_draw_grid() and draw only
|
2004-04-04 12:23:30 -07:00
|
|
|
|
the relevant part of the grid. Fixes bug #138081.
|
2004-04-04 10:17:40 -07:00
|
|
|
|
|
2004-04-04 08:53:21 -07:00
|
|
|
|
2004-04-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
Cache the GC for drawing the grid as suggested in bug #138081:
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell.[ch]: added a grid_gc member to
|
|
|
|
|
|
GimpDisplayShell.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-handlers.c
|
|
|
|
|
|
(gimp_display_shell_grid_notify_handler)
|
|
|
|
|
|
(gimp_display_shell_disconnect): invalidate the grid GC.
|
|
|
|
|
|
|
|
|
|
|
|
* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
|
|
|
|
|
|
use the cached grid_gc. Also applied the fix that Pedro Gimeno did
|
|
|
|
|
|
for bug #138606.
|
|
|
|
|
|
|
2004-04-04 03:56:57 -07:00
|
|
|
|
2004-04-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpundo.c (gimp_undo_type_to_name): added a missing
|
|
|
|
|
|
call to gettext(). Fixes bug #139000.
|
|
|
|
|
|
|
2004-04-03 17:12:32 -08:00
|
|
|
|
2004-04-03 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* gimptool-2.0.in: Create any directories in the install path that do
|
|
|
|
|
|
not already exist. Fixes bug #138980.
|
|
|
|
|
|
|
|
|
|
|
|
* docs/gimptool.1.in: s/dont/don't/g
|
|
|
|
|
|
|
2004-04-03 15:17:59 -08:00
|
|
|
|
2004-04-04 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimagemap.c (gimp_image_map_apply): do nothing if the
|
|
|
|
|
|
selection is empty. Fixes bug #138973.
|
|
|
|
|
|
|
2004-04-03 04:03:27 -08:00
|
|
|
|
2004-04-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextlayer.c (gimp_text_layer_new): create the
|
|
|
|
|
|
initial text layer with a size of 1 x 1 since tile_manager_new()
|
|
|
|
|
|
does not any longer accept 0 x 0.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable.c (gimp_drawable_configure): check that
|
|
|
|
|
|
width and height are > 0.
|
|
|
|
|
|
|
2004-04-02 15:45:36 -08:00
|
|
|
|
2004-04-03 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/Lighting/lighting_main.c
|
|
|
|
|
|
* plug-ins/Lighting/lighting_shade.c: applied the first of two
|
|
|
|
|
|
patches attached to bug #138788 by William Skaggs.
|
|
|
|
|
|
|
2004-04-02 12:50:07 -08:00
|
|
|
|
2004-04-02 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/whirlpinch.c: set a proper pixelfetcher
|
|
|
|
|
|
edge mode for bigger radii. Avoids getting garbage at the
|
|
|
|
|
|
image borders.
|
|
|
|
|
|
|
2004-04-02 01:41:42 -08:00
|
|
|
|
2004-04-02 Dave Neary <bolsh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c: Added .jpe to the list of extensions
|
|
|
|
|
|
that the jpeg plug-in recognises. Fixes bug #138776.
|
|
|
|
|
|
|
2004-04-01 10:43:42 -08:00
|
|
|
|
2004-04-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/user-install-dialog.c: unset the bg_pixmap and tweak
|
|
|
|
|
|
style colors for all states. Sort of ugly but makes the dialog
|
|
|
|
|
|
work better with more obscure themes (bug #138379).
|
|
|
|
|
|
|
2004-04-01 09:28:15 -08:00
|
|
|
|
2004-04-01 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/kernelgen.c: updated a comment.
|
|
|
|
|
|
|
2004-04-01 06:51:58 -08:00
|
|
|
|
2004-04-01 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/core-enums.[ch] (enum GimpUndoType): added undo type
|
|
|
|
|
|
GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
|
|
|
|
|
|
GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo-push.[ch]: added new new function
|
|
|
|
|
|
gimp_image_undo_push_text_layer_modified() which makes
|
|
|
|
|
|
modifications of the text_layer's "modified" boolean undoable.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable.[ch]: added new virtual function
|
|
|
|
|
|
GimpDrawable::push_undo() and moved the actual undo pushing into
|
|
|
|
|
|
the default implementation gimp_drawable_real_push_undo().
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimptextlayer.c (gimp_text_layer_push_undo): new
|
|
|
|
|
|
function. Pushes the text_layer's modified state to the undo stack
|
|
|
|
|
|
after upchaining and sets modified to TRUE.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_text_layer_set_tiles): ditto.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_lext_layer_apply_region)
|
|
|
|
|
|
(gimp_text_layer_replace_region): removed because their default
|
|
|
|
|
|
implementations already call gimp_drawable_push_undo().
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_text_layer_swap_pixels): removed because swap_pixels() is
|
|
|
|
|
|
used by undo only and doesn't need to care about the text_layer's
|
|
|
|
|
|
modified state.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_text_layer_render): don't set modified to FALSE here because
|
|
|
|
|
|
we can't push an undo step here.
|
|
|
|
|
|
|
|
|
|
|
|
(gimp_text_layer_set): push the modified state to the undo stack
|
|
|
|
|
|
and set it to FALSE here. Also push the layer's tiles if the
|
|
|
|
|
|
layer was modified.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified"
|
|
|
|
|
|
to the undo stack and set it to FALSE here, too.
|
|
|
|
|
|
|
|
|
|
|
|
Fixes bug #137767.
|
|
|
|
|
|
|
2004-03-31 06:21:36 -08:00
|
|
|
|
2004-03-31 Simon Budig <simon@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptransformtool.c: One really should use braces
|
|
|
|
|
|
when mixing additions and multiplication and the operator
|
|
|
|
|
|
precedence is not the desired one...
|
|
|
|
|
|
|
|
|
|
|
|
I feel stupid... :-)
|
|
|
|
|
|
|
2004-03-31 04:40:23 -08:00
|
|
|
|
2004-03-31 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimp-transform-utils.c
|
|
|
|
|
|
(gimp_transform_matrix_perspective): make sure 0.0/0.0 results
|
|
|
|
|
|
in 1.0, not NaN.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.c
|
|
|
|
|
|
(gimp_drawable_transform_tiles_affine): instead of returning NULL
|
|
|
|
|
|
if the transformation shrinks the tiles completely away, return at
|
|
|
|
|
|
least the pixel (or the row or column of pixels) which best covers
|
|
|
|
|
|
the sub-pixel area of the transform result:
|
|
|
|
|
|
|
|
|
|
|
|
- Changed rounding of the transformed coordinates from RINT()
|
|
|
|
|
|
to floor()/ceil() so we don't cut off sub-pixel portions of the
|
|
|
|
|
|
transform result.
|
|
|
|
|
|
- Force the minimal size if the changed rounding didn't help.
|
|
|
|
|
|
|
|
|
|
|
|
Fixes bug #138117.
|
|
|
|
|
|
|
|
|
|
|
|
Also added paranoia code which falls back to clip_result if the
|
|
|
|
|
|
passed matrix produces NaN coordinates (copied the FINITE() macro
|
|
|
|
|
|
from image_cmds.c).
|
|
|
|
|
|
|
2004-03-30 08:55:08 -08:00
|
|
|
|
2004-03-30 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/grid-system.scm: define "map" here,
|
|
|
|
|
|
the script used to take the definition from alien-glow-arrow.scm
|
|
|
|
|
|
or beveled-pattern-arrow.scm. Also added an undo group around all
|
|
|
|
|
|
operations. Fixes bug #138524.
|
|
|
|
|
|
|
2004-03-30 03:16:37 -08:00
|
|
|
|
2004-03-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
2004-03-30 03:32:21 -08:00
|
|
|
|
* app/Makefile.am
|
|
|
|
|
|
* app/sanity.[ch]: new files implementing sanity_check() for
|
|
|
|
|
|
run-time checking library versions. Added a check for FreeType but
|
|
|
|
|
|
disabled it until we figured if and how freetype causes some of
|
|
|
|
|
|
the DLL hell bugs.
|
|
|
|
|
|
|
|
|
|
|
|
* app/main.c (main): call it and abort if it fails.
|
|
|
|
|
|
|
|
|
|
|
|
* app/app_procs.[ch]: added app_gui_abort() so main.c doesn't
|
|
|
|
|
|
need to #include "gui/gui.h"
|
|
|
|
|
|
|
|
|
|
|
|
* app/gui/gui.[ch] (gui_libs_init): removed library sanity checking.
|
|
|
|
|
|
|
|
|
|
|
|
(gui_abort): new function which shows the abort message.
|
|
|
|
|
|
|
|
|
|
|
|
2004-03-30 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in (ALL_LINGUAS): revert addition of "pa" until
|
2004-03-30 03:16:37 -08:00
|
|
|
|
all .po files are there.
|
|
|
|
|
|
|
2004-03-30 02:00:26 -08:00
|
|
|
|
2004-03-20 Guntupalli Karunakar <karunakar@freedomink.org>
|
|
|
|
|
|
|
|
|
|
|
|
* configure.in: Added "pa" for Punjabi to ALL_LINGUAS.
|
|
|
|
|
|
|
2004-03-29 15:38:58 -08:00
|
|
|
|
2004-03-29 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/jpeg.c (struct my_error_mgr): Move setjump_buffer
|
|
|
|
|
|
to the beginning of the structure, to make sure it is aligned on a
|
|
|
|
|
|
16-byte boundary for ia64, even with icc. Fixes #138357.
|
|
|
|
|
|
|
2004-03-29 09:54:13 -08:00
|
|
|
|
2004-03-29 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimpguiconfig.c: changed the default for "help-locales"
|
|
|
|
|
|
from NULL to an empty string. Fixes the generated gimprc man-page.
|
|
|
|
|
|
|
|
|
|
|
|
* app/config/gimprc-blurbs.h (HELP_LOCALES_BLURB): added missing
|
|
|
|
|
|
whitespace.
|
|
|
|
|
|
|
|
|
|
|
|
* app/widgets/gimphelp.c: use the user's locale if "help-locales"
|
|
|
|
|
|
is NULL or the empty string.
|
|
|
|
|
|
|
|
|
|
|
|
* docs/gimprc.5.in
|
|
|
|
|
|
* etc/gimprc: regenerated.
|
|
|
|
|
|
|
2004-03-29 01:57:39 -08:00
|
|
|
|
2004-03-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
2004-03-29 01:58:04 -08:00
|
|
|
|
* app/core/core-enums.[ch] (enum GimpUndoType): added new group
|
2004-03-29 01:57:39 -08:00
|
|
|
|
GIMP_UNDO_GROUP_FS_REMOVE.
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimplayer-floating-sel.c (floating_sel_remove): push an
|
|
|
|
|
|
undo group. Fixes undo corruption spotted by Pedro Gimeno.
|
|
|
|
|
|
|
2004-03-29 01:27:30 -08:00
|
|
|
|
2004-03-29 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/guillotine.c (guillotine): Don't just skip
|
|
|
|
|
|
guides at the image edges but any guide which is at a position we
|
|
|
|
|
|
already remembered. Should catch all instances of bug #138312 this
|
|
|
|
|
|
time.
|
|
|
|
|
|
|
2004-03-28 08:09:56 -08:00
|
|
|
|
2004-03-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/ifscompose/ifscompose.c: applied patch from David Necas
|
|
|
|
|
|
that updates the sensitivity of the Delete button and menu entry.
|
2004-03-29 09:54:13 -08:00
|
|
|
|
Fixes bug #138212.
|
2004-03-28 08:09:56 -08:00
|
|
|
|
|
2004-03-28 07:41:31 -08:00
|
|
|
|
2004-03-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/MapObject/mapobject_main.c: fixed non-interactive call.
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/spinning-globe.scm: pass -1 as
|
|
|
|
|
|
drawable ID for unused drawables. Fixes bug #138253.
|
|
|
|
|
|
|
2004-03-28 06:27:37 -08:00
|
|
|
|
2004-03-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/text/gimpfontlist.c (gimp_font_list_add_font): validate the
|
|
|
|
|
|
font name. This should work around the crashes that Windows users
|
|
|
|
|
|
were experiencing on startup (bug #132366). The real problem needs
|
|
|
|
|
|
to be fixed elsewhere though.
|
|
|
|
|
|
|
2004-03-28 06:25:42 -08:00
|
|
|
|
2004-03-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo-push.c (undo_pop_layer): when re-adding
|
|
|
|
|
|
a layer with mask, don't forget to set layer->mask->removed to FALSE.
|
|
|
|
|
|
|
2004-03-28 06:20:57 -08:00
|
|
|
|
2004-03-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpitem.[ch]: added "gboolean removed" to the GimpItem
|
|
|
|
|
|
struct. Defaults to FALSE. Set it to TRUE in gimp_item_removed().
|
|
|
|
|
|
Added public function gimp_item_is_removed().
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpimage-undo-push.c (undo_pop_layer)
|
|
|
|
|
|
(undo_pop_layer_mask) (undo_pop_channel) (undo_pop_vectors):
|
|
|
|
|
|
set it to FALSE manually when re-adding something from the
|
|
|
|
|
|
undo stack.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/app.pl
|
|
|
|
|
|
* tools/pdbgen/pdb.pl: don't allow any operation on items which
|
|
|
|
|
|
are removed from the image (and exist on the undo stack only).
|
|
|
|
|
|
Fixes bug #138311.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/channel_cmds.c
|
|
|
|
|
|
* app/pdb/color_cmds.c
|
|
|
|
|
|
* app/pdb/drawable_cmds.c
|
|
|
|
|
|
* app/pdb/edit_cmds.c
|
|
|
|
|
|
* app/pdb/floating_sel_cmds.c
|
|
|
|
|
|
* app/pdb/image_cmds.c
|
|
|
|
|
|
* app/pdb/layer_cmds.c
|
|
|
|
|
|
* app/pdb/paint_tools_cmds.c
|
|
|
|
|
|
* app/pdb/parasite_cmds.c
|
|
|
|
|
|
* app/pdb/selection_cmds.c
|
|
|
|
|
|
* app/pdb/selection_tools_cmds.c
|
|
|
|
|
|
* app/pdb/transform_tools_cmds.c: regenerated.
|
|
|
|
|
|
|
2004-03-28 04:31:20 -08:00
|
|
|
|
2004-03-28 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/script-fu/scripts/slide.scm: applied a (modified) patch
|
|
|
|
|
|
from Nils Philippsen that fixes bug #138310.
|
|
|
|
|
|
|
2004-03-28 03:58:22 -08:00
|
|
|
|
2004-03-28 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/common/guillotine.c (guillotine): applied a (modified)
|
|
|
|
|
|
patch from Joao S. O. Bueno which removes any guides from the
|
|
|
|
|
|
cropped images. Fixes bug #138314.
|
|
|
|
|
|
|
|
|
|
|
|
Skip guides which are at the image's edges because the algorithm
|
|
|
|
|
|
already assumes that there are always guides at these positions.
|
|
|
|
|
|
Fixes bug #138312.
|
|
|
|
|
|
|
2004-03-26 17:09:00 -08:00
|
|
|
|
2004-03-27 Tor Lillqvist <tml@iki.fi>
|
|
|
|
|
|
|
|
|
|
|
|
* plug-ins/help/Makefile.am (AM_LDFLAGS): Use -mwindows on Windows
|
|
|
|
|
|
to avoid a console window popping up.
|
|
|
|
|
|
|
2004-03-26 08:49:18 -08:00
|
|
|
|
2004-03-26 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/app.pl: don't generate code with tabs.
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/pdb/procedural_db.pdb: convert tabs to spaces in
|
|
|
|
|
|
helper function declaration.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/procedural_db.c: convert tabs to spaces.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/*.c: regenerated, no code changes, only tabs->spaces.
|
|
|
|
|
|
|
2004-03-26 08:38:44 -08:00
|
|
|
|
2004-03-26 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* tools/pdbgen/app.pl: kill whitespace in blank lines.
|
|
|
|
|
|
|
|
|
|
|
|
* app/pdb/*.c: regenerated, no code changes, only whitespace.
|
|
|
|
|
|
|
2004-03-26 02:28:44 -08:00
|
|
|
|
2004-03-26 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/core/gimpdrawable-transform.c
|
|
|
|
|
|
(gimp_drawable_transform_tiles_affine): return NULL tiles if the
|
|
|
|
|
|
matrix would transform the drawable into nothing. Fixes the
|
|
|
|
|
|
core-crashing part of bug #138117 and makes the script fail
|
|
|
|
|
|
with an execution error.
|
|
|
|
|
|
|
2004-03-25 11:08:28 -08:00
|
|
|
|
2004-03-25 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* README: mention the gimp-perl pre-release and provide a link.
|
|
|
|
|
|
|
2004-03-25 09:58:26 -08:00
|
|
|
|
2004-03-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/base/tile-manager.c (tile_manager_new): g_return_if_fail()
|
|
|
|
|
|
on width, height or bpp <= 0. Doesn't fix anything but badly
|
|
|
|
|
|
warns (and helps debugging) on bug #138117.
|
|
|
|
|
|
|
2004-03-25 04:46:20 -08:00
|
|
|
|
2004-03-25 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimpvectortool.c (gimp_vector_tool_button_release):
|
|
|
|
|
|
fixed condition which triggers the path tool's undo hack. Fixes
|
|
|
|
|
|
bug #138086. Also g_object_unref() the undo step.
|
|
|
|
|
|
|
|
|
|
|
|
Removed trailing whitespace.
|
|
|
|
|
|
|
2004-03-25 01:02:28 -08:00
|
|
|
|
2004-03-25 Manish Singh <yosh@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* libgimp/gimp.c
|
|
|
|
|
|
* app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX
|
|
|
|
|
|
shm case. We were leaking an fd here.
|
|
|
|
|
|
|
|
|
|
|
|
* app/tools/gimptexttool.c (gimp_text_tool_connect): remove
|
|
|
|
|
|
unnecessary G_OBJECT() cast in g_object_set() call.
|
|
|
|
|
|
|
2004-03-23 11:24:19 -08:00
|
|
|
|
2004-03-23 Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* autogen.sh: be verbose about AUTOGEN_CONFIGURE_ARGS in the
|
|
|
|
|
|
message that is printed if no arguments were passed.
|
|
|
|
|
|
|
2004-03-23 10:31:35 -08:00
|
|
|
|
2004-03-23 Sven Neumann <sven@gimp.org>
|
|
|
|
|
|
Michael Natterer <mitch@gimp.org>
|
|
|
|
|
|
|
|
|
|
|
|
* Made 2.0.0 release.
|